RPSBLAST alignment for GI: 254780705 and conserved domain: PRK10971

>gnl|CDD|182873 PRK10971, PRK10971, sulfate/thiosulfate transporter subunit; Provisional. Length = 277
 Score = 40.1 bits (94), Expect = 0.001
 Identities = 25/81 (30%), Positives = 43/81 (53%), Gaps = 1/81 (1%)

Query: 286 LALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLA 345
           +A  ++P ++      L  +      AA  LGA++ Q+    VLP   PA+L G  +S  
Sbjct: 147 MAFTSIPFVVRTVQPVLEELGPEYEEAAETLGATRWQSFRKVVLPELSPALLAGVALSFT 206

Query: 346 RALGETAPLLFV-GMVAFVTD 365
           R+LGE   ++F+ G +A+ T+
Sbjct: 207 RSLGEFGAVIFIAGNIAWKTE 227