HHsearch alignment for GI: 254780711 and conserved domain: cd01884

>cd01884 EF_Tu EF-Tu subfamily. This subfamily includes orthologs of translation elongation factor EF-Tu in bacteria, mitochondria, and chloroplasts. It is one of several GTP-binding translation factors found in the larger family of GTP-binding elongation factors. The eukaryotic counterpart, eukaryotic translation elongation factor 1 (eEF-1 alpha), is excluded from this family. EF-Tu is one of the most abundant proteins in bacteria, as well as, one of the most highly conserved, and in a number of species the gene is duplicated with identical function. When bound to GTP, EF-Tu can form a complex with any (correctly) aminoacylated tRNA except those for initiation and for selenocysteine, in which case EF-Tu is replaced by other factors. Transfer RNA is carried to the ribosome in these complexes for protein translation.
Probab=96.27  E-value=0.022  Score=38.47  Aligned_cols=123  Identities=16%  Similarity=0.135  Sum_probs=65.4

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEECCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             89962344333468899999999861489507820542210047799998510347422233210368999999999974
Q gi|254780711|r  102 VIMLVGLQGSGKTTTTAKIAYHLKTLKKKKILMASLDVHRPAAQEQLRYLGEQIQVDTLEVIPEQSPEKIAIRATQSARD  181 (461)
Q Consensus       102 vIllvGl~GsGKTTT~aKLA~~~~~~~~~kV~lv~~Dt~R~aA~eQL~~~a~~~~v~~~~~~~~~dp~~i~~~a~~~a~~  181 (461)
T Consensus         4 Ni~iiGHVDhGKTTL~~~l~~~~~~~~-~~~~~------~~~~~D~~~~-EreRGiTI~~~~~-------------~~~~   62 (195)
T cd01884           4 NVGTIGHVDHGKTTLTAAITKVLAKKG-GAKFK------KYDEIDKAPE-EKARGITINTAHV-------------EYET   62 (195)
T ss_pred             EEEEEEECCCCHHHHHHHHHHHHHHHC-CCCCC------CCHHCCCCHH-HHCCCCCCCCEEE-------------EEEC
T ss_conf             999996058869899999999886634-44411------2001005466-6505886144189-------------9960


Q ss_pred             CCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCHHCCHHHHHHHH-HHH--HHCCCCCEE--EEECCCC
Q ss_conf             15886998334422211246899999985138511000310111225688889-887--635844077--6411576
Q gi|254780711|r  182 GGYDAVILDTAGRNHINDSLMQEISEIKSLTNPHEILLVADALTGQDAVHLAR-NFD--KIVDLTGII--LTRMDGD  253 (461)
Q Consensus       182 ~~~D~iiiDTaGR~~~d~~lm~El~~i~~~~~p~e~~lV~da~~Gq~a~~~a~-~F~--~~~~i~giI--lTKlD~~  253 (461)
T Consensus        63 ~~~~~~~IDtPGH~dF----~~~~i~--g~~~~D~aiLVVdA~eGv~~--QT~eh~~la~~lgi~~iiV~iNK~D~~  131 (195)
T cd01884          63 ANRHYAHVDCPGHADY----IKNMIT--GAAQMDGAILVVSATDGPMP--QTREHLLLARQVGVPYIVVFLNKADMV  131 (195)
T ss_pred             CCEEEEECCCCCHHHH----HHHHHH--HHHHCCEEEEEEECCCCCCH--HHHHHHHHHHHHCCCCEEEEEECCCCC
T ss_conf             8816996268960778----889986--35113626899852778747--899999999980999627999687789