HHsearch alignment for GI: 254780711 and conserved domain: PRK11701

>PRK11701 phnK phosphonates transport ATP-binding protein; Provisional.
Probab=95.57  E-value=0.11  Score=33.14  Aligned_cols=53  Identities=26%  Similarity=0.281  Sum_probs=33.3

Q ss_pred             CCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEC-----CCCCCCHHHHH
Q ss_conf             100025884189962344333468899999999861489507820-----54221004779
Q gi|254780711|r   92 ELDLNAPSPLVIMLVGLQGSGKTTTTAKIAYHLKTLKKKKILMAS-----LDVHRPAAQEQ  147 (461)
Q Consensus        92 ~l~~~~~~p~vIllvGl~GsGKTTT~aKLA~~~~~~~~~kV~lv~-----~Dt~R~aA~eQ  147 (461)
T Consensus        26 s~~v~~G--Ei~~iiG~nGaGKSTLl~~i~G~~~p~~G~-I~~~g~~~~~~~~~~~~~~~~   83 (258)
T PRK11701         26 SFDLYPG--EVLGIVGESGSGKTTLLNALSARLAPDAGE-VHYRMRDGQLRDLYALSEAER   83 (258)
T ss_pred             EEEECCC--CEEEEECCCCCCHHHHHHHHHCCCCCCCCE-EEECCCCCCCCCHHHCCHHHH
T ss_conf             7788799--799998889988999999985678888873-997461157677344599999