RPSBLAST alignment for GI: 254780705 and conserved domain: PRK15050

>gnl|CDD|185010 PRK15050, PRK15050, 2-aminoethylphosphonate transport system permease PhnU; Provisional. Length = 296
 Score = 39.6 bits (93), Expect = 0.001
 Identities = 28/85 (32%), Positives = 40/85 (47%), Gaps = 2/85 (2%)

Query: 282 GGLILALMTL--PSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTG 339
           GG+ILA +T   P ++     A   + +    AA  LGAS  +     +LP A PA+  G
Sbjct: 162 GGVILAEITFYTPFVVRPLLAAFAQLDARQLEAAASLGASPWRVARRVILPEAWPALAAG 221

Query: 340 STVSLARALGETAPLLFVGMVAFVT 364
            ++ L   L E   +LF G    VT
Sbjct: 222 GSLCLLLTLNEFGIVLFTGAKDVVT 246