HHsearch alignment for GI: 254780711 and conserved domain: cd01122

>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases. Helicases couple NTP hydrolysis to the unwinding of nucleic acid duplexes into their component strands.
Probab=97.44  E-value=0.0042  Score=43.91  Aligned_cols=144  Identities=18%  Similarity=0.148  Sum_probs=81.7

Q ss_pred             EEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEECCCCCCCHHHHHHHHHHHCCCCCCCCCCCCC-HHHHHHHHHHHHH
Q ss_conf             189962344333468899999999861489507820542210047799998510347422233210-3689999999999
Q gi|254780711|r  101 LVIMLVGLQGSGKTTTTAKIAYHLKTLKKKKILMASLDVHRPAAQEQLRYLGEQIQVDTLEVIPEQ-SPEKIAIRATQSA  179 (461)
Q Consensus       101 ~vIllvGl~GsGKTTT~aKLA~~~~~~~~~kV~lv~~Dt~R~aA~eQL~~~a~~~~v~~~~~~~~~-dp~~i~~~a~~~a  179 (461)
T Consensus        31 eL~viaarpg~GKT~f~~~~a~~~~~~~g~~vl~~SlEm~~~~--~~~Rlls~~~g~~~~~~~~~~~~~~e~~~~~~~~~  108 (271)
T cd01122          31 ELIILTAGTGVGKTTFLREYALDLITQHGVRVGTISLEEPVVR--TARRLLGQYAGKRLHLPDTVFIYTLEEFDAAFDEF  108 (271)
T ss_pred             CEEEEEECCCCCHHHHHHHHHHHHHHHCCCEEEEEECCCCHHH--HHHHHHHHHHCCCHHHCCCCCCCHHHHHHHHHHHH
T ss_conf             0899996899869999999999999976990899970499999--99999999829971103446778099999999997


Q ss_pred             HHCCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCHHC-----CH---H-------HHHHHHHHHHHCCCCC
Q ss_conf             7415886998334422211246899999985138511000310111-----22---5-------6888898876358440
Q gi|254780711|r  180 RDGGYDAVILDTAGRNHINDSLMQEISEIKSLTNPHEILLVADALT-----GQ---D-------AVHLARNFDKIVDLTG  244 (461)
Q Consensus       180 ~~~~~D~iiiDTaGR~~~d~~lm~El~~i~~~~~p~e~~lV~da~~-----Gq---~-------a~~~a~~F~~~~~i~g  244 (461)
T Consensus       109 ~~~~-~l~i~d~~~~~~-~~~i~~~ir~~~~~~~~~--~vvIDylqll~~~~~~~~d~~~~i~~i~~~Lk~lAke~~v~V  184 (271)
T cd01122         109 EGTG-RLFMYDSFGEYS-MDSVLEKVRYMAVSHGIQ--HIIIDNLSIMVSDERASGDERKALDEIMTKLRGFATEHGIHI  184 (271)
T ss_pred             CCCC-CEEEECCCCCCC-HHHHHHHHHHHHHHCCCC--EEEEEHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCE
T ss_conf             0799-808878999988-999999999999828998--899831785036786773189999999999999999979977


Q ss_pred             EEEEEC
Q ss_conf             776411
Q gi|254780711|r  245 IILTRM  250 (461)
Q Consensus       245 iIlTKl  250 (461)
T Consensus       185 i~lsQl  190 (271)
T cd01122         185 TLVSHL  190 (271)
T ss_pred             EEEECC
T ss_conf             999526