BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780712|ref|YP_003065125.1| 30S ribosomal protein S16 [Candidatus Liberibacter asiaticus str. psy62] (116 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780712|ref|YP_003065125.1| 30S ribosomal protein S16 [Candidatus Liberibacter asiaticus str. psy62] Length = 116 Score = 241 bits (616), Expect = 2e-66, Method: Compositional matrix adjust. Identities = 116/116 (100%), Positives = 116/116 (100%) Query: 1 MTLKIRLACGGSKSRHHYRIVVANSRSPRDGKFIEKLGTWNPTLPKENPLRFTMNFERIQ 60 MTLKIRLACGGSKSRHHYRIVVANSRSPRDGKFIEKLGTWNPTLPKENPLRFTMNFERIQ Sbjct: 1 MTLKIRLACGGSKSRHHYRIVVANSRSPRDGKFIEKLGTWNPTLPKENPLRFTMNFERIQ 60 Query: 61 HWMSKGAQPTDRILFFLDKAGLIKRSPQNNPKKSQPKKKALERLASKKNADEHATT 116 HWMSKGAQPTDRILFFLDKAGLIKRSPQNNPKKSQPKKKALERLASKKNADEHATT Sbjct: 61 HWMSKGAQPTDRILFFLDKAGLIKRSPQNNPKKSQPKKKALERLASKKNADEHATT 116 >gi|254780747|ref|YP_003065160.1| putative protease IV transmembrane protein [Candidatus Liberibacter asiaticus str. psy62] Length = 293 Score = 23.9 bits (50), Expect = 0.82, Method: Compositional matrix adjust. Identities = 9/21 (42%), Positives = 16/21 (76%) Query: 76 FLDKAGLIKRSPQNNPKKSQP 96 FLDK G+ +S +++P K++P Sbjct: 144 FLDKLGVSIKSVKSSPMKAEP 164 >gi|254781152|ref|YP_003065565.1| hypothetical protein CLIBASIA_05295 [Candidatus Liberibacter asiaticus str. psy62] Length = 155 Score = 22.3 bits (46), Expect = 2.3, Method: Compositional matrix adjust. Identities = 9/23 (39%), Positives = 11/23 (47%) Query: 1 MTLKIRLACGGSKSRHHYRIVVA 23 + L I L C HHY IV + Sbjct: 123 LNLVIALCCATDVLIHHYGIVTS 145 >537021.9.peg.753_1 Length = 1033 Score = 22.3 bits (46), Expect = 2.3, Method: Composition-based stats. Identities = 15/47 (31%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Query: 43 TLPKENPLRFTMNFERIQHWMSKGAQPTDRILFFLDKAGLIKRSPQN 89 T+ +PLRF++ FER + + + P I F D+ + R QN Sbjct: 391 TITDIDPLRFSLLFERFLN-PDRMSMPDFDIDFCQDRRDEVIRYVQN 436 >gi|254780226|ref|YP_003064639.1| translation-associated GTPase [Candidatus Liberibacter asiaticus str. psy62] Length = 367 Score = 22.3 bits (46), Expect = 2.7, Method: Composition-based stats. Identities = 9/24 (37%), Positives = 18/24 (75%) Query: 88 QNNPKKSQPKKKALERLASKKNAD 111 +++ KK +A++RLAS++NA+ Sbjct: 213 EHDCKKGNIYTEAVQRLASQQNAE 236 >gi|254780410|ref|YP_003064823.1| hypothetical protein CLIBASIA_01475 [Candidatus Liberibacter asiaticus str. psy62] Length = 362 Score = 21.6 bits (44), Expect = 4.5, Method: Composition-based stats. Identities = 7/10 (70%), Positives = 8/10 (80%) Query: 31 GKFIEKLGTW 40 GKF+E LG W Sbjct: 299 GKFLEGLGIW 308 >gi|254780873|ref|YP_003065286.1| aspartate kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 411 Score = 21.6 bits (44), Expect = 4.8, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 15/34 (44%) Query: 71 DRILFFLDKAGLIKRSPQNNPKKSQPKKKALERL 104 DR + D G+ P+ PK KK + E + Sbjct: 167 DRCDIYTDVCGIYTTDPRIEPKAHLMKKISFEEM 200 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.317 0.131 0.396 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 75,993 Number of Sequences: 1233 Number of extensions: 2882 Number of successful extensions: 11 Number of sequences better than 100.0: 11 Number of HSP's better than 100.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of query: 116 length of database: 328,796 effective HSP length: 63 effective length of query: 53 effective length of database: 251,117 effective search space: 13309201 effective search space used: 13309201 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 33 (17.3 bits)