HHsearch alignment of GI: 254780713 and MMDB domain: 3h9n_A_94-177

>3h9n_A (A:94-177) Ribosome maturation factor RIMM; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.70A {Haemophilus influenzae}
Probab=99.90  E-value=2.2e-23  Score=151.06  Aligned_cols=78  Identities=24%  Similarity=0.298  Sum_probs=72.6

Q ss_pred             CCCHHHHHCCEEEEECCCEEEEEEEEEECCCCEEEEEEC-----CCCCEEEEECHH-HHCCEEECCCCEEEEECCCCCCC
Q ss_conf             021452401136752584311998866579950899974-----998289987503-10010563397999952810038
Q gi|254780713|r   97 EFFNTDLEEMETFDRQGKYWGQVCGVYNFGAGSILEIKN-----TMEKTFLIPFTK-FAVLEVNLQENKILIDPIAAGLN  170 (190)
Q Consensus        97 e~Y~~dLiG~~V~d~~~~~iG~V~~v~~~~a~dil~V~~-----~~~ke~lIP~v~-~~I~~ID~~~k~I~v~~p~Glld  170 (190)
                      ||||+||+||+|++.+|+.+|+|.+|+++||||+|+|++     .++|++||||++ .||++||.++|+|.|+||+||||
T Consensus         1 Efy~~dLiG~~V~d~~g~~iG~V~~v~~~~a~dll~I~~~~~~~~~gke~liPfv~e~~V~~iD~e~~~I~v~~p~Glld   80 (84)
T 3h9n_A            1 DYYWHDLIGCTVVNLEGYTXGTVTEXXETGSNDVLVVKANTKDAFGKQERLIPFLYEQVVKRVDLTTKTIEVDWDAGFLE   80 (84)
T ss_dssp             CGGGGGTTTCEEEETTCCEEEEEEEEEESSSCEEEEEECCTTCTTCCSEEEEECCBTTTEEEEEGGGTEEEECCCSSTTC
T ss_pred             CEEHHHHEEEEEEEECCCCCEEEEEECCCCCCEEEEEEECCCCCCCCCEEEEECCCCCCCEEEECCCCEEEEECCCCHHH
T ss_conf             20221010008997079624799398106992599998288667798289974376467517967899999988812644


Q ss_pred             CCCC
Q ss_conf             8865
Q gi|254780713|r  171 NTTM  174 (190)
Q Consensus       171 ~~~~  174 (190)
                      ++.+
T Consensus        81 ~~~e   84 (84)
T 3h9n_A           81 HHHH   84 (84)
T ss_dssp             CCCC
T ss_pred             CCCC
T ss_conf             4489