BLAST/BLAST alignment of GI: 254780711 and GI: 254780709
>gi|254780709|ref|YP_003065122.1| cell division protein [Candidatus Liberibacter asiaticus str. psy62] Length = 321
 Score =  108 bits (271), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 79/278 (28%), Positives = 132/278 (47%), Gaps = 21/278 (7%)

Query: 33  EIRRTFLEADVSLEVVQS-----FSKRVQEKAKGEKILRSIQPGQMVIKIVHDELVEVLG 87
           E+    + +D+ + V Q       +KR  +    +++L  +       +++H  L+ +  
Sbjct: 48  ELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVS------ELIHKMLMPL-- 99

Query: 88  KESIELDLNAPSPLVIMLVGLQGSGKTTTTAKIAYHLKTLKKKKILMASLDVHRPAAQEQ 147
            +    D +   P VI++VG+ G GKTT   K++  +      K+++A+ D  R AA +Q
Sbjct: 100 SKPFNWDFS-HRPHVILVVGVNGVGKTTVIGKLSKKMSD-AGLKVMLAAGDTFRSAAIDQ 157

Query: 148 LRYLGEQIQVDTLEVIPEQSPEKIAIRATQSARDGGYDAVILDTAGRNHINDSLMQEISE 207
           L+   ++   D +          +A  A + A+    D +I+DTAGR H N  LM  I +
Sbjct: 158 LKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGK 217

Query: 208 IKSLTN------PHEILLVADALTGQDAVHLARNFDKIVDLTGIILTRMDGDGRGGAALS 261
           +  +        PH +L V DA TGQ+A+     F  +   TG+I+T+MDG  RGG  + 
Sbjct: 218 MIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIP 277

Query: 262 MRTVTGKPIKAIGTGEKINDLENFFPDRIANRILGMGD 299
           +      P+  +G GE INDLE F     +  I G  D
Sbjct: 278 IVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITGCLD 315