HHsearch alignment for GI: 254780711 and conserved domain: cd03112

>cd03112 CobW_like The function of this protein family is unkown. The amino acid sequence of YjiA protein in E. coli contains several conserved motifs that characterizes it as a P-loop GTPase. YijA gene is among the genes significantly induced in response to DNA-damage caused by mitomycin. YijA gene is a homologue of the CobW gene which encodes the cobalamin synthesis protein/P47K.
Probab=97.94  E-value=0.00013  Score=55.31  Aligned_cols=143  Identities=15%  Similarity=0.207  Sum_probs=86.0

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEECCCCCCCHHHHHHHHHHHCCCCCCCCCC-------CCCHHHHHHHH
Q ss_conf             89962344333468899999999861489507820542210047799998510347422233-------21036899999
Q gi|254780711|r  102 VIMLVGLQGSGKTTTTAKIAYHLKTLKKKKILMASLDVHRPAAQEQLRYLGEQIQVDTLEVI-------PEQSPEKIAIR  174 (461)
Q Consensus       102 vIllvGl~GsGKTTT~aKLA~~~~~~~~~kV~lv~~Dt~R~aA~eQL~~~a~~~~v~~~~~~-------~~~dp~~i~~~  174 (461)
T Consensus         2 v~iitGFLGaGKTTll~~lL~---~~~~~~~avIvNEfG~~~-ID~~l--l~~~~~~v~el~~GCiCCs~~~dl~~~l~~   75 (158)
T cd03112           2 VTVLTGFLGAGKTTLLNHILT---EQHGRKIAVIENEFGEVG-IDNQL--VVDTDEEIIEMNNGCICCTVRGDLIRALLD   75 (158)
T ss_pred             EEEEEECCCCCHHHHHHHHHH---CCCCCCEEEEEECCCCCC-CCHHH--HHCCCCEEEEECCCEEEEECCCHHHHHHHH
T ss_conf             089984888999999999984---788997799970765546-31667--637882499933871465225158999999


Q ss_pred             HHHHHH--HCCCCEEEEECCCCCCCHHHHHHHH---HHHHHHCCCCCCCCCCCHHCCHHHHHHHHHHHHHCC-CCCEEEE
Q ss_conf             999997--4158869983344222112468999---999851385110003101112256888898876358-4407764
Q gi|254780711|r  175 ATQSAR--DGGYDAVILDTAGRNHINDSLMQEI---SEIKSLTNPHEILLVADALTGQDAVHLARNFDKIVD-LTGIILT  248 (461)
Q Consensus       175 a~~~a~--~~~~D~iiiDTaGR~~~d~~lm~El---~~i~~~~~p~e~~lV~da~~Gq~a~~~a~~F~~~~~-i~giIlT  248 (461)
T Consensus        76 l~~~~~~~~~~~d~iiIE~SGla~P~-~i~~~~~~~~~l~~~~~l~~vi~vVDa~~~~~~~~~~~~~~~Qi~~AD~ivln  154 (158)
T cd03112          76 LLERLDAGKIAFDRIVIETTGLADPG-PVAQTFFMDEELAERYLLDGVITLVDAKHANQHLDQQTEAQSQIAFADRILLN  154 (158)
T ss_pred             HHHHHHCCCCCCCEEEEECCCCCCCH-HHHHHHHCCHHHHCEEECCCEEEEECHHHHHHHHHCCHHHHHHHHHCCEEEEE
T ss_conf             99976515788788999636878828-99998860714321074387699981898776432446999999968999996


Q ss_pred             ECC
Q ss_conf             115
Q gi|254780711|r  249 RMD  251 (461)
Q Consensus       249 KlD  251 (461)
T Consensus       155 K~D  157 (158)
T cd03112         155 KTD  157 (158)
T ss_pred             CCC
T ss_conf             677