BLAST/PSIBLAST alignment of GI: 254780708 and GI: 23502785 at iteration 1
>gi|23502785|ref|NP_698912.1| intracellular septation protein A [Brucella suis 1330] Length = 220
>gi|62290789|ref|YP_222582.1| intracellular septation protein A [Brucella abortus bv. 1 str. 9-941] Length = 220
>gi|82700700|ref|YP_415274.1| intracellular septation protein A [Brucella melitensis biovar Abortus 2308] Length = 220
>gi|148559014|ref|YP_001259757.1| intracellular septation protein A [Brucella ovis ATCC 25840] Length = 220
>gi|161619853|ref|YP_001593740.1| intracellular septation protein A [Brucella canis ATCC 23365] Length = 220
>gi|163843958|ref|YP_001628362.1| intracellular septation protein A [Brucella suis ATCC 23445] Length = 220
>gi|189025003|ref|YP_001935771.1| intracellular septation protein A [Brucella abortus S19] Length = 220
>gi|237816296|ref|ZP_04595289.1| intracellular septation protein A [Brucella abortus str. 2308 A] Length = 220
>gi|254690076|ref|ZP_05153330.1| intracellular septation protein A [Brucella abortus bv. 6 str. 870] Length = 220
>gi|254694564|ref|ZP_05156392.1| intracellular septation protein A [Brucella abortus bv. 3 str. Tulya] Length = 220
>gi|254696189|ref|ZP_05158017.1| intracellular septation protein A [Brucella abortus bv. 2 str. 86/8/59] Length = 220
>gi|254700576|ref|ZP_05162404.1| intracellular septation protein A [Brucella suis bv. 5 str. 513] Length = 220
>gi|254704946|ref|ZP_05166774.1| intracellular septation protein A [Brucella suis bv. 3 str. 686] Length = 220
>gi|254707540|ref|ZP_05169368.1| intracellular septation protein A [Brucella pinnipedialis M163/99/10] Length = 220
>gi|254708923|ref|ZP_05170734.1| intracellular septation protein A [Brucella pinnipedialis B2/94] Length = 220
>gi|254713650|ref|ZP_05175461.1| intracellular septation protein A [Brucella ceti M644/93/1] Length = 220
>gi|254715996|ref|ZP_05177807.1| intracellular septation protein A [Brucella ceti M13/05/1] Length = 220
>gi|254731107|ref|ZP_05189685.1| intracellular septation protein A [Brucella abortus bv. 4 str. 292] Length = 220
>gi|256030449|ref|ZP_05444063.1| intracellular septation protein A [Brucella pinnipedialis M292/94/1] Length = 220
>gi|256045539|ref|ZP_05448422.1| intracellular septation protein A [Brucella melitensis bv. 1 str. Rev.1] Length = 220
>gi|256112267|ref|ZP_05453188.1| intracellular septation protein A [Brucella melitensis bv. 3 str. Ether] Length = 220
>gi|256158433|ref|ZP_05456331.1| intracellular septation protein A [Brucella ceti M490/95/1] Length = 220
>gi|256253853|ref|ZP_05459389.1| intracellular septation protein A [Brucella ceti B1/94] Length = 220
>gi|256258329|ref|ZP_05463865.1| intracellular septation protein A [Brucella abortus bv. 9 str. C68] Length = 220
>gi|256370337|ref|YP_003107848.1| putative intracellular septation protein [Brucella microti CCM 4915] Length = 220
>gi|260546053|ref|ZP_05821793.1| ATP/GTP-binding site-containing protein A [Brucella abortus NCTC 8038] Length = 220
>gi|260562849|ref|ZP_05833335.1| ATP/GTP-binding site-containing protein A [Brucella melitensis bv. 1 str. 16M] Length = 220
>gi|260567578|ref|ZP_05838048.1| ATP/GTP-binding site-containing protein A [Brucella suis bv. 4 str. 40] Length = 220
>gi|260755614|ref|ZP_05867962.1| intracellular septation protein A [Brucella abortus bv. 6 str. 870] Length = 220
>gi|260758839|ref|ZP_05871187.1| intracellular septation protein A [Brucella abortus bv. 4 str. 292] Length = 220
>gi|260760563|ref|ZP_05872906.1| intracellular septation protein A [Brucella abortus bv. 2 str. 86/8/59] Length = 220
>gi|260884640|ref|ZP_05896254.1| intracellular septation protein A [Brucella abortus bv. 9 str. C68] Length = 220
>gi|261214888|ref|ZP_05929169.1| intracellular septation protein A [Brucella abortus bv. 3 str. Tulya] Length = 220
>gi|261217764|ref|ZP_05932045.1| intracellular septation protein A [Brucella ceti M13/05/1] Length = 220
>gi|261220991|ref|ZP_05935272.1| intracellular septation protein A [Brucella ceti B1/94] Length = 220
>gi|261315021|ref|ZP_05954218.1| intracellular septation protein A [Brucella pinnipedialis M163/99/10] Length = 220
>gi|261316422|ref|ZP_05955619.1| intracellular septation protein A [Brucella pinnipedialis B2/94] Length = 220
>gi|261321388|ref|ZP_05960585.1| intracellular septation protein A [Brucella ceti M644/93/1] Length = 220
>gi|261751084|ref|ZP_05994793.1| intracellular septation protein A [Brucella suis bv. 5 str. 513] Length = 220
>gi|261755646|ref|ZP_05999355.1| intracellular septation protein A [Brucella suis bv. 3 str. 686] Length = 220
>gi|265987493|ref|ZP_06100050.1| intracellular septation protein A [Brucella pinnipedialis M292/94/1] Length = 220
>gi|265991965|ref|ZP_06104522.1| intracellular septation protein A [Brucella melitensis bv. 1 str. Rev.1] Length = 220
>gi|265993698|ref|ZP_06106255.1| intracellular septation protein A [Brucella melitensis bv. 3 str. Ether] Length = 220
>gi|265996950|ref|ZP_06109507.1| intracellular septation protein A [Brucella ceti M490/95/1] Length = 220
>gi|297247176|ref|ZP_06930894.1| intracellular septation protein A [Brucella abortus bv. 5 str. B3196] Length = 220
>gi|306842916|ref|ZP_07475552.1| intracellular septation protein A [Brucella sp. BO2] Length = 220
>gi|306843385|ref|ZP_07475986.1| intracellular septation protein A [Brucella sp. BO1] Length = 220
>gi|75496180|sp|Q57AW3|ISPZ_BRUAB RecName: Full=Probable intracellular septation protein Length = 220
>gi|123546238|sp|Q2YLU9|ISPZ_BRUA2 RecName: Full=Probable intracellular septation protein Length = 220
>gi|166218363|sp|A5VSR0|ISPZ_BRUO2 RecName: Full=Probable intracellular septation protein Length = 220
>gi|189045822|sp|A9M8S1|ISPZ_BRUC2 RecName: Full=Probable intracellular septation protein Length = 220
>gi|189045823|sp|B0CIT9|ISPZ_BRUSI RecName: Full=Probable intracellular septation protein Length = 220
>gi|238689406|sp|B2S888|ISPZ_BRUA1 RecName: Full=Probable intracellular septation protein Length = 220
>gi|23348806|gb|AAN30827.1| intracellular septation protein A [Brucella suis 1330] Length = 220
>gi|62196921|gb|AAX75221.1| IspZ, intracellular septation protein A [Brucella abortus bv. 1 str. 9-941] Length = 220
>gi|82616801|emb|CAJ11891.1| ATP/GTP-binding site motif A (P-loop):Intracellular septation protein A [Brucella melitensis biovar Abortus 2308] Length = 220
>gi|148370271|gb|ABQ60250.1| intracellular septation protein A [Brucella ovis ATCC 25840] Length = 220
>gi|161336664|gb|ABX62969.1| intracellular septation protein A [Brucella canis ATCC 23365] Length = 220
>gi|163674681|gb|ABY38792.1| intracellular septation protein A [Brucella suis ATCC 23445] Length = 220
>gi|189020575|gb|ACD73297.1| ATP/GTP-binding site motif A (P-loop) [Brucella abortus S19] Length = 220
>gi|237788363|gb|EEP62578.1| intracellular septation protein A [Brucella abortus str. 2308 A] Length = 220
>gi|256000500|gb|ACU48899.1| putative intracellular septation protein [Brucella microti CCM 4915] Length = 220
>gi|260096160|gb|EEW80036.1| ATP/GTP-binding site-containing protein A [Brucella abortus NCTC 8038] Length = 220
>gi|260152865|gb|EEW87957.1| ATP/GTP-binding site-containing protein A [Brucella melitensis bv. 1 str. 16M] Length = 220
>gi|260157096|gb|EEW92176.1| ATP/GTP-binding site-containing protein A [Brucella suis bv. 4 str. 40] Length = 220
>gi|260669157|gb|EEX56097.1| intracellular septation protein A [Brucella abortus bv. 4 str. 292] Length = 220
>gi|260670995|gb|EEX57816.1| intracellular septation protein A [Brucella abortus bv. 2 str. 86/8/59] Length = 220
>gi|260675722|gb|EEX62543.1| intracellular septation protein A [Brucella abortus bv. 6 str. 870] Length = 220
>gi|260874168|gb|EEX81237.1| intracellular septation protein A [Brucella abortus bv. 9 str. C68] Length = 220
>gi|260916495|gb|EEX83356.1| intracellular septation protein A [Brucella abortus bv. 3 str. Tulya] Length = 220
>gi|260919575|gb|EEX86228.1| intracellular septation protein A [Brucella ceti B1/94] Length = 220
>gi|260922853|gb|EEX89421.1| intracellular septation protein A [Brucella ceti M13/05/1] Length = 220
>gi|261294078|gb|EEX97574.1| intracellular septation protein A [Brucella ceti M644/93/1] Length = 220
>gi|261295645|gb|EEX99141.1| intracellular septation protein A [Brucella pinnipedialis B2/94] Length = 220
>gi|261304047|gb|EEY07544.1| intracellular septation protein A [Brucella pinnipedialis M163/99/10] Length = 220
>gi|261740837|gb|EEY28763.1| intracellular septation protein A [Brucella suis bv. 5 str. 513] Length = 220
>gi|261745399|gb|EEY33325.1| intracellular septation protein A [Brucella suis bv. 3 str. 686] Length = 220
>gi|262551418|gb|EEZ07408.1| intracellular septation protein A [Brucella ceti M490/95/1] Length = 220
>gi|262764679|gb|EEZ10600.1| intracellular septation protein A [Brucella melitensis bv. 3 str. Ether] Length = 220
>gi|263003031|gb|EEZ15324.1| intracellular septation protein A [Brucella melitensis bv. 1 str. Rev.1] Length = 220
>gi|264659690|gb|EEZ29951.1| intracellular septation protein A [Brucella pinnipedialis M292/94/1] Length = 220
>gi|297174345|gb|EFH33692.1| intracellular septation protein A [Brucella abortus bv. 5 str. B3196] Length = 220
>gi|306276076|gb|EFM57776.1| intracellular septation protein A [Brucella sp. BO1] Length = 220
>gi|306286939|gb|EFM58459.1| intracellular septation protein A [Brucella sp. BO2] Length = 220
 Score =  176 bits (446), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 92/206 (44%), Positives = 131/206 (63%), Gaps = 4/206 (1%)

Query: 2   SRSQSQSKIVCFLL----EFSPGIAFWLCNFYGEKLFFYFPMLSNLGGIIFVSTLLFMVL 57
            +S+++ + V  LL    E  P + F+  N  GE L   FP+L ++G  IF++T LFM  
Sbjct: 12  EKSETERREVPPLLKLALELGPLLVFFFANARGEMLIERFPILGSIGAPIFLATALFMAA 71

Query: 58  TAVSLGMFWFFFREFRVIPVVSGVCVLVFGSLTVWLRDESLIKMKPTFFYFVFSVVLFVG 117
           T ++L + W   R   ++P+VSG+ VLVFG+LT+WL +++ IKMKPT    +F  +L  G
Sbjct: 72  TVIALAISWSMTRTLPIMPLVSGIVVLVFGALTLWLHNDTFIKMKPTIVNTLFGGILLGG 131

Query: 118 YLSGKSFVRFFLSQVICLDSIGWRKLTLRWAFFFLFLSFCNEIVWRNFSTETWIFFKAIG 177
              GKS + +       LD+ GWRKLTLRW  FF+FL+  NEIVWRNFST+TW+ FK  G
Sbjct: 132 LFFGKSLLGYVFDSAFRLDAEGWRKLTLRWGLFFIFLAIVNEIVWRNFSTDTWVSFKVWG 191

Query: 178 IFPIFLIFGIVQMNLINKHTILPEER 203
           I PI ++F ++QM LI KH++  EE 
Sbjct: 192 IMPITIVFTLLQMPLIQKHSLTDEEN 217