HHsearch alignment for GI: 254780711 and conserved domain: TIGR03015

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily. Members of this protein are marked as probable ATPases by the nucleotide binding P-loop motif GXXGXGKTT, a motif DEAQ similar to the DEAD/H box of helicases, and extensive homology to ATPases of MSHA-type pilus systems and to GspA proteins associated with type II protein secretion systems.
Probab=97.69  E-value=0.00068  Score=49.91  Aligned_cols=144  Identities=17%  Similarity=0.187  Sum_probs=82.1

Q ss_pred             EEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEECCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHH-
Q ss_conf             1899623443334688999999998614895078205422100477999985103474222332103689999999999-
Q gi|254780711|r  101 LVIMLVGLQGSGKTTTTAKIAYHLKTLKKKKILMASLDVHRPAAQEQLRYLGEQIQVDTLEVIPEQSPEKIAIRATQSA-  179 (461)
Q Consensus       101 ~vIllvGl~GsGKTTT~aKLA~~~~~~~~~kV~lv~~Dt~R~aA~eQL~~~a~~~~v~~~~~~~~~dp~~i~~~a~~~a-  179 (461)
T Consensus        44 g~~lltGe~GtGKTtllr~l~~~l~~-~~~~~~~i~-~~~-l~~~~ll~~i~~~lg~~~~-~~~~~~~~~~l~~~L~~~~  119 (269)
T TIGR03015        44 GFILITGEVGAGKTTLIRNLLKRLDQ-ERVVAAKLV-NTR-VDAEDLLRMVAADFGLETE-GRDKAALLRELEDFLIEQF  119 (269)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHCCC-CCEEEEEEC-CCC-CCHHHHHHHHHHHCCCCCC-CCCHHHHHHHHHHHHHHHH
T ss_conf             65999729989889999999984593-454899976-999-9999999999998598988-9899999999999999999


Q ss_pred             HHCCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCHHCCHHHHH------HHHHHHHHCCCCCEEEEECCC
Q ss_conf             7415886998334422211246899999985138511000310111225688------889887635844077641157
Q gi|254780711|r  180 RDGGYDAVILDTAGRNHINDSLMQEISEIKSLTNPHEILLVADALTGQDAVH------LARNFDKIVDLTGIILTRMDG  252 (461)
Q Consensus       180 ~~~~~D~iiiDTaGR~~~d~~lm~El~~i~~~~~p~e~~lV~da~~Gq~a~~------~a~~F~~~~~i~giIlTKlD~  252 (461)
T Consensus       120 ~~g~~~vliIDEAq~L--~~~~Le~Lr~L~n~e~~~~~ll~i-iL~GqpeL~~~L~~~~~~~l~qRI~~-~~~L~pl~~  194 (269)
T TIGR03015       120 AAGKRALLVVDEAQNL--TPELLEELRMLSNFQTDNAKLLQI-FLVGQPEFRETLQSPQLQQLRQRIIA-SCHLGPLDR  194 (269)
T ss_pred             HCCCCEEEEEECHHHC--CHHHHHHHHHHHCCCCCCCCCEEE-EEECCHHHHHHHCCCCHHHHHHCEEE-EEEECCCCH
T ss_conf             6699469997242219--999999999997013588870489-99578679998727402545550767-998479998