HHsearch alignment for GI: 254780711 and conserved domain: PRK09302

>PRK09302 circadian clock protein KaiC; Reviewed.
Probab=97.61  E-value=0.0008  Score=49.37  Aligned_cols=111  Identities=12%  Similarity=0.041  Sum_probs=63.4

Q ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEECCCCCCCHHHHHHHHHHHCCCCCCCC-------------CC-C
Q ss_conf             841899623443334688999999998614895078205422100477999985103474222-------------33-2
Q gi|254780711|r   99 SPLVIMLVGLQGSGKTTTTAKIAYHLKTLKKKKILMASLDVHRPAAQEQLRYLGEQIQVDTLE-------------VI-P  164 (461)
Q Consensus        99 ~p~vIllvGl~GsGKTTT~aKLA~~~~~~~~~kV~lv~~Dt~R~aA~eQL~~~a~~~~v~~~~-------------~~-~  164 (461)
T Consensus        23 ~g~~~LV~G~pGsGKTtla~QfL~~Ga~~~GE~~lyitl~E~----~~~l~~~~~~~g~~~~~~~~~~~l~i~d~~~~~~   98 (501)
T PRK09302         23 KGRPTLVSGTAGTGKTLFALQFLHNGIKSFGEPGVFVTFEES----PEDIIRNVASFGWDLQKLIDEGKLFILDASPDPS   98 (501)
T ss_pred             CCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCC----HHHHHHHHHHCCCCHHHHHHCCCEEEEECCCCCC
T ss_conf             997799983899999999999999998855997899985799----9999999998499868973268389996156743


Q ss_pred             ------CCHHHHHHHHHHHHHHHCCCCEEEEECCC--CC--CCHHHHHHHHHHHHHHCC
Q ss_conf             ------10368999999999974158869983344--22--211246899999985138
Q gi|254780711|r  165 ------EQSPEKIAIRATQSARDGGYDAVILDTAG--RN--HINDSLMQEISEIKSLTN  213 (461)
Q Consensus       165 ------~~dp~~i~~~a~~~a~~~~~D~iiiDTaG--R~--~~d~~lm~El~~i~~~~~  213 (461)
T Consensus        99 ~~~~~~~~dL~~l~~~I~~~v~~~~~~RvViDSlt~l~~~~~~~~~~R~~l~~L~~~l~  157 (501)
T PRK09302         99 EQEEAGEYDLSALIERIEYAIRKIKAKRVVIDSIEALFQQYDNPAVVRRELFRLFAWLK  157 (501)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHCCCEEEECCHHHHHHHCCCHHHHHHHHHHHHHHHH
T ss_conf             11133447689999999999997199999999978998763587899999999999998