>cd04157 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a subfamily of the Arf family of small GTPases. Arl6 expression is limited to the brain and kidney in adult mice, but it is expressed in the neural plate and somites during embryogenesis, suggesting a possible role for Arl6 in early development. Arl6 is also believed to have a role in cilia or flagella function. Several proteins have been identified that bind Arl6, including Arl6 interacting protein (Arl6ip), and SEC61beta, a subunit of the heterotrimeric conducting channel SEC61p. Based on Arl6 binding to these effectors, Arl6 is also proposed to play a role in protein transport, membrane trafficking, or cell signaling during hematopoietic maturation. At least three specific homozygous Arl6 mutations in humans have been found to cause Bardet-Biedl syndrome, a disorder characterized by obesity, retinopathy, polydactyly, renal and cardiac malformations, learning disabilities, and hypogenitalism. Older literature suggests that A

Probab=95.53 E-value=0.022 Score=38.45 Aligned_cols=79 Identities=22% Similarity=0.321 Sum_probs=43.3 Q ss_pred EEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEECCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHC Q ss_conf 99623443334688999999998614895078205422100477999985103474222332103689999999999741 Q gi|254780711|r 103 IMLVGLQGSGKTTTTAKIAYHLKTLKKKKILMASLDVHRPAAQEQLRYLGEQIQVDTLEVIPEQSPEKIAIRATQSARDG 182 (461) Q Consensus 103 IllvGl~GsGKTTT~aKLA~~~~~~~~~kV~lv~~Dt~R~aA~eQL~~~a~~~~v~~~~~~~~~dp~~i~~~a~~~a~~~ 182 (461) T Consensus 2 Il~lGl~~sGKTtil~~l~----~~~~~-~~~~----------------~pT~G~~~~~-----------------~~~~ 43 (162) T cd04157 2 ILVVGLDNSGKTTIINQLK----PENAQ-SQII----------------VPTVGFNVES-----------------FEKG 43 (162) T ss_pred EEEECCCCCCHHHHHHHHH----CCCCC-CCCC----------------CCCCCEEEEE-----------------EEEC T ss_conf 9999999998899999997----28987-5641----------------6850757899-----------------9839 Q ss_pred CCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCHHC Q ss_conf 5886998334422211246899999985138511000310111 Q gi|254780711|r 183 GYDAVILDTAGRNHINDSLMQEISEIKSLTNPHEILLVADALT 225 (461) Q Consensus 183 ~~D~iiiDTaGR~~~d~~lm~El~~i~~~~~p~e~~lV~da~~ 225 (461) T Consensus 44 ~~~~~iwD~~G~~~~r-~lw---~~y~--~~~~~iI~VvDssd 80 (162) T cd04157 44 NLSFTAFDMSGQGKYR-GLW---EHYY--KNIQGIIFVIDSSD 80 (162) T ss_pred CEEEEEEECCCCCCCC-HHH---HHHH--CCCCEEEEEEECCC T ss_conf 9889999858874420-558---9870--56744899970763

HHsearch alignment for GI: 254780711 and conserved domain: cd04157