HHsearch alignment for GI: 254780711 and conserved domain: PRK11545

>PRK11545 gntK gluconate kinase 1; Provisional.
Probab=95.46  E-value=0.02  Score=38.75  Aligned_cols=53  Identities=21%  Similarity=0.319  Sum_probs=38.1

Q ss_pred             CCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEECCCCCCCHH-HHHHHHHHHCCCCCC
Q ss_conf             2588418996234433346889999999986148950782054221004-779999851034742
Q gi|254780711|r   96 NAPSPLVIMLVGLQGSGKTTTTAKIAYHLKTLKKKKILMASLDVHRPAA-QEQLRYLGEQIQVDT  159 (461)
Q Consensus        96 ~~~~p~vIllvGl~GsGKTTT~aKLA~~~~~~~~~kV~lv~~Dt~R~aA-~eQL~~~a~~~~v~~  159 (461)
T Consensus         4 ~~~~~~iiVVMGVsGsGKSTig~~LA~~l----~~--~fiegDdfHp~~Ni~KM~-----~GiPL   57 (177)
T PRK11545          4 TNHDHHIYVLMGVSGSGKSAVASAVAHQL----HA--AFLDGDFLHPRCNIEKMA-----SGEPL   57 (177)
T ss_pred             CCCCCEEEEEECCCCCCHHHHHHHHHHHH----CC--CEECCCCCCCHHHHHHHH-----CCCCC
T ss_conf             67887599998479899999999999981----99--855365558999999862-----89999