HHsearch alignment for GI: 254780711 and conserved domain: PRK07994

>PRK07994 DNA polymerase III subunits gamma and tau; Validated.
Probab=96.44  E-value=0.11  Score=32.96  Aligned_cols=219  Identities=16%  Similarity=0.182  Sum_probs=92.1

Q ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEECCCCCCCHHHHHHHHHHHCCCCCCCCC----CCCCHHHHHHH
Q ss_conf             88418996234433346889999999986148950782054221004779999851034742223----32103689999
Q gi|254780711|r   98 PSPLVIMLVGLQGSGKTTTTAKIAYHLKTLKKKKILMASLDVHRPAAQEQLRYLGEQIQVDTLEV----IPEQSPEKIAI  173 (461)
Q Consensus        98 ~~p~vIllvGl~GsGKTTT~aKLA~~~~~~~~~kV~lv~~Dt~R~aA~eQL~~~a~~~~v~~~~~----~~~~dp~~i~~  173 (461)
T Consensus        36 r~~haylf~G~rG~GKtt~ari~ak~lnc~~~~--~~~pcg~-----c~~c~~i~~g~~~d~~eidaas~~~vd~~rel~  108 (643)
T PRK07994         36 RIHHAYLFSGTRGVGKTSIARLLAKGLNCETGI--TATPCGV-----CDNCREIEQGRFVDLIEIDAASRTKVEDTRDLL  108 (643)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCC--CCCCCCC-----CHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHH
T ss_conf             866348745899888889999999996799999--9997876-----776898865898875886367778889999999


Q ss_pred             HHHHHHH-HCCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCHHCCHH-----HHHHHHHHH----------
Q ss_conf             9999997-415886998334422211246899999985138511000310111225-----688889887----------
Q gi|254780711|r  174 RATQSAR-DGGYDAVILDTAGRNHINDSLMQEISEIKSLTNPHEILLVADALTGQD-----AVHLARNFD----------  237 (461)
Q Consensus       174 ~a~~~a~-~~~~D~iiiDTaGR~~~d~~lm~El~~i~~~~~p~e~~lV~da~~Gq~-----a~~~a~~F~----------  237 (461)
T Consensus       109 ~~~~y~p~~~r~kvyiidEvhmls~~a--fnalLKtlEe-Pp~hv~fil-aTT~~~k~p~TilSRC~~f~~~~~~~~~i~  184 (643)
T PRK07994        109 DNVQYAPARGRFKVYLIDEVHMLSRHS--FNALLKTLEE-PPAHVKFLL-ATTDPQKLPVTILSRCLQFHLKALDVEQIR  184 (643)
T ss_pred             HHCCCCCCCCCEEEEEEECHHHCCHHH--HHHHHHHHCC-CCHHCEEEE-ECCCHHHCCHHHHHHHHHEECCCCCHHHHH
T ss_conf             844668877853699972210158999--9999986237-861008998-607745484789977765001669999999


Q ss_pred             ---------HHCCCCCEEEEECCCCCCCC--HHHHHHHHHCCCHHHEECCCCCCCCCCCCHHHHHHHHHCCCCHHHHHHH
Q ss_conf             ---------63584407764115766330--3677788847873026158672321001368899877358627889998
Q gi|254780711|r  238 ---------KIVDLTGIILTRMDGDGRGG--AALSMRTVTGKPIKAIGTGEKINDLENFFPDRIANRILGMGDVVSLVEK  306 (461)
Q Consensus       238 ---------~~~~i~giIlTKlD~~akgG--~als~~~~~~~PI~fig~GE~~~dle~F~p~~~~~riLGmgD~~~l~e~  306 (461)
T Consensus       185 ~~l~~i~~~e~i~~~~~al~~ia~~a~gs~rdalsl~dq---~i~~-~~~~-~~-------~~~v~~mlg~~d~~~~~~l  252 (643)
T PRK07994        185 HQLEHILNEEHIAHEPRALQLLARAADGSLRDALSLTDQ---AIAS-GDGQ-VS-------TQAVSAMLGTLDDDQALSL  252 (643)
T ss_pred             HHHHHHHHHCCCCCCHHHHHHHHHHCCCCHHHHHHHHHH---HHHH-CCCC-CC-------HHHHHHHHCCCCHHHHHHH
T ss_conf             999999997599878899999999747865668889999---9986-5897-47-------9999998589987899999


Q ss_pred             HHHHHHHHHH--HHHHHHHHCCCCCHHHHHHHHHH
Q ss_conf             7421126789--98886531046379999999999
Q gi|254780711|r  307 AARNLNEKQA--ALTAKKIAKGKFDLEDLAEQFRQ  339 (461)
Q Consensus       307 ~~~~~d~~~~--~~l~~k~~~g~F~l~Df~~Ql~~  339 (461)
T Consensus       253 l~al~~~d~~~~~~~~~~~~~~~~~~~~~l~~l~~  287 (643)
T PRK07994        253 VEALVEANGERVMALINEAAARGIEWEALLVEMLS  287 (643)
T ss_pred             HHHHHHCCHHHHHHHHHHHHHHCCCHHHHHHHHHH
T ss_conf             99999569999999999999868899999999999