HHsearch alignment for GI: 254780711 and conserved domain: TIGR03420

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members of this protein family are Hda (Homologous to DnaA). These proteins are about half the length of DnaA and homologous over length of Hda. In the model species Escherichia coli, the initiation of DNA replication requires DnaA bound to ATP rather than ADP; Hda helps facilitate the conversion of DnaA-ATP to DnaA-ADP.
Probab=95.92  E-value=0.045  Score=36.01  Aligned_cols=79  Identities=18%  Similarity=0.122  Sum_probs=45.5

Q ss_pred             EEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEECCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             18996234433346889999999986148950782054221004779999851034742223321036899999999997
Q gi|254780711|r  101 LVIMLVGLQGSGKTTTTAKIAYHLKTLKKKKILMASLDVHRPAAQEQLRYLGEQIQVDTLEVIPEQSPEKIAIRATQSAR  180 (461)
Q Consensus       101 ~vIllvGl~GsGKTTT~aKLA~~~~~~~~~kV~lv~~Dt~R~aA~eQL~~~a~~~~v~~~~~~~~~dp~~i~~~a~~~a~  180 (461)
T Consensus        39 ~~l~i~G~~GsGKTHLl~a~~~~~~~-~~~~~~yl~~~~~~~~~~~----------------------------~l~--~   87 (226)
T TIGR03420        39 RFLYLWGESGSGKSHLLQAACAAAEE-RGKSAIYLPLAELAQADPE----------------------------VLE--G   87 (226)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHC-CCCCEEEECHHHHHHHHHH----------------------------HHH--H
T ss_conf             86999899999889999999999862-6995799529998775399----------------------------997--2


Q ss_pred             HCCCCEEEEECCCCCCCHHHHHHHHHHHHH
Q ss_conf             415886998334422211246899999985
Q gi|254780711|r  181 DGGYDAVILDTAGRNHINDSLMQEISEIKS  210 (461)
Q Consensus       181 ~~~~D~iiiDTaGR~~~d~~lm~El~~i~~  210 (461)
T Consensus        88 l~~~d~l~iDDi~~i~~~~~~e~~lF~l~N  117 (226)
T TIGR03420        88 LEQADLVCLDDVEAIAGQPEWQEALFHLYN  117 (226)
T ss_pred             CCCCCEEEEECHHHHCCCHHHHHHHHHHHH
T ss_conf             744899999663334378378999999999