>gi|254780713|ref|YP_003065126.1| 16S rRNA-processing protein [Candidatus Liberibacter asiaticus str. psy62]
MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQYDCPLDSAGKKS