HHsearch alignment for GI: 254780709 and conserved domain: cd02042

>cd02042 ParA ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation. ParB binds to DNA sequences adjacent to the origin of replication and localizes to opposite cell poles shortly following the initiation of DNA replication. ParB regulates the ParA ATPase activity by promoting nucleotide exchange in a fashion reminiscent of the exchange factors of eukaryotic G proteins. ADP-bound ParA binds single-stranded DNA, whereas the ATP-bound form dissociates ParB from its DNA binding sites. Increasing the fraction of ParA-ADP in the cell inhibits cell division, suggesting that this simple nucleotide switch may regulate cytokinesis. ParA shares sequence similarity to a conserved and widespread family of ATPases which includes the repA protein of the repABC operon in R. etli Sym plasmid. This operon is involved in the plasmid replication and partition.
Probab=98.27  E-value=1.4e-06  Score=66.49  Aligned_cols=47  Identities=36%  Similarity=0.429  Sum_probs=41.9

Q ss_pred             CCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEE
Q ss_conf             44442478999999985226742677434512456889999975303532122358661245422899996514875998
Q gi|254780709|r  120 NGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLII  199 (321)
Q Consensus       120 nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~~~Dvvli  199 (321)
T Consensus         9 GGvGKtt~~~~la~~~a~~g~~vl~iD~DpQ-------------------------------------------yD~iiI   45 (104)
T cd02042           9 GGVGKTTTAVNLAAALARRGKRVLLIDLDPQ-------------------------------------------YDYIII   45 (104)
T ss_pred             CCCCHHHHHHHHHHHHHHCCCEEEEEECCCC-------------------------------------------CCEEEE
T ss_conf             9876899999999999977992999977988-------------------------------------------888999


Q ss_pred             ECCCCCCCHH
Q ss_conf             6543332115
Q gi|254780709|r  200 DTAGRLHNNS  209 (321)
Q Consensus       200 DTAGR~~~~~  209 (321)
T Consensus        46 Dtpp~~~~~~   55 (104)
T cd02042          46 DTPPSLGLLT   55 (104)
T ss_pred             ECCCCCCHHH
T ss_conf             7949998999