HHsearch results for GI: 254780713 and protein with PDBid: 2f1l_A

>2f1l_A 16S rRNA processing protein; structural genomics, joint CENT structural genomics, JCSG, protein structure initiative, PS unknown function; HET: UNL; 2.46A {Pseudomonas aeruginosa} SCOP: b.41.1.4 b.43.3.4
Probab=100.00  E-value=0  Score=295.78  Aligned_cols=164  Identities=23%  Similarity=0.388  Sum_probs=150.3

Q ss_pred             CCCCEEEEEEEECCCEEEEEEEEEECCCCHHHHHHCCEEC----CCCEEEEEEEEEEECCEEEEEECCCCCHHHHHHHCC
Q ss_conf             8200799999944630505999994189977876301020----798379999999739979999638778455676349
Q gi|254780713|r    3 KLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRFIATFSGIDNIHSASELRD   78 (190)
Q Consensus         3 k~~~~i~iGkI~k~hGlkGevki~~~td~~~~~~~~~~~~----~~~~~~~i~~~~~~~~~~iikf~gi~s~~~A~~l~g   78 (190)
                      +.++|+.||+|++|||+|||++|+++|++++++.++..+.    ....++.+++++.+++.++++|++++||++|+.|+|
T Consensus        16 ~~dd~i~iG~I~~~hGlkGevkv~~~td~~~~~~~~~~~~l~~~~~~~~~~i~~~~~~~~~~l~k~~gi~~re~Ae~L~g   95 (187)
T 2f1l_A           16 PADDLVVIGKIVSVYGIRGEVKVYSFTDPLDNLLDYRRWTLRRDGEIRQAELVRGRLHGKVLAAKLKGLDDREEARTFTG   95 (187)
T ss_dssp             ---CEEEEEEEEEEETTTTEEEEEECSSSGGGGGGCCEEEEEETTEEEEEEEEEEEEETTEEEEEETTCCSHHHHHTTTT
T ss_pred             CCCCEEEEEEEECCEEECEEEEEEECCCCHHHHHCCCEEEEEECCCEEEEEEEEEEECCCEEEEEECCCCCHHHHHHHCC
T ss_conf             97887999999298953779999998789799617776999608958899999998427589998469699899997449


Q ss_pred             CEEEECHHHCCCCCCCCCCCCHHHHHCCEEEEECCCEEEEEEEEEECCCCEEEEEECC----CCCEEEEECHHHHCCEEE
Q ss_conf             6877417778865564100214524011367525843119988665799508999749----982899875031001056
Q gi|254780713|r   79 LKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFGAGSILEIKNT----MEKTFLIPFTKFAVLEVN  154 (190)
Q Consensus        79 ~~i~i~~~~lp~~~l~~~e~Y~~dLiG~~V~d~~~~~iG~V~~v~~~~a~dil~V~~~----~~ke~lIP~v~~~I~~ID  154 (190)
                      +.||+++++||  +|+++||||+|||||+|++.+++.+|+|.+++++||||+|+|+..    ++||+||||+++||.+||
T Consensus        96 ~~l~i~~~~lp--~l~e~E~y~~dLiG~~V~~~~~~~lG~V~~v~~~ga~dll~I~~~~~~~~~ke~LIPf~~~~V~~VD  173 (187)
T 2f1l_A           96 YEICIPRSELP--SLEEGEYYWHQLEGLKVIDQGRQLLGVIDHLLETGANDVMVVKPCAGSLDDRERLLPYTGQCVLSID  173 (187)
T ss_dssp             CEEEEEGGGSC--C-----CCHHHHTTCEEEETTSCEEEEEEEEECCSSSCEEEEECCTTSSSSCCEEEECSTTTEEEEE
T ss_pred             CEEEECHHHCC--CCCCCCEEHHHHCCCEEEECCCCEEEEEEEEECCCCCEEEEEEECCCCCCCCEEEEECCHHHCCEEE
T ss_conf             87995054588--7778824345635819997899788999999568993499998578888982999866731138897


Q ss_pred             CCCCEEEEECCCCC
Q ss_conf             33979999528100
Q gi|254780713|r  155 LQENKILIDPIAAG  168 (190)
Q Consensus       155 ~~~k~I~v~~p~Gl  168 (190)
                      +++|+|+||+|+++
T Consensus       174 ~~~k~I~Vdw~~d~  187 (187)
T 2f1l_A          174 LAAGEMRVDWDADF  187 (187)
T ss_dssp             TTTTEEEECCCTTC
T ss_pred             CCCCEEEEECCCCC
T ss_conf             88999999589999