RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780708|ref|YP_003065121.1| intracellular septation protein A [Candidatus Liberibacter asiaticus str. psy62] (204 letters) >gnl|CDD|178950 PRK00259, PRK00259, intracellular septation protein A; Reviewed. Length = 179 Score = 136 bits (345), Expect = 4e-33 Identities = 65/193 (33%), Positives = 102/193 (52%), Gaps = 18/193 (9%) Query: 13 FLLEFSPGIAFWLCNFYGEKLFFYFPMLSNLGGIIFVSTLLFMVLTAVSLGMFWFFFREF 72 LL+F P I F F + + I+ +T +V T + L + W +R+ Sbjct: 3 QLLDFLPLILF----------FAAYKL-----YGIYAATAALIVATVIQLAISWIRYRKV 47 Query: 73 RVIPVVSGVCVLVFGSLTVWLRDESLIKMKPTFFYFVFSVVLFVG-YLSGKSFVRFFLSQ 131 + ++S V V+VFG LT+ D++ IK KPT Y++F++ L ++ K ++ L + Sbjct: 48 EKMQLISLVVVVVFGGLTLVFHDDTFIKWKPTIIYWLFALALLGSQFIFKKPLIKRMLGK 107 Query: 132 VICLDSIGWRKLTLRWAFFFLFLSFCNEIVWRNFSTETWIFFKAIGIFPIFLIFGIVQMN 191 + L WRKL L WA FF+F N V RNFST+TW+ FK G+ + L+F ++Q Sbjct: 108 ELTLPDPVWRKLNLAWALFFIFCGLLNLYVARNFSTDTWVNFKVFGLTGLTLVFTLLQGP 167 Query: 192 LINKHTILPEERK 204 + +H LPEE K Sbjct: 168 YLYRH--LPEEDK 178 >gnl|CDD|130070 TIGR00997, ispZ, intracellular septation protein A. This partially characterized protein, whose absence can cause a cell division defect in an intracellularly replicating bacterium, is found only so far only in the Proteobacteria. Length = 178 Score = 103 bits (258), Expect = 5e-23 Identities = 57/185 (30%), Positives = 91/185 (49%), Gaps = 16/185 (8%) Query: 13 FLLEFSPGIAFWLCNFYGEKLFFYFPMLSNLGGIIFVSTLLFMVLTAVSLGMFWFFFREF 72 L+ P I F+ IF +T+ +V T +++G+ + +++ Sbjct: 3 LALDLLPLIVFFATYKMTG---------------IFAATIALLVATIIAIGLSYVKYKKV 47 Query: 73 RVIPVVSGVCVLVFGSLTVWLRDESLIKMKPTFFYFVFSVVLFVGYLSGK-SFVRFFLSQ 131 + +S V ++VFG LT+ D IK KPT Y +F+V+L L GK +++ L + Sbjct: 48 EKMQWISFVLIVVFGGLTLIFHDSRFIKWKPTIIYGLFAVILLGSQLFGKTPGIKYMLGK 107 Query: 132 VICLDSIGWRKLTLRWAFFFLFLSFCNEIVWRNFSTETWIFFKAIGIFPIFLIFGIVQMN 191 L GW KL RWA FF+F++ NE V NFS E W+ FK G+ + IF I Q Sbjct: 108 EFQLTEKGWLKLNFRWAGFFIFMAVLNEYVATNFSEEIWVNFKVFGVTILTFIFIIAQGP 167 Query: 192 LINKH 196 + ++ Sbjct: 168 YLYRN 172 >gnl|CDD|178535 PLN02949, PLN02949, transferase, transferring glycosyl groups. Length = 463 Score = 27.0 bits (60), Expect = 3.7 Identities = 15/49 (30%), Positives = 21/49 (42%), Gaps = 8/49 (16%) Query: 86 FGSLTVWLRDESLIKMKPTFFYFVFSVVLFVGYLSGKSFVRFFLSQVIC 134 GS V+L E+L K P +F+ GY R F +V+C Sbjct: 125 LGS--VYLAWEALCKFTPLYFFDT------SGYAFTYPLARLFGCKVVC 165 >gnl|CDD|177916 PLN02277, PLN02277, H(+) -translocating inorganic pyrophosphatase. Length = 730 Score = 25.5 bits (56), Expect = 9.5 Identities = 12/37 (32%), Positives = 13/37 (35%), Gaps = 12/37 (32%) Query: 104 TFFYFVFSV------------VLFVGYLSGKSFVRFF 128 FY V +L VGY G SFV F Sbjct: 155 ATFYVWLGVDSPGGMKVTDLPLLLVGYGFGASFVALF 191 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.338 0.149 0.499 Gapped Lambda K H 0.267 0.0705 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 3,434,267 Number of extensions: 223566 Number of successful extensions: 1163 Number of sequences better than 10.0: 1 Number of HSP's gapped: 1143 Number of HSP's successfully gapped: 145 Length of query: 204 Length of database: 5,994,473 Length adjustment: 89 Effective length of query: 115 Effective length of database: 4,071,361 Effective search space: 468206515 Effective search space used: 468206515 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.8 bits) S2: 55 (25.0 bits)