HHsearch alignment for GI: 254780711 and conserved domain: PRK10416

>PRK10416 cell division protein FtsY; Provisional.
Probab=100.00  E-value=0  Score=616.58  Aligned_cols=284  Identities=33%  Similarity=0.535  Sum_probs=263.3

Q ss_pred             HHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             99999998742888789899999999999999852469699999999999998303111269989999999999999871
Q gi|254780711|r    7 ERLGSIFQNITGKGSLSETDISNTLREIRRTFLEADVSLEVVQSFSKRVQEKAKGEKILRSIQPGQMVIKIVHDELVEVL   86 (461)
Q Consensus         7 ~~l~~~~~~l~~~~~l~e~~i~~~l~ei~~aLLeaDV~~~vv~~~~~~Ik~k~~~~~~~~~~~~~~~i~kiv~~eL~~lL   86 (461)
T Consensus       210 ~~l~~~~~~lf~~kkiD~~~----~eeLEe~Li~aDvGv~tt~~ii~~l~~~~~~~~~----~~~~~l~~~l~~~~~~il  281 (499)
T PRK10416        210 ENLGSGFISLFRGKKIDDDL----FEELEEQLLIADVGVETTRKIITNLTEGASRKQL----RDAEALYGLLKEEMGEIL  281 (499)
T ss_pred             HHHHHHHHHHHCCCCCCHHH----HHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCC----CCHHHHHHHHHHHHHHHH
T ss_conf             99999999986689888899----9999999997205999999999999999986479----999999999999999987


Q ss_pred             CCCCCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEECCCCCCCHHHHHHHHHHHCCCCCCCCCCCCC
Q ss_conf             87742100025884189962344333468899999999861489507820542210047799998510347422233210
Q gi|254780711|r   87 GKESIELDLNAPSPLVIMLVGLQGSGKTTTTAKIAYHLKTLKKKKILMASLDVHRPAAQEQLRYLGEQIQVDTLEVIPEQ  166 (461)
Q Consensus        87 g~~~~~l~~~~~~p~vIllvGl~GsGKTTT~aKLA~~~~~~~~~kV~lv~~Dt~R~aA~eQL~~~a~~~~v~~~~~~~~~  166 (461)
T Consensus       282 ~~~~~~l~~~~~~P~VIl~vGvNG~GKTTTigKLA~~~~~-~gkkVllaA~DTfRaAAieQL~~w~~r~~v~vi~~~~g~  360 (499)
T PRK10416        282 AKVDEPLNVEGKTPFVILMVGVNGVGKTTTIGKLARQFEQ-QGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGA  360 (499)
T ss_pred             HCCCCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHH-CCCCEEEEEECCCCHHHHHHHHHHHCCCCCEEEECCCCC
T ss_conf             3104466568999879999747878789899999999997-799537884066756899999998424573698368999


Q ss_pred             HHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHHHHCC------CCCCCCCCCHHCCHHHHHHHHHHHHHC
Q ss_conf             36899999999997415886998334422211246899999985138------511000310111225688889887635
Q gi|254780711|r  167 SPEKIAIRATQSARDGGYDAVILDTAGRNHINDSLMQEISEIKSLTN------PHEILLVADALTGQDAVHLARNFDKIV  240 (461)
Q Consensus       167 dp~~i~~~a~~~a~~~~~D~iiiDTaGR~~~d~~lm~El~~i~~~~~------p~e~~lV~da~~Gq~a~~~a~~F~~~~  240 (461)
T Consensus       361 Dpa~V~~dai~~a~~~~~DvviiDTAGRl~~~~~LM~EL~ki~rvi~k~~~~aP~e~lLVlDa~tGQna~~qak~F~e~~  440 (499)
T PRK10416        361 DSASVIFDAIQAAKARNVDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKLFHEAV  440 (499)
T ss_pred             CHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCEEEEEEECCCCHHHHHHHHHHHHCC
T ss_conf             97999999999999729998998577643260999999999999997237899974899977876778999999984427


Q ss_pred             CCCCEEEEECCCCCCCCHHHHHHHHHCCCHHHEECCCCCCCCCCCCHHHHHHHHHCCCC
Q ss_conf             84407764115766330367778884787302615867232100136889987735862
Q gi|254780711|r  241 DLTGIILTRMDGDGRGGAALSMRTVTGKPIKAIGTGEKINDLENFFPDRIANRILGMGD  299 (461)
Q Consensus       241 ~i~giIlTKlD~~akgG~als~~~~~~~PI~fig~GE~~~dle~F~p~~~~~riLGmgD  299 (461)
T Consensus       441 ~ltGiIlTKlDGtAKGG~~lsi~~~~~~PI~fiG~GE~idDL~~F~~~~Fv~aLf~~e~  499 (499)
T PRK10416        441 GLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDFIEALFARED  499 (499)
T ss_pred             CCCEEEEECCCCCCCCHHHHHHHHHHCCCEEEEECCCCHHHCCCCCHHHHHHHHHCCCC
T ss_conf             99759996567788525999999998839599867988220667798999999844799