HHsearch alignment for GI: 254780711 and conserved domain: pfam00350

>pfam00350 Dynamin_N Dynamin family.
Probab=96.35  E-value=0.014  Score=39.80  Aligned_cols=66  Identities=26%  Similarity=0.176  Sum_probs=37.9

Q ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCHHCC---HHHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             58869983344222112468999999851385110003101112---256888898876358440776411
Q gi|254780711|r  183 GYDAVILDTAGRNHINDSLMQEISEIKSLTNPHEILLVADALTG---QDAVHLARNFDKIVDLTGIILTRM  250 (461)
Q Consensus       183 ~~D~iiiDTaGR~~~d~~lm~El~~i~~~~~p~e~~lV~da~~G---q~a~~~a~~F~~~~~i~giIlTKl  250 (461)
T Consensus       100 ~~~l~lvDtPGl~s~~~~~~~~t~~~i~--~~d~il~V~~a~~~~~~~~~~~l~~~~d~~~~r~i~V~tk~  168 (168)
T pfam00350       100 VPGLTLVDTPGLDSVAVGDQDLTEEYIK--PADIILAVVDANHDLSTSEALFLAREVDPNGKRTIGVLTKD  168 (168)
T ss_pred             CCCEEEEECCCCCCCCCCCHHHHHHHHH--HCCEEEEEEECCCCHHHHHHHHHHHHHCCCCCEEEEEECCC
T ss_conf             8881898279865444336999999985--38669999846951666199999997399998389998188