HHsearch alignment of GI: 254780713 and MMDB domain: 2f1l_A_112-187

>2f1l_A (A:112-187) 16S rRNA processing protein; 9949912, structural genomics, PSI, protein structure initiative, joint center for structural genomics, JCSG; HET: UNL; 2.46A {Pseudomonas aeruginosa}
Probab=99.88  E-value=1.2e-22  Score=146.93  Aligned_cols=72  Identities=22%  Similarity=0.361  Sum_probs=69.1

Q ss_pred             CCCHHHHHCCEEEEECCCEEEEEEEEEECCCCEEEEEECC----CCCEEEEECHHHHCCEEECCCCEEEEECCCCC
Q ss_conf             0214524011367525843119988665799508999749----98289987503100105633979999528100
Q gi|254780713|r   97 EFFNTDLEEMETFDRQGKYWGQVCGVYNFGAGSILEIKNT----MEKTFLIPFTKFAVLEVNLQENKILIDPIAAG  168 (190)
Q Consensus        97 e~Y~~dLiG~~V~d~~~~~iG~V~~v~~~~a~dil~V~~~----~~ke~lIP~v~~~I~~ID~~~k~I~v~~p~Gl  168 (190)
                      ||||+|||||+|+|.+|+.+|+|.+|+++||||+|+|+++    ++|++||||+++||++||.++++|+|+||+||
T Consensus         1 Efy~~dLiG~~V~~~~g~~lG~V~~v~~~~a~dil~I~~~~~~~~~ke~liP~~~~fV~~VD~~~~~I~v~~p~G~   76 (76)
T 2f1l_A            1 EYYWHQLEGLKVIDQGRQLLGVIDHLLETGANDVXVVKPCAGSLDDRERLLPYTGQCVLSIDLAAGEXRVDWDADF   76 (76)
T ss_dssp             -CCHHHHTTCEEEETTSCEEEEEEEEECCSSSCEEEEECCTTSSSSCCEEEECSTTTEEEEETTTTEEEECCCTTC
T ss_pred             HHHHHHHCCEEEEEECCCEEEEEEEEECCCCCCEEEEECCCCCCCCCEEEEECCHHHCCEEECCCCEEEEECCCCC
T ss_conf             0003654780899807945899969954899409999716788898199998564305879778999999589999