BLAST/PSIBLAST alignment of GI: 254780713 and GI: 190893807 at iteration 1
>gi|190893807|ref|YP_001980349.1| 16S rRNA processing protein [Rhizobium etli CIAT 652] Length = 193
>gi|209573647|sp|B3PR17|RIMM_RHIE6 RecName: Full=Ribosome maturation factor rimM Length = 193
>gi|190699086|gb|ACE93171.1| 16S rRNA processing protein [Rhizobium etli CIAT 652] Length = 193
 Score =  149 bits (375), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 76/170 (44%), Positives = 108/170 (63%), Gaps = 1/170 (0%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYV-LYSNDNRELRILKMYRKNKR 59
           M KL+  VLMATIG   GL GEV   +Y  +P  L  Y  L+S D R   IL++      
Sbjct: 5   MTKLENPVLMATIGGAQGLRGEVRAKAYTADPTALGDYGHLHSMDGRSFEILEIREMKNV 64

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +  F GI++ ++A  L  L+LY +R +  DEELE+DEF+  DLE +E  D QG  +G V
Sbjct: 65  VVVRFRGINDRNAAEALNGLELYIERDNLPDEELEDDEFYYADLEGLEARDDQGVSYGTV 124

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
            GV++FGAG +LE+K   ++  LIPF++ +VLE++L+   +LIDP+AAGL
Sbjct: 125 TGVFDFGAGDLLELKGPGKRPVLIPFSEASVLEIDLEAGTLLIDPLAAGL 174