HHsearch results for GI: 254780713 and protein with PDBid: 3htr_A

>3htr_A Uncharacterized PRC-barrel domain protein; beta-barrel, photo-reaction-center domain, structural genomics, PSI-2; HET: MSE; 2.06A {Rhodopseudomonas palustris}
Probab=95.92  E-value=0.024  Score=31.92  Aligned_cols=70  Identities=11%  Similarity=0.195  Sum_probs=50.1

Q ss_pred             HHHHHCCEEEEECCCEEEEEEEEE-EC-CCC-EEEEEECC-----CCCEEEEECHHHHCCEEECCCCEEEEECCCCCCCC
Q ss_conf             452401136752584311998866-57-995-08999749-----98289987503100105633979999528100388
Q gi|254780713|r  100 NTDLEEMETFDRQGKYWGQVCGVY-NF-GAG-SILEIKNT-----MEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN  171 (190)
Q Consensus       100 ~~dLiG~~V~d~~~~~iG~V~~v~-~~-~a~-dil~V~~~-----~~ke~lIP~v~~~I~~ID~~~k~I~v~~p~Glld~  171 (190)
                      -++|+|++|++.+|+.||+|.+++ +. .+. ..++|..-     .++.+.+|+.   ...++...+.+.++...--+.+
T Consensus        17 a~~l~G~~V~~~dG~~iG~V~dv~id~~~g~i~~~vV~~Gg~lg~g~k~v~vp~~---~~~~~~~~~~~~l~~t~~~~~~   93 (120)
T 3htr_A           17 SDKVQGTAVYGPDGEKIGSIERVMIEKVSGRVSYAVLSFGGFLGIGDDHYPLPWP---ALKYNVELGGYQVMVTVDQLER   93 (120)
T ss_dssp             HHHHTTCEEECTTSCEEEEEEEEEEETTTCBEEEEEEEESSBTTBSCEEEEECGG---GCEEETTTTEEECCCCHHHHHT
T ss_pred             CCCCCCCEEECCCCCEEEEEEEEEEECCCCCEEEEEEEECCCCCCCCEEEECCHH---HHCCCCCCCEEEECCCHHHHHC
T ss_conf             0103498789799898888889999889995889999607754579865657889---9000366898994498999952


Q ss_pred             C
Q ss_conf             8
Q gi|254780713|r  172 T  172 (190)
Q Consensus       172 ~  172 (190)
                      .
T Consensus        94 a   94 (120)
T 3htr_A           94 A   94 (120)
T ss_dssp             C
T ss_pred             C
T ss_conf             9