>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake. NatB possess six putative membrane spanning regions at its C-terminus. In B. subtilis, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane. The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system. Hence, the functional NatAB is presumably assembled with two copies of the single ATP-binding protein and the single intergral membrane protein.

Probab=96.17 E-value=0.0032 Score=42.91 Aligned_cols=66 Identities=20% Similarity=0.243 Sum_probs=39.9 Q ss_pred HHHHHHHHHHHHCCCCCCCCCCCCCC-CCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCC Q ss_conf 99999998785201001210001366-7412311354444424789999999852267426774345 Q gi|254780709|r 84 VLYDVSELIHKMLMPLSKPFNWDFSH-RPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDT 149 (321) Q Consensus 84 i~~~l~~~L~~~L~~~~~~~~~~~~~-~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~Dt 149 (321) T Consensus 19 ~~~~~~~~l~K~yg~~~al~~vsf~i~~Gei~gLlGpNGaGKSTllk~l~Gl~~p~~G~I~v~G~~~ 85 (236) T cd03267 19 LIGSLKSLFKRKYREVEALKGISFTIEKGEIVGFIGPNGAGKTTTLKILSGLLQPTSGEVRVAGLVP 85 (236) T ss_pred HHHHHHHHEECCCCCEEEECCCEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECCEEC T ss_conf 8898664524554998986680578848959999999983099999999649488715999999985

HHsearch alignment for GI: 254780709 and conserved domain: cd03267