HHsearch alignment for GI: 254780711 and conserved domain: COG2894

>COG2894 MinD Septum formation inhibitor-activating ATPase [Cell division and chromosome partitioning].
Probab=96.79  E-value=0.0074  Score=42.01  Aligned_cols=37  Identities=38%  Similarity=0.531  Sum_probs=31.3

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEECCCCC
Q ss_conf             99623443334688999999998614895078205422
Q gi|254780711|r  103 IMLVGLQGSGKTTTTAKIAYHLKTLKKKKILMASLDVH  140 (461)
Q Consensus       103 IllvGl~GsGKTTT~aKLA~~~~~~~~~kV~lv~~Dt~  140 (461)
T Consensus         6 VvTSGKGGVGKTTttAnig~aLA~-~GkKv~liD~DiG   42 (272)
T COG2894           6 VVTSGKGGVGKTTTTANIGTALAQ-LGKKVVLIDFDIG   42 (272)
T ss_pred             EEECCCCCCCCCCHHHHHHHHHHH-CCCEEEEEECCCC
T ss_conf             994488876743106778999997-3985999966767