>pfam03796 DnaB_C DnaB-like helicase C terminal domain. The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork. Although the mechanism by which DnaB both couples ATP hydrolysis to translocation along DNA and denatures the duplex is unknown, a change in the quaternary structure of the protein involving dimerization of the N-terminal domain has been observed and may occur during the enzymatic cycle. This C-terminal domain contains an ATP-binding site and is therefore probably the site of ATP hydrolysis.

Probab=97.81 E-value=0.00047 Score=48.77 Aligned_cols=90 Identities=13% Similarity=0.131 Sum_probs=58.2 Q ss_pred CCEEECCCCCCCCHHHHHHHHHHHHH-HCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCC-CCHHH--HHHHH Q ss_conf 41231135444442478999999985-2267426774345124568899999753035321223586-61245--42289 Q gi|254780709|r 111 PHVILVVGVNGVGKTTVIGKLSKKMS-DAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGS-DAAAL--AYEAF 186 (321) Q Consensus 111 p~vil~vG~nG~GKTTT~aKLA~~~~-~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~-dp~~v--~~~a~ 186 (321) T Consensus 19 G~l~vi~g~pg~GKS~~~~~~a~~~a~~~g~~Vl~~slEm~~~--~~~~R~~a~~~~v~~~~i~~~~~~~~~~~~~~~~~ 96 (186) T pfam03796 19 GDLIIIAARPSMGKTAFALNIARNAALKQDKPVLFFSLEMSAE--QLAERLLSSESRISSSKLRSGQLSDEDWERLAEAA 96 (186) T ss_pred CCEEEEEECCCCCHHHHHHHHHHHHHHHCCCCEEEECCCCCHH--HHHHHHHHHHHCCCHHHHHCCCHHHHHHHHHHHHH T ss_conf 8179999679998799999999999997099668754755299--99999999862676555412512167999999999 Q ss_pred HHHHHHCCCEEEEECCCC Q ss_conf 999651487599865433 Q gi|254780709|r 187 KQAQAKKVDVLIIDTAGR 204 (321) Q Consensus 187 ~~a~~~~~DvvliDTAGR 204 (321) T Consensus 97 ~--~~~~~~l~i~~~~~~ 112 (186) T pfam03796 97 G--ELSEAPLYIDDTPGL 112 (186) T ss_pred H--HHHCCCEEEECCCCC T ss_conf 9--985398688479999

HHsearch alignment for GI: 254780709 and conserved domain: pfam03796