HHSEARCH alignment of GI: 254780713 and SCOP domain: d2i5nh1

Alignment
>d2i5nh1 b.41.1.1 (H:37-258) Photosynthetic reaction centre {Rhodopseudomonas viridis [TaxId: 1079]}
Probab=95.48  E-value=0.01  Score=32.66  Aligned_cols=82  Identities=22%  Similarity=0.331  Sum_probs=51.7

Q ss_pred             CCCEEEECHHHCCCCCCC----------CCCCCH----HHHHCCEEEEECCCEEEEEEEEE-ECCCC--EEEEEECC-CC
Q ss_conf             496877417778865564----------100214----52401136752584311998866-57995--08999749-98
Q gi|254780713|r   77 RDLKLYAKRQDFKDEELE----------EDEFFN----TDLEEMETFDRQGKYWGQVCGVY-NFGAG--SILEIKNT-ME  138 (190)
Q Consensus        77 ~g~~i~i~~~~lp~~~l~----------~~e~Y~----~dLiG~~V~d~~~~~iG~V~~v~-~~~a~--dil~V~~~-~~  138 (190)
                      +|---|.+|.+.|+....          ...|.+    .|++|+.|+..+|+.+|+|.+++ +...+  -.|+|++. .+
T Consensus        76 vGp~s~a~R~d~p~l~~~g~~~i~Pmr~~~~~~v~~~~~DprG~~V~g~DGekIGtV~DvwVD~~e~~vRYleVetg~gg  155 (222)
T d2i5nh1          76 VGPASYAERAEVVDATVDGKAKIVPLRVATDFSIAEGDVDPRGLPVVAADGVEAGTVTDLWVDRSEHYFRYLELSVAGSA  155 (222)
T ss_dssp             CGGGCCCCCCSCBCBCTTSSBSEEETTTCTTCEECTTSCCCTTCEEECTTSCEEEEEEEEEEETTTTEEEEEEEEETTTT
T ss_pred             CCCCCCCCCCCCCCCCCCCCEEEEEEECCCCCEECCCCCCCCCCEEECCCCCEEEEEEEEEEECCCCEEEEEEEEECCCC
T ss_conf             47533555578876678998568762026882661688875567458689986127889899688885999999828988


Q ss_pred             CEEEEECHHHHCCEEECCCCEEEEE
Q ss_conf             2899875031001056339799995
Q gi|254780713|r  139 KTFLIPFTKFAVLEVNLQENKILID  163 (190)
Q Consensus       139 ke~lIP~v~~~I~~ID~~~k~I~v~  163 (190)
                      +.+|||+.-.   .++.  ..+.|.
T Consensus       156 k~vLvP~~~a---~i~~--d~v~V~  175 (222)
T d2i5nh1         156 RTALIPLGFC---DVKK--DKIVVT  175 (222)
T ss_dssp             EEEEEEGGGC---EECS--SCEECC
T ss_pred             CEEEEEHHHC---EECC--CCEEEC
T ss_conf             5576320211---6558--938982


SCOP domain information

class: All beta proteins
fold: PRC-barrel domain
superfamily: PRC-barrel domain
family: Photosynthetic reaction centre, H-chain, cytoplasmic domain
domain: Photosynthetic reaction centre
species: Rhodopseudomonas viridis [TaxId: 1079]