HHsearch alignment of GI: 254780713 and MMDB domain: 2qgg_A_1-102

>2qgg_A (A:1-102) 16S rRNA-processing protein RIMM; X-RAY, NESG, ASR73, structural genomics, PSI-2, protein structure initiative; 2.40A {Acinetobacter calcoaceticus}
Probab=99.89  E-value=4e-23  Score=149.65  Aligned_cols=94  Identities=12%  Similarity=0.262  Sum_probs=83.7

Q ss_pred             CCCCCCEEEEEEEECCCEEEEEEEEEECCCCHHHHHHCCEE----CCCCEEEEEEEEEEECCEEEEEECCCCCHHHHHHH
Q ss_conf             99820079999994463050599999418997787630102----07983799999997399799996387784556763
Q gi|254780713|r    1 MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRKNKRFIATFSGIDNIHSASEL   76 (190)
Q Consensus         1 M~k~~~~i~iGkI~k~hGlkGevki~~~td~~~~~~~~~~~----~~~~~~~~i~~~~~~~~~~iikf~gi~s~~~A~~l   76 (190)
                      |.+.++|+.||+|++|||+|||+||+++|+.++.+.++..+    .....++.++.++.+++.++++|+||+||++|++|
T Consensus         5 m~~~~~~i~iGkI~~~hGlkG~vkv~~~td~~~~~~~~~~~~l~~~~~~~~~~v~~~r~~~~~~ivkf~gi~~re~Ae~l   84 (102)
T 2qgg_A            5 QNVPEDRIQIGQLRSAYGLNGWLWVYSNTEPXSNXFDYLPWYIETKAGWQTVDVKRWKPHGKGLVVSLKGVSDRTGAESL   84 (102)
T ss_dssp             -CCCSSEEEEEEEEEEETTTTEEEEEECSSSGGGGGGSSSEEEEETTEEEEECEEEEEEETTEEEEEETTCCSHHHHHTT
T ss_pred             CCCCCCEEEEEEEECCEEECEEEEEEECCCCHHHHHCCCEEEEECCCCCEEEEEEEEECCCCEEEEEECCCCCHHHHHHH
T ss_conf             68986669999990989426699999988897996087729986389807999999741475799997167856677753


Q ss_pred             CCCEEEECHHHCCCCCCCCC
Q ss_conf             49687741777886556410
Q gi|254780713|r   77 RDLKLYAKRQDFKDEELEED   96 (190)
Q Consensus        77 ~g~~i~i~~~~lp~~~l~~~   96 (190)
                      +|+.||+++++||  +|++|
T Consensus        85 ~g~~i~i~~~~lp--~l~eD  102 (102)
T 2qgg_A           85 VASNIWIAKSQLP--KADVD  102 (102)
T ss_dssp             TTCEEEEETTCCC--CCHHH
T ss_pred             CCCEEEEEHHHCC--CCCCC
T ss_conf             1858997444515--55334