RPSBLAST alignment for GI: 254780705 and conserved domain: pfam11812

>gnl|CDD|152248 pfam11812, DUF3333, Domain of unknown function (DUF3333). This family of proteins are functionally uncharacterized. This family is only found in bacteria. This presumed domain is typically between 116 to 159 amino acids in length. Length = 155
 Score =  144 bits (365), Expect = 4e-35
 Identities = 57/147 (38%), Positives = 78/147 (53%), Gaps = 2/147 (1%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
              LK RY +E  FR Y + A+L+   FL++LL SIVS G GA  QT I+L +   E ++
Sbjct: 2   DARLKKRYAAERRFRAYGLAAILIGLAFLVILLGSIVSNGYGAFQQTEITLEVTLDEEVL 61

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
           DP   R  DP  L  A+Y  L++ AL   L        L      ++S  A   LR  ++
Sbjct: 62  DPDGNR--DPKKLSTANYRPLIKDALEELLPEVGDRSDLRSDLYSLISEGAAAQLRDFVL 119

Query: 128 TDPSLIGKTVEVSLLASANIDSALKGY 154
            +P LIG TV   LLAS+++D  LKG 
Sbjct: 120 ANPELIGTTVTFWLLASSDVDGYLKGR 146