HHsearch alignment for GI: 254780711 and conserved domain: PRK09112

>PRK09112 DNA polymerase III subunit delta'; Validated.
Probab=96.55  E-value=0.027  Score=37.74  Aligned_cols=30  Identities=23%  Similarity=0.375  Sum_probs=26.2

Q ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHHHH
Q ss_conf             588418996234433346889999999986
Q gi|254780711|r   97 APSPLVIMLVGLQGSGKTTTTAKIAYHLKT  126 (461)
Q Consensus        97 ~~~p~vIllvGl~GsGKTTT~aKLA~~~~~  126 (461)
T Consensus        42 gRl~HA~Lf~GP~GiGKaTlA~~~A~~Ll~   71 (352)
T PRK09112         42 GRLHHALLFEGPEGIGKATLAFHLANHILS   71 (352)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHC
T ss_conf             996524653589980899999999999866