RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780708|ref|YP_003065121.1| intracellular septation protein A [Candidatus Liberibacter asiaticus str. psy62] (204 letters) >gnl|CDD|146751 pfam04279, IspA, Intracellular septation protein A. Length = 176 Score = 137 bits (347), Expect = 2e-33 Identities = 66/185 (35%), Positives = 99/185 (53%), Gaps = 16/185 (8%) Query: 13 FLLEFSPGIAFWLCNFYGEKLFFYFPMLSNLGGIIFVSTLLFMVLTAVSLGMFWFFFREF 72 LL+F P I F++ Y I+V+T +V T + L + W + Sbjct: 3 QLLDFGPLILFFVAYKYYG---------------IYVATAALIVATLLQLAILWILTGKV 47 Query: 73 RVIPVVSGVCVLVFGSLTVWLRDESLIKMKPTFFYFVFSVVLFVG-YLSGKSFVRFFLSQ 131 + +++ V V+VFG LT+W D++ IK KPT Y++F++ L G K ++ L + Sbjct: 48 EKMQLITLVLVVVFGGLTLWFHDDTFIKWKPTIIYWLFALALLGGLLFFKKPLLKRMLGK 107 Query: 132 VICLDSIGWRKLTLRWAFFFLFLSFCNEIVWRNFSTETWIFFKAIGIFPIFLIFGIVQMN 191 I L GWRKL LRWA FFLF++ NE V NFST+TW+ FK G+ + L+F + Q Sbjct: 108 AIELPDEGWRKLNLRWALFFLFMAVLNEYVAFNFSTDTWVNFKVFGLMGLTLVFTLAQGP 167 Query: 192 LINKH 196 + KH Sbjct: 168 YLYKH 172 >gnl|CDD|32741 COG2917, COG2917, Intracellular septation protein A [Cell division and chromosome partitioning]. Length = 180 Score = 116 bits (292), Expect = 4e-27 Identities = 67/185 (36%), Positives = 102/185 (55%), Gaps = 16/185 (8%) Query: 13 FLLEFSPGIAFWLCNFYGEKLFFYFPMLSNLGGIIFVSTLLFMVLTAVSLGMFWFFFREF 72 LL+F P I F+ I+ +T + +V T + L + W +R+ Sbjct: 3 QLLDFGPLILFFAAYKVYG---------------IYAATAVLIVATVIQLAILWIKYRKV 47 Query: 73 RVIPVVSGVCVLVFGSLTVWLRDESLIKMKPTFFYFVFSVVLFV-GYLSGKSFVRFFLSQ 131 + ++SGV V+VFG LT+ +++ IK KPT Y++F++VL +L K ++ L + Sbjct: 48 EKMQLISGVVVVVFGGLTLIFHNDTFIKWKPTIIYWLFALVLLGSQFLFKKPLIKRMLGK 107 Query: 132 VICLDSIGWRKLTLRWAFFFLFLSFCNEIVWRNFSTETWIFFKAIGIFPIFLIFGIVQMN 191 + L WRKL LRWA FFLF + NE V RNFST+TW+ FK G+ P+ LIF ++Q Sbjct: 108 ELQLPEEVWRKLNLRWALFFLFCAIANEYVARNFSTDTWVNFKVFGLTPLTLIFTLIQGP 167 Query: 192 LINKH 196 I +H Sbjct: 168 YIYRH 172 >gnl|CDD|144808 pfam01350, Flavi_NS4A, Flavivirus non-structural protein NS4A. Flaviviruses encode a single polyprotein. This is cleaved into three structural and seven non-structural proteins. The NS4A protein is small and poorly conserved among the Flaviviruses. NS4A contains multiple hydrophobic potential membrane spanning regions. NS4A has only been found in cells infected by Kunjin virus. Length = 145 Score = 28.3 bits (64), Expect = 1.5 Identities = 15/68 (22%), Positives = 28/68 (41%), Gaps = 1/68 (1%) Query: 48 FVSTLLFMVLTAVSLGMFWFFFREFRVIPVVSGVCVLVFGSLTVWLRDESLIKMKPT-FF 106 + LL +L +LG+F + + G+ VL+ +W+ K+ Sbjct: 49 LETILLVALLGLATLGVFLLLMARKGIGRMGLGMVVLLVAGGLLWMGGVPPGKIAGVLLI 108 Query: 107 YFVFSVVL 114 +F+ VVL Sbjct: 109 FFLLLVVL 116 >gnl|CDD|34371 COG4757, COG4757, Predicted alpha/beta hydrolase [General function prediction only]. Length = 281 Score = 26.5 bits (58), Expect = 4.9 Identities = 9/31 (29%), Positives = 16/31 (51%) Query: 56 VLTAVSLGMFWFFFREFRVIPVVSGVCVLVF 86 ++ A + G+ +F+R F +G VL F Sbjct: 33 LVVAGATGVGQYFYRRFAAAAAKAGFEVLTF 63 >gnl|CDD|112547 pfam03737, Methyltransf_6, Demethylmenaquinone methyltransferase. Members of this family are demethylmenaquinone methyltransferases that convert dimethylmenaquinone (DMK) to menaquinone (MK) in the final step of menaquinone biosynthesis. This region is also found at the C-terminus of the DlpA protein. Length = 154 Score = 26.5 bits (59), Expect = 5.0 Identities = 10/21 (47%), Positives = 14/21 (66%) Query: 25 LCNFYGEKLFFYFPMLSNLGG 45 LC+ YG ++ P+LSN GG Sbjct: 8 LCDAYGSQVGVVEPILSNFGG 28 >gnl|CDD|36500 KOG1286, KOG1286, KOG1286, Amino acid transporters [Amino acid transport and metabolism]. Length = 554 Score = 26.4 bits (58), Expect = 5.1 Identities = 34/165 (20%), Positives = 55/165 (33%), Gaps = 11/165 (6%) Query: 37 FPMLSNLGGIIFVSTLLFMVLTAVSLGMFWFFFREFRVIPVVSGVCVLVFGSLTVWLRDE 96 +LS+L ++ + + L L +F + R +P+V+ + +FG+L Sbjct: 330 IGLLSSLNSSLYAGSRVLYALAKDGLAPKFFARVDRRGVPLVAVLVSGLFGALAALNFSL 389 Query: 97 SLIKMKPTFFYFVFSVVLFVGYLSGKSFVRF---FLSQVICLDSIGWRKLTLRW------ 147 + LF L S +RF Q LD + ++ T + Sbjct: 390 GAATVFNWLVNLSSIGTLFAWTLVALSHLRFRYAMKVQGRSLDELPYKSPTGPYGSYYGL 449 Query: 148 --AFFFLFLSFCNEIVWRNFSTETWIFFKAIGIFPIFLIFGIVQM 190 L F W FF+A PI LIF I Sbjct: 450 LVNILILLAQFYVAFFPIGSEFSAWGFFEAYLGLPILLIFYIGYK 494 >gnl|CDD|111042 pfam02101, Ocular_alb, Ocular albinism type 1 protein. Length = 407 Score = 26.2 bits (57), Expect = 7.2 Identities = 11/25 (44%), Positives = 13/25 (52%) Query: 21 IAFWLCNFYGEKLFFYFPMLSNLGG 45 IA WL N E L FY M ++ G Sbjct: 254 IACWLSNIINESLLFYLEMQPDIHG 278 >gnl|CDD|39021 KOG3817, KOG3817, KOG3817, Uncharacterized conserved protein [Function unknown]. Length = 452 Score = 25.7 bits (56), Expect = 8.5 Identities = 20/121 (16%), Positives = 42/121 (34%), Gaps = 9/121 (7%) Query: 83 VLVFGSLTVWLRDESLIKMKPTFFYFVFSVVLFVGYLSGKSFVRFFLSQVICLDSIGWRK 142 LVF + + F+Y S + +G L+ V F +++ ++ + Sbjct: 140 FLVFVVGILLFFSARRLSRNSVFYY---SSGIVIGILASLLVVIFLVARFFPKKTMMYGI 196 Query: 143 LTLRWAFFFLFLSFCNEIVWRNFSTETWIFFKAIGIFPIFLIFGIVQMNLINKHTILPEE 202 L W+ + + N WI ++ + LI G++ + K + Sbjct: 197 LIGGWSISLYVIKQ----LADNLQ-LIWIEYR-DYVLGYVLIVGLISFAVCYKIGPPKDP 250 Query: 203 R 203 R Sbjct: 251 R 251 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.338 0.149 0.499 Gapped Lambda K H 0.267 0.0680 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,829,686 Number of extensions: 169377 Number of successful extensions: 1315 Number of sequences better than 10.0: 1 Number of HSP's gapped: 1240 Number of HSP's successfully gapped: 275 Length of query: 204 Length of database: 6,263,737 Length adjustment: 89 Effective length of query: 115 Effective length of database: 4,340,536 Effective search space: 499161640 Effective search space used: 499161640 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.8 bits) S2: 55 (25.1 bits)