BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780708|ref|YP_003065121.1| intracellular septation protein A [Candidatus Liberibacter asiaticus str. psy62] (204 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780708|ref|YP_003065121.1| intracellular septation protein A [Candidatus Liberibacter asiaticus str. psy62] Length = 204 Score = 399 bits (1025), Expect = e-113, Method: Compositional matrix adjust. Identities = 204/204 (100%), Positives = 204/204 (100%) Query: 1 MSRSQSQSKIVCFLLEFSPGIAFWLCNFYGEKLFFYFPMLSNLGGIIFVSTLLFMVLTAV 60 MSRSQSQSKIVCFLLEFSPGIAFWLCNFYGEKLFFYFPMLSNLGGIIFVSTLLFMVLTAV Sbjct: 1 MSRSQSQSKIVCFLLEFSPGIAFWLCNFYGEKLFFYFPMLSNLGGIIFVSTLLFMVLTAV 60 Query: 61 SLGMFWFFFREFRVIPVVSGVCVLVFGSLTVWLRDESLIKMKPTFFYFVFSVVLFVGYLS 120 SLGMFWFFFREFRVIPVVSGVCVLVFGSLTVWLRDESLIKMKPTFFYFVFSVVLFVGYLS Sbjct: 61 SLGMFWFFFREFRVIPVVSGVCVLVFGSLTVWLRDESLIKMKPTFFYFVFSVVLFVGYLS 120 Query: 121 GKSFVRFFLSQVICLDSIGWRKLTLRWAFFFLFLSFCNEIVWRNFSTETWIFFKAIGIFP 180 GKSFVRFFLSQVICLDSIGWRKLTLRWAFFFLFLSFCNEIVWRNFSTETWIFFKAIGIFP Sbjct: 121 GKSFVRFFLSQVICLDSIGWRKLTLRWAFFFLFLSFCNEIVWRNFSTETWIFFKAIGIFP 180 Query: 181 IFLIFGIVQMNLINKHTILPEERK 204 IFLIFGIVQMNLINKHTILPEERK Sbjct: 181 IFLIFGIVQMNLINKHTILPEERK 204 >gi|254780451|ref|YP_003064864.1| aconitate hydratase [Candidatus Liberibacter asiaticus str. psy62] Length = 896 Score = 26.2 bits (56), Expect = 0.39, Method: Composition-based stats. Identities = 11/32 (34%), Positives = 20/32 (62%), Gaps = 3/32 (9%) Query: 69 FREFRVIPVVSGVC---VLVFGSLTVWLRDES 97 F+ FRV+P +G+C L + +VW ++E+ Sbjct: 170 FKNFRVVPPGTGICHQINLEYLGQSVWTKNEN 201 >gi|254780903|ref|YP_003065316.1| two-component sensor histidine kinase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 766 Score = 22.7 bits (47), Expect = 4.7, Method: Composition-based stats. Identities = 14/43 (32%), Positives = 20/43 (46%), Gaps = 2/43 (4%) Query: 161 VWRNFSTETWIFFKAIGIFPIFLIFGIVQMNLINKH--TILPE 201 +WR T +FF I +F++F + NK TIL E Sbjct: 210 LWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLE 252 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.338 0.149 0.499 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 136,282 Number of Sequences: 1233 Number of extensions: 5875 Number of successful extensions: 30 Number of sequences better than 100.0: 13 Number of HSP's better than 100.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 5 Number of HSP's that attempted gapping in prelim test: 21 Number of HSP's gapped (non-prelim): 14 length of query: 204 length of database: 328,796 effective HSP length: 70 effective length of query: 134 effective length of database: 242,486 effective search space: 32493124 effective search space used: 32493124 T: 11 A: 40 X1: 15 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.8 bits) S2: 36 (18.5 bits)