RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780712|ref|YP_003065125.1| 30S ribosomal protein S16 [Candidatus Liberibacter asiaticus str. psy62] (116 letters) >d2uubp1 d.27.1.1 (P:1-83) Ribosomal protein S16 {Thermus thermophilus [TaxId: 274]} Length = 83 Score = 107 bits (268), Expect = 4e-25 Identities = 38/83 (45%), Positives = 55/83 (66%), Gaps = 2/83 (2%) Query: 3 LKIRLACGGSKSRHHYRIVVANSRSPRDGKFIEKLGTWNPTLPKENPLRFTMNFERIQHW 62 +KIRLA GSK HYRIVV ++R RDGK+IEK+G ++P + L+ + ER ++W Sbjct: 2 VKIRLARFGSKHNPHYRIVVTDARRKRDGKYIEKIGYYDPRKTTPDWLKV--DVERARYW 59 Query: 63 MSKGAQPTDRILFFLDKAGLIKR 85 +S GAQPTD L +AG+ ++ Sbjct: 60 LSVGAQPTDTARRLLRQAGVFRQ 82 >d3bn0a1 d.27.1.1 (A:2-102) Ribosomal protein S16 {Aquifex aeolicus [TaxId: 63363]} Length = 101 Score = 106 bits (265), Expect = 6e-25 Identities = 32/102 (31%), Positives = 55/102 (53%), Gaps = 5/102 (4%) Query: 3 LKIRLACGGSKSRHHYRIVVANSRSPRDGKFIEKLGTWNPTLPKENPLRFTMNFERIQHW 62 ++IRLA G K YRIVV +++SPR+GK+I+ LGT++P + + + E+++ W Sbjct: 2 VRIRLAKFGRKHHPIYRIVVMDAKSPREGKYIDILGTYDP----KRKVLINVYPEKVKEW 57 Query: 63 MSKGAQPTDRILFFLDKAGLIKR-SPQNNPKKSQPKKKALER 103 + KG + + R L G++K P+ K E+ Sbjct: 58 VLKGVELSHRAKAILWNHGILKEVVPEGYEMKRVGDYYVFEK 99 >d2gy9p1 d.27.1.1 (P:1-78) Ribosomal protein S16 {Escherichia coli [TaxId: 562]} Length = 78 Score = 99.8 bits (249), Expect = 6e-23 Identities = 30/77 (38%), Positives = 51/77 (66%), Gaps = 1/77 (1%) Query: 3 LKIRLACGGSKSRHHYRIVVANSRSPRDGKFIEKLGTWNPTLPKENPLRFTMNFERIQHW 62 + IRLA G+K R Y++VVA+SR+ R+G+FIE++G +NP + E ++ +RI HW Sbjct: 2 VTIRLARHGAKKRPFYQVVVADSRNARNGRFIERVGFFNP-IASEKEEGTRLDLDRIAHW 60 Query: 63 MSKGAQPTDRILFFLDK 79 + +GA +DR+ + + Sbjct: 61 VGQGATISDRVAALIKE 77 >d1j7na3 d.166.1.1 (A:264-550) Anthrax toxin lethal factor, middle domain {Bacillus anthracis [TaxId: 1392]} Length = 287 Score = 23.8 bits (51), Expect = 3.8 Identities = 11/48 (22%), Positives = 18/48 (37%), Gaps = 2/48 (4%) Query: 63 MSKGAQPTDRILFFLDKAGLIKRSPQNNPKKSQPKK--KALERLASKK 108 + QP D D GLI N + Q K+ + ++ L + Sbjct: 116 LKLDIQPYDINQRLQDTGGLIDSPSINLDVRKQYKRDIQNIDALLHQS 163 >d1u09a_ e.8.1.4 (A:) Viral RNA polymerase {Foot-and-mouth disease virus [TaxId: 12110]} Length = 476 Score = 23.4 bits (50), Expect = 5.8 Identities = 5/46 (10%), Positives = 15/46 (32%), Gaps = 8/46 (17%) Query: 29 RDGKFIEKLGTWNPTLPKENPLRFTMNFERIQHWMSKGAQPTDRIL 74 R G + P + + E I + ++ ++++ Sbjct: 388 RHFHMDYGTGFYKPVMASK-------TLEAILSF-ARRGTIQEKLI 425 >d1q3ia_ d.220.1.1 (A:) Sodium/potassium-transporting ATPase alpha chain {Pig (Sus scrofa) [TaxId: 9823]} Length = 214 Score = 23.3 bits (49), Expect = 5.9 Identities = 6/33 (18%), Positives = 10/33 (30%) Query: 32 KFIEKLGTWNPTLPKENPLRFTMNFERIQHWMS 64 K IE + NP ++F + Sbjct: 74 KCIELSCGSVRKMRDRNPKVAEISFNSTNKYQL 106 >d2qgma1 c.150.1.3 (A:33-445) Succinoglycan biosynthesis protein BC3205 {Bacillus cereus [TaxId: 1396]} Length = 413 Score = 22.6 bits (48), Expect = 9.1 Identities = 4/21 (19%), Positives = 9/21 (42%) Query: 33 FIEKLGTWNPTLPKENPLRFT 53 IE + +N + ++F Sbjct: 116 MIEWMKDYNADPSNKKKIQFI 136 >d3b55a1 c.150.1.3 (A:40-442) Succinoglycan biosynthesis protein BC3120 {Bacillus cereus [TaxId: 1396]} Length = 403 Score = 22.6 bits (48), Expect = 9.6 Identities = 2/21 (9%), Positives = 9/21 (42%) Query: 33 FIEKLGTWNPTLPKENPLRFT 53 ++ + +N ++ +R Sbjct: 110 LLDWIRQYNANPKHKSKVRVI 130 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.317 0.131 0.396 Gapped Lambda K H 0.267 0.0634 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 449,177 Number of extensions: 19257 Number of successful extensions: 54 Number of sequences better than 10.0: 1 Number of HSP's gapped: 50 Number of HSP's successfully gapped: 14 Length of query: 116 Length of database: 2,407,596 Length adjustment: 73 Effective length of query: 43 Effective length of database: 1,405,306 Effective search space: 60428158 Effective search space used: 60428158 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.1 bits)