BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780713|ref|YP_003065126.1| 16S rRNA-processing protein
[Candidatus Liberibacter asiaticus str. psy62]
         (190 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780713|ref|YP_003065126.1| 16S rRNA-processing protein [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040390|gb|ACT57186.1| 16S rRNA-processing protein [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 190

 Score =  393 bits (1010), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 190/190 (100%), Positives = 190/190 (100%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRF 60
           MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRF
Sbjct: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRF 60

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC
Sbjct: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQYD 180
           GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQYD
Sbjct: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQYD 180

Query: 181 CPLDSAGKKS 190
           CPLDSAGKKS
Sbjct: 181 CPLDSAGKKS 190


>gi|315121878|ref|YP_004062367.1| 16S rRNA-processing protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495280|gb|ADR51879.1| 16S rRNA-processing protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 190

 Score =  242 bits (617), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 158/187 (84%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRF 60
           MVK +KLVL+ATIGTTHGL GEVY++SYA+NP+DL+RY+LYS+D +E +IL +Y+ NKR 
Sbjct: 1   MVKSEKLVLIATIGTTHGLKGEVYVNSYASNPMDLSRYILYSDDAKEFKILDIYQNNKRL 60

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           IATF GI +IHSA +LR LKLYA+RQDFKDEELEEDEFFN DLEE+ETFD QGKYWG++C
Sbjct: 61  IATFDGIYDIHSAEKLRHLKLYARRQDFKDEELEEDEFFNADLEELETFDLQGKYWGKIC 120

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQYD 180
           G+Y+FGAG++LE K++ EK FLIPFTK  VL VNL+ENKILID ++AGL+  T K+  ++
Sbjct: 121 GIYDFGAGAVLEFKDSKEKKFLIPFTKSTVLSVNLKENKILIDSVSAGLDCMTKKDKNHE 180

Query: 181 CPLDSAG 187
           C   S G
Sbjct: 181 CQSSSPG 187


>gi|222087527|ref|YP_002546064.1| 16S rRNA processing protein RimM [Agrobacterium radiobacter K84]
 gi|254797739|sp|B9JCM0|RIMM_AGRRK RecName: Full=Ribosome maturation factor rimM
 gi|221724975|gb|ACM28131.1| 16S rRNA processing protein RimM [Agrobacterium radiobacter K84]
          Length = 190

 Score =  154 bits (389), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 79/173 (45%), Positives = 112/173 (64%), Gaps = 1/173 (0%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYV-LYSNDNRELRILKMYRKNKR 59
           M KL+  VLMATIG   GL GEV   ++ ++P  L  Y  L+S D R   +L++      
Sbjct: 1   MTKLENPVLMATIGAAQGLRGEVRARAFTSDPTALGDYGHLHSMDGRIFEVLEIREAKNV 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F G++N  +A  L  L+LY +R +  D+ELE+DEFF TDLE +E  D +G  +G V
Sbjct: 61  VIVRFRGVNNRDAAEALNGLELYIERDNLPDDELEDDEFFYTDLEGLEAVDDKGTAYGTV 120

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNT 172
            GVY+FGAG +LE+K   ++  LIPF++ AVLE++L+  KILIDP+AAGL ++
Sbjct: 121 SGVYDFGAGDLLELKGPGKRPVLIPFSEAAVLEIDLEGGKILIDPMAAGLIDS 173


>gi|109893039|sp|Q2K381|RIMM_RHIEC RecName: Full=Ribosome maturation factor rimM
          Length = 188

 Score =  150 bits (379), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 109/170 (64%), Gaps = 1/170 (0%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKR 59
           M KL+  VLMATIG   GL GEV   +Y  +P  L  Y +L+S D R   IL++      
Sbjct: 1   MTKLENPVLMATIGGAQGLRGEVRAKAYTADPTALGDYGLLHSTDGRSFEILEIREMKNV 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +  F GI++ ++A  L  L+LY +R +  DEELE+DEF+  DLE +E  D +G  +G V
Sbjct: 61  VVVRFRGINDRNAAEALNGLELYIERDNLPDEELEDDEFYYADLEGLEALDDKGVSYGTV 120

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
            GV++FGAG +LE+K   ++  LIPF++ +VLE++L+   +LIDP+AAGL
Sbjct: 121 TGVFDFGAGDLLELKGPGKRPVLIPFSEASVLEIDLEAGTLLIDPLAAGL 170


>gi|86359540|ref|YP_471432.1| 16S rRNA-processing protein [Rhizobium etli CFN 42]
 gi|86283642|gb|ABC92705.1| 16S rRNA processing protein [Rhizobium etli CFN 42]
          Length = 217

 Score =  150 bits (378), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 109/170 (64%), Gaps = 1/170 (0%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKR 59
           M KL+  VLMATIG   GL GEV   +Y  +P  L  Y +L+S D R   IL++      
Sbjct: 30  MTKLENPVLMATIGGAQGLRGEVRAKAYTADPTALGDYGLLHSTDGRSFEILEIREMKNV 89

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +  F GI++ ++A  L  L+LY +R +  DEELE+DEF+  DLE +E  D +G  +G V
Sbjct: 90  VVVRFRGINDRNAAEALNGLELYIERDNLPDEELEDDEFYYADLEGLEALDDKGVSYGTV 149

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
            GV++FGAG +LE+K   ++  LIPF++ +VLE++L+   +LIDP+AAGL
Sbjct: 150 TGVFDFGAGDLLELKGPGKRPVLIPFSEASVLEIDLEAGTLLIDPLAAGL 199


>gi|190893807|ref|YP_001980349.1| 16S rRNA processing protein [Rhizobium etli CIAT 652]
 gi|209573647|sp|B3PR17|RIMM_RHIE6 RecName: Full=Ribosome maturation factor rimM
 gi|190699086|gb|ACE93171.1| 16S rRNA processing protein [Rhizobium etli CIAT 652]
          Length = 193

 Score =  149 bits (375), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 76/170 (44%), Positives = 108/170 (63%), Gaps = 1/170 (0%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYV-LYSNDNRELRILKMYRKNKR 59
           M KL+  VLMATIG   GL GEV   +Y  +P  L  Y  L+S D R   IL++      
Sbjct: 5   MTKLENPVLMATIGGAQGLRGEVRAKAYTADPTALGDYGHLHSMDGRSFEILEIREMKNV 64

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +  F GI++ ++A  L  L+LY +R +  DEELE+DEF+  DLE +E  D QG  +G V
Sbjct: 65  VVVRFRGINDRNAAEALNGLELYIERDNLPDEELEDDEFYYADLEGLEARDDQGVSYGTV 124

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
            GV++FGAG +LE+K   ++  LIPF++ +VLE++L+   +LIDP+AAGL
Sbjct: 125 TGVFDFGAGDLLELKGPGKRPVLIPFSEASVLEIDLEAGTLLIDPLAAGL 174


>gi|209551324|ref|YP_002283241.1| 16S rRNA-processing protein RimM [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|238058953|sp|B5ZTH9|RIMM_RHILW RecName: Full=Ribosome maturation factor rimM
 gi|209537080|gb|ACI57015.1| 16S rRNA processing protein RimM [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 189

 Score =  147 bits (370), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 74/170 (43%), Positives = 108/170 (63%), Gaps = 1/170 (0%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYV-LYSNDNRELRILKMYRKNKR 59
           M KL+  VLMATIG   GL GEV   +Y  +P  L  Y  L+S D R   +L++      
Sbjct: 1   MTKLENPVLMATIGGAQGLRGEVRAKAYTADPSALGDYGHLHSMDGRSFEVLEIRETKNV 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F G+++ ++A  L  L+LY +R +  DEELE+DEF+  DLE +E  D +G  +G V
Sbjct: 61  VIVRFRGVNDRNAAEALNGLELYIERDNLPDEELEDDEFYYADLEGLEARDDKGASYGTV 120

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
            GV++FGAG +LE+K   ++  LIPF++ +VLE++L+   +LIDP+AAGL
Sbjct: 121 TGVFDFGAGDLLELKGPGKRPVLIPFSEASVLEIDLEAGTLLIDPLAAGL 170


>gi|163757327|ref|ZP_02164416.1| 16S rRNA-processing protein [Hoeflea phototrophica DFL-43]
 gi|162284829|gb|EDQ35111.1| 16S rRNA-processing protein [Hoeflea phototrophica DFL-43]
          Length = 202

 Score =  146 bits (369), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 70/173 (40%), Positives = 105/173 (60%), Gaps = 1/173 (0%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKR 59
           M KL+  +L+  IG   G+ GEV +  +  +P+ +  Y  LYS D R   IL        
Sbjct: 8   MSKLENPILIGIIGAAQGIRGEVRVKPFTEDPMAIAEYGALYSEDGRRFEILDHRLAKTV 67

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +  F GI++ ++A  L+ L LY  R    DE+LEE E+F+ DLE +E +D +G++WG+V
Sbjct: 68  VVVRFRGINDRNAAEALKGLNLYIDRSSLDDEDLEEGEYFHADLEGLEAWDAEGQFWGEV 127

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNT 172
            GV +FG G +LE++    K  +IPFT  AV +V+L+  +IL+DPIAAGL +T
Sbjct: 128 SGVLDFGGGDLLELREDGRKPVVIPFTLAAVPKVDLEAGRILVDPIAAGLIDT 180


>gi|218513354|ref|ZP_03510194.1| 16S rRNA-processing protein [Rhizobium etli 8C-3]
          Length = 206

 Score =  146 bits (368), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 107/170 (62%), Gaps = 1/170 (0%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYV-LYSNDNRELRILKMYRKNKR 59
           M KL+  VLMATIG   GL GEV   +Y  +P  L  Y  L+S D R   IL++      
Sbjct: 18  MTKLENPVLMATIGGAQGLRGEVRAKAYTADPTALGDYGHLHSMDGRSFEILEIREMKNV 77

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +  F GI++ ++A  L  L+LY +R +  DEELE+DEF+  DLE +E  D  G  +G V
Sbjct: 78  VVVRFRGINDRNAAEALNGLELYIERDNLPDEELEDDEFYYADLEGLEARDDHGVSYGTV 137

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
            GV++FGAG +LE+K   ++  LIPF++ +VLE++L+   +LIDP+AAGL
Sbjct: 138 TGVFDFGAGDLLELKGPGKRPVLIPFSEASVLEIDLEAGTLLIDPLAAGL 187


>gi|222150103|ref|YP_002551060.1| 16S rRNA-processing protein RimM [Agrobacterium vitis S4]
 gi|221737085|gb|ACM38048.1| 16S rRNA processing protein RimM [Agrobacterium vitis S4]
          Length = 221

 Score =  145 bits (365), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 69/178 (38%), Positives = 109/178 (61%), Gaps = 1/178 (0%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYV-LYSNDNRELRILKMYRKNKR 59
           M KL+  VLMA IG   GL GEV + S+  +P+ L  Y  L++ D R   +L +      
Sbjct: 32  MTKLENPVLMAVIGAAQGLRGEVRVKSFTADPMALGDYGKLHAGDGRVFEVLDIREAKTV 91

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +  F G+++ ++A  L  L+L+ +R    DEEL++DEF+  DLE +   D +G  +G V
Sbjct: 92  VVVRFRGVNDRNAAEALNGLELFIERSALPDEELDDDEFYYADLEGLAVVDAEGNSYGTV 151

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNP 177
             V++FGAG +LE+K   ++  L+PF++ AVL+++L+E K+LIDP AAGL +   + P
Sbjct: 152 TAVFDFGAGDLLEVKGPGKRPVLVPFSEAAVLQIDLEEGKLLIDPEAAGLKDDGSEEP 209


>gi|241206760|ref|YP_002977856.1| 16S rRNA-processing protein RimM [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240860650|gb|ACS58317.1| 16S rRNA processing protein RimM [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 189

 Score =  145 bits (365), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 73/170 (42%), Positives = 108/170 (63%), Gaps = 1/170 (0%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYV-LYSNDNRELRILKMYRKNKR 59
           M KL+  VLMATIG   GL GEV   +Y  +P  L  Y  L+S D R   +L++      
Sbjct: 1   MTKLENPVLMATIGGAQGLRGEVRAKAYTADPGALGDYGHLHSMDGRSFEVLEIREMKNV 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +  F G+++ ++A  L  L+LY +R +  DEELE+DEF+  DLE +E  D +G  +G V
Sbjct: 61  VVVRFRGVNDRNAAEALNGLELYIERDNLPDEELEDDEFYYADLEGLEARDDKGVSYGTV 120

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
            GV++FGAG +LE+K   ++  LIPF++ +VLE++L+   +LIDP+AAGL
Sbjct: 121 TGVFDFGAGDLLELKGPGKRPVLIPFSEASVLEIDLEAGTLLIDPLAAGL 170


>gi|116254277|ref|YP_770115.1| 16S rRNA-processing protein RimM [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115258925|emb|CAK10034.1| putative 16S rRNA processing protein [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 193

 Score =  145 bits (365), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 73/170 (42%), Positives = 108/170 (63%), Gaps = 1/170 (0%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYV-LYSNDNRELRILKMYRKNKR 59
           M KL+  VLMATIG   GL GEV   +Y  +P  L  Y  L+S D R   +L++      
Sbjct: 5   MTKLENPVLMATIGGAQGLRGEVRAKAYTADPGALGDYGHLHSMDGRSFEVLEIREMKNV 64

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +  F G+++ ++A  L  L+LY +R +  DEEL+EDEF+  DLE +E  D +G  +G V
Sbjct: 65  VVVRFRGVNDRNAAEALNGLELYIERDNLPDEELDEDEFYYADLEGLEARDDKGVSYGTV 124

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
            GV++FGAG +LE+K   ++  LIPF++ +VLE++L+   +LIDP+AAGL
Sbjct: 125 TGVFDFGAGDLLELKGPGKRPVLIPFSEASVLEIDLEAGTLLIDPLAAGL 174


>gi|172046212|sp|Q1MAK4|RIMM_RHIL3 RecName: Full=Ribosome maturation factor rimM
          Length = 189

 Score =  144 bits (364), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 73/170 (42%), Positives = 108/170 (63%), Gaps = 1/170 (0%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYV-LYSNDNRELRILKMYRKNKR 59
           M KL+  VLMATIG   GL GEV   +Y  +P  L  Y  L+S D R   +L++      
Sbjct: 1   MTKLENPVLMATIGGAQGLRGEVRAKAYTADPGALGDYGHLHSMDGRSFEVLEIREMKNV 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +  F G+++ ++A  L  L+LY +R +  DEEL+EDEF+  DLE +E  D +G  +G V
Sbjct: 61  VVVRFRGVNDRNAAEALNGLELYIERDNLPDEELDEDEFYYADLEGLEARDDKGVSYGTV 120

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
            GV++FGAG +LE+K   ++  LIPF++ +VLE++L+   +LIDP+AAGL
Sbjct: 121 TGVFDFGAGDLLELKGPGKRPVLIPFSEASVLEIDLEAGTLLIDPLAAGL 170


>gi|209573734|sp|A6UE44|RIMM_SINMW RecName: Full=Ribosome maturation factor rimM
          Length = 187

 Score =  137 bits (346), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 76/183 (41%), Positives = 112/183 (61%), Gaps = 1/183 (0%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYV-LYSNDNRELRILKMYRKNKR 59
           M +L   VLMATIG   GL GEV + S+ ++P  L  Y  L+S D R   +L++      
Sbjct: 1   MTQLKNPVLMATIGAAQGLRGEVRVKSFTDDPTALGDYGNLHSEDGRVFEVLEIREAKNV 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +  F G+++  +A  L  L+L+ +R +  D++L+EDEFF  DLE ME  DR GK +G V
Sbjct: 61  VVVRFRGVNDRTAAEALNGLELFIERDNLPDDDLDEDEFFYADLEGMEAVDRTGKSYGSV 120

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQY 179
            GV++FGAG +LE+K    +  LIPFT+++VLE++L+  K++IDP AAGL +     P  
Sbjct: 121 TGVFDFGAGDLLELKGPGLRPVLIPFTEWSVLEIDLEAGKLVIDPTAAGLVDDEKSGPGK 180

Query: 180 DCP 182
             P
Sbjct: 181 PFP 183


>gi|227823735|ref|YP_002827708.1| 16S rRNA-processing protein RimM [Sinorhizobium fredii NGR234]
 gi|254797759|sp|C3MAG2|RIMM_RHISN RecName: Full=Ribosome maturation factor rimM
 gi|227342737|gb|ACP26955.1| 16S rRNA processing protein RimM [Sinorhizobium fredii NGR234]
          Length = 187

 Score =  137 bits (345), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 110/170 (64%), Gaps = 1/170 (0%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYV-LYSNDNRELRILKMYRKNKR 59
           M KL+  VLMATIG   GL GEV + S+ ++P  L  Y  L+S D R   +L++      
Sbjct: 1   MTKLENPVLMATIGAAQGLRGEVRVKSFTDDPTALGDYGNLHSEDGRVFEVLEVRETKNV 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F GI++  +A  L  L+L+ +R +  D++L+EDEFF  DLE +E  D  GK +G V
Sbjct: 61  VIVRFRGINDRSAAEALNGLELFIERDNLPDDDLDEDEFFYADLEGLEAVDGTGKSYGSV 120

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
            GV++FGAG +LE+K    +  LIPFT+++VLE++L+  K+L+DP+AAGL
Sbjct: 121 TGVFDFGAGDLLELKGPGRRPVLIPFTEWSVLEIDLEAGKLLVDPVAAGL 170


>gi|150398292|ref|YP_001328759.1| 16S rRNA-processing protein RimM [Sinorhizobium medicae WSM419]
 gi|150029807|gb|ABR61924.1| 16S rRNA processing protein RimM [Sinorhizobium medicae WSM419]
          Length = 206

 Score =  137 bits (345), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 76/183 (41%), Positives = 112/183 (61%), Gaps = 1/183 (0%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYV-LYSNDNRELRILKMYRKNKR 59
           M +L   VLMATIG   GL GEV + S+ ++P  L  Y  L+S D R   +L++      
Sbjct: 20  MTQLKNPVLMATIGAAQGLRGEVRVKSFTDDPTALGDYGNLHSEDGRVFEVLEIREAKNV 79

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +  F G+++  +A  L  L+L+ +R +  D++L+EDEFF  DLE ME  DR GK +G V
Sbjct: 80  VVVRFRGVNDRTAAEALNGLELFIERDNLPDDDLDEDEFFYADLEGMEAVDRTGKSYGSV 139

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQY 179
            GV++FGAG +LE+K    +  LIPFT+++VLE++L+  K++IDP AAGL +     P  
Sbjct: 140 TGVFDFGAGDLLELKGPGLRPVLIPFTEWSVLEIDLEAGKLVIDPTAAGLVDDEKSGPGK 199

Query: 180 DCP 182
             P
Sbjct: 200 PFP 202


>gi|15966996|ref|NP_387349.1| 16S rRNA-processing protein [Sinorhizobium meliloti 1021]
 gi|307302464|ref|ZP_07582221.1| 16S rRNA processing protein RimM [Sinorhizobium meliloti BL225C]
 gi|307316206|ref|ZP_07595650.1| 16S rRNA processing protein RimM [Sinorhizobium meliloti AK83]
 gi|21362866|sp|Q92L42|RIMM_RHIME RecName: Full=Ribosome maturation factor rimM
 gi|15076269|emb|CAC47822.1| Probable 16S rRNA processing protein [Sinorhizobium meliloti 1021]
 gi|306898046|gb|EFN28788.1| 16S rRNA processing protein RimM [Sinorhizobium meliloti AK83]
 gi|306903134|gb|EFN33724.1| 16S rRNA processing protein RimM [Sinorhizobium meliloti BL225C]
          Length = 187

 Score =  136 bits (343), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 76/183 (41%), Positives = 112/183 (61%), Gaps = 1/183 (0%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYV-LYSNDNRELRILKMYRKNKR 59
           M +L   VLMATIG   GL GEV + S+ ++P  L  Y  L+S D R   +L++      
Sbjct: 1   MTQLKNPVLMATIGAAQGLRGEVRVKSFTDDPAALGDYGNLHSEDGRVFEVLEIREAKNV 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +  F GI++  +A  L  L+L+ +R +  D++L+EDEFF  DLE +E  DR GK +G V
Sbjct: 61  VVVRFRGINDRTAAEALNGLELFIERDNLPDDDLDEDEFFYADLEGLEAVDRTGKSYGSV 120

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQY 179
            GV++FGAG +LE+K    +  LIPFT+++VLE++L+  K++IDP AAGL +     P  
Sbjct: 121 TGVFDFGAGDLLELKGPGLRPVLIPFTEWSVLEIDLEAGKLVIDPTAAGLVDDEKSGPGK 180

Query: 180 DCP 182
             P
Sbjct: 181 PFP 183


>gi|325294071|ref|YP_004279935.1| Ribosome maturation factor rimM [Agrobacterium sp. H13-3]
 gi|325061924|gb|ADY65615.1| Ribosome maturation factor rimM [Agrobacterium sp. H13-3]
          Length = 188

 Score =  131 bits (330), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 73/170 (42%), Positives = 108/170 (63%), Gaps = 1/170 (0%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYV-LYSNDNRELRILKMYRKNKR 59
           M KL+  +LMA IG   GL GEV + +Y + P+ L  Y  L S D R   IL++      
Sbjct: 1   MAKLENPILMAKIGGAQGLRGEVRVSTYTDEPMALGDYGNLVSADGRVFEILEVREGKNV 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +  F GI++ ++A  L  L+L+ +R +  D+EL++DEF+  DLE +E  D +GK +G V
Sbjct: 61  VVVRFRGINDRNAAESLNGLELFIERDNLPDDELDDDEFYYADLEGLEAVDAEGKSYGAV 120

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
             VY+FGAG +LE+K    +  LIPF++ AVLE++L+  +ILIDP+AAGL
Sbjct: 121 SAVYDFGAGDLLELKGAGRRPALIPFSEAAVLEIDLEARRILIDPMAAGL 170


>gi|22001903|sp|Q8UBZ8|RIMM_AGRT5 RecName: Full=Ribosome maturation factor rimM
          Length = 188

 Score =  131 bits (329), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 72/170 (42%), Positives = 109/170 (64%), Gaps = 1/170 (0%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYV-LYSNDNRELRILKMYRKNKR 59
           M KL+  +LMA IG   GL GEV + +Y ++P+ L  Y  L + D R   IL++      
Sbjct: 1   MAKLENPILMAKIGGAQGLRGEVRVSTYTDDPMALGDYGNLVTADGRVFEILEVREGKNV 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +  F GI++ ++A  L  L+L+ +R +  D+EL++DEF+  DLE +E  D +GK +G V
Sbjct: 61  VVVRFRGINDRNAAESLNGLELFIERDNLPDDELDDDEFYYADLEGLEAVDAEGKSYGAV 120

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
             VY+FGAG +LE+K    +  LIPF++ AVLE++L+  +ILIDP+AAGL
Sbjct: 121 SAVYDFGAGDLLELKGAGRRPALIPFSEAAVLEIDLEAGRILIDPMAAGL 170


>gi|159185334|ref|NP_355635.2| 16S rRNA-processing protein [Agrobacterium tumefaciens str. C58]
 gi|159140589|gb|AAK88420.2| 16S rRNA processing protein [Agrobacterium tumefaciens str. C58]
          Length = 179

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 103/161 (63%), Gaps = 1/161 (0%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNRYV-LYSNDNRELRILKMYRKNKRFIATFSGID 68
           MA IG   GL GEV + +Y ++P+ L  Y  L + D R   IL++       +  F GI+
Sbjct: 1   MAKIGGAQGLRGEVRVSTYTDDPMALGDYGNLVTADGRVFEILEVREGKNVVVVRFRGIN 60

Query: 69  NIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFGAG 128
           + ++A  L  L+L+ +R +  D+EL++DEF+  DLE +E  D +GK +G V  VY+FGAG
Sbjct: 61  DRNAAESLNGLELFIERDNLPDDELDDDEFYYADLEGLEAVDAEGKSYGAVSAVYDFGAG 120

Query: 129 SILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
            +LE+K    +  LIPF++ AVLE++L+  +ILIDP+AAGL
Sbjct: 121 DLLELKGAGRRPALIPFSEAAVLEIDLEAGRILIDPMAAGL 161


>gi|306843366|ref|ZP_07475967.1| 16S rRNA processing protein RimM [Brucella sp. BO1]
 gi|306276057|gb|EFM57757.1| 16S rRNA processing protein RimM [Brucella sp. BO1]
          Length = 189

 Score =  122 bits (305), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 60/182 (32%), Positives = 99/182 (54%), Gaps = 1/182 (0%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKR 59
           M + +  + +A IG  HG  GEV + ++  +P+ +  Y +LY    +   IL+       
Sbjct: 1   MPRPENPIQLAVIGAAHGTRGEVRVKTFTGDPLAIADYGLLYDEQGKAYEILEARVAKTV 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F G+++ ++A  L   +L+  R    DEEL+EDEFF TDL  +E  D  GK +G V
Sbjct: 61  VIVRFKGVNDRNTAEALNGTELFIDRSQLPDEELDEDEFFQTDLIGLEAVDEDGKSYGVV 120

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQY 179
             +++FG G ++E+    ++  LIPFT+ AV E++  +  I ++P AAGL      NP +
Sbjct: 121 SAIFDFGGGDLIELSEKGKRPMLIPFTEAAVPEIDFDKGIIKVEPYAAGLIADEHDNPPH 180

Query: 180 DC 181
           + 
Sbjct: 181 ES 182


>gi|254717977|ref|ZP_05179788.1| 16S rRNA-processing protein RimM [Brucella sp. 83/13]
 gi|265982920|ref|ZP_06095655.1| ribosome maturation factor rimM [Brucella sp. 83/13]
 gi|306838930|ref|ZP_07471757.1| 16S rRNA processing protein RimM [Brucella sp. NF 2653]
 gi|306842935|ref|ZP_07475569.1| 16S rRNA processing protein RimM [Brucella sp. BO2]
 gi|264661512|gb|EEZ31773.1| ribosome maturation factor rimM [Brucella sp. 83/13]
 gi|306286863|gb|EFM58388.1| 16S rRNA processing protein RimM [Brucella sp. BO2]
 gi|306406000|gb|EFM62252.1| 16S rRNA processing protein RimM [Brucella sp. NF 2653]
          Length = 189

 Score =  121 bits (304), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 63/191 (32%), Positives = 103/191 (53%), Gaps = 6/191 (3%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKR 59
           M + +  + +A IG  HG  GEV + ++  +P+ +  Y +LY    +   IL+       
Sbjct: 1   MPRPENPIQLAVIGAAHGTRGEVRVKTFTGDPLAIADYGLLYDEQGKAYEILEARVAKTV 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F G+++ ++A  L   +L+  R    DEEL+EDEFF TDL  +E  D  GK +G V
Sbjct: 61  VIVRFKGVNDRNAAEALNGTELFIDRSQLPDEELDEDEFFQTDLIGLEAVDGDGKSYGVV 120

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQY 179
             +++FG G ++E+    ++  LIPFT+ AV E++  +  I ++P AAGL        ++
Sbjct: 121 SAIFDFGGGDLIELSEKGKRPMLIPFTEAAVPEIDFDKGIIKVEPHAAGLIAD-----EH 175

Query: 180 DCPLDSAGKKS 190
           D P   +GKK 
Sbjct: 176 DTPPHESGKKP 186


>gi|256158416|ref|ZP_05456314.1| 16S rRNA-processing protein RimM [Brucella ceti M490/95/1]
 gi|256253836|ref|ZP_05459372.1| 16S rRNA-processing protein RimM [Brucella ceti B1/94]
 gi|261220971|ref|ZP_05935252.1| ribosome maturation factor rimM [Brucella ceti B1/94]
 gi|265996930|ref|ZP_06109487.1| ribosome maturation factor rimM [Brucella ceti M490/95/1]
 gi|260919555|gb|EEX86208.1| ribosome maturation factor rimM [Brucella ceti B1/94]
 gi|262551398|gb|EEZ07388.1| ribosome maturation factor rimM [Brucella ceti M490/95/1]
          Length = 189

 Score =  121 bits (304), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 60/182 (32%), Positives = 99/182 (54%), Gaps = 1/182 (0%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKR 59
           M + +  + +A IG  HG  GEV + ++  +P+ +  Y +LY    +   IL+       
Sbjct: 1   MPRPENPIQLAVIGAAHGTRGEVRVKTFTGDPLAIADYGLLYDEQGKAYEILEARVAKTV 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F G+++ ++A  L   +L+  R    DEEL+EDEFF TDL  +E  D  GK +G V
Sbjct: 61  VIVRFKGVNDRNAAEALNGTELFIDRSQLPDEELDEDEFFQTDLIGLEAVDGDGKSYGVV 120

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQY 179
             +++FG G ++E+    ++  LIPFT+ AV E++  +  I ++P AAGL      NP +
Sbjct: 121 SAIFDFGGGDLIELSEKGKRPMLIPFTEAAVPEIDFDKGIIKVEPHAAGLIADEHDNPSH 180

Query: 180 DC 181
           + 
Sbjct: 181 ES 182


>gi|17986432|ref|NP_539066.1| 16S rRNA-processing protein RimM [Brucella melitensis bv. 1 str.
           16M]
 gi|23502765|ref|NP_698892.1| 16S rRNA-processing protein RimM [Brucella suis 1330]
 gi|62290769|ref|YP_222562.1| 16S rRNA-processing protein RimM [Brucella abortus bv. 1 str.
           9-941]
 gi|82700681|ref|YP_415255.1| 16S rRNA-processing protein RimM [Brucella melitensis biovar
           Abortus 2308]
 gi|148559613|ref|YP_001259739.1| 16S rRNA-processing protein RimM [Brucella ovis ATCC 25840]
 gi|161619833|ref|YP_001593720.1| 16S rRNA-processing protein [Brucella canis ATCC 23365]
 gi|163843938|ref|YP_001628342.1| 16S rRNA-processing protein [Brucella suis ATCC 23445]
 gi|189024984|ref|YP_001935752.1| 16S rRNA-processing protein RimM [Brucella abortus S19]
 gi|225628114|ref|ZP_03786149.1| 16S rRNA processing protein RimM [Brucella ceti str. Cudo]
 gi|225853352|ref|YP_002733585.1| 16S rRNA-processing protein RimM [Brucella melitensis ATCC 23457]
 gi|237816276|ref|ZP_04595269.1| 16S rRNA processing protein RimM [Brucella abortus str. 2308 A]
 gi|254690059|ref|ZP_05153313.1| 16S rRNA-processing protein RimM [Brucella abortus bv. 6 str. 870]
 gi|254694547|ref|ZP_05156375.1| 16S rRNA-processing protein RimM [Brucella abortus bv. 3 str.
           Tulya]
 gi|254696172|ref|ZP_05158000.1| 16S rRNA-processing protein RimM [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254700559|ref|ZP_05162387.1| 16S rRNA-processing protein RimM [Brucella suis bv. 5 str. 513]
 gi|254704929|ref|ZP_05166757.1| 16S rRNA-processing protein RimM [Brucella suis bv. 3 str. 686]
 gi|254707557|ref|ZP_05169385.1| 16S rRNA-processing protein RimM [Brucella pinnipedialis
           M163/99/10]
 gi|254708906|ref|ZP_05170717.1| 16S rRNA-processing protein RimM [Brucella pinnipedialis B2/94]
 gi|254713667|ref|ZP_05175478.1| 16S rRNA-processing protein RimM [Brucella ceti M644/93/1]
 gi|254715979|ref|ZP_05177790.1| 16S rRNA-processing protein RimM [Brucella ceti M13/05/1]
 gi|254731090|ref|ZP_05189668.1| 16S rRNA-processing protein RimM [Brucella abortus bv. 4 str. 292]
 gi|256030432|ref|ZP_05444046.1| 16S rRNA-processing protein RimM [Brucella pinnipedialis M292/94/1]
 gi|256045522|ref|ZP_05448405.1| 16S rRNA-processing protein RimM [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256059891|ref|ZP_05450078.1| 16S rRNA-processing protein RimM [Brucella neotomae 5K33]
 gi|256112249|ref|ZP_05453170.1| 16S rRNA-processing protein RimM [Brucella melitensis bv. 3 str.
           Ether]
 gi|256258312|ref|ZP_05463848.1| 16S rRNA-processing protein RimM [Brucella abortus bv. 9 str. C68]
 gi|256263162|ref|ZP_05465694.1| ribosome maturation factor rimM [Brucella melitensis bv. 2 str.
           63/9]
 gi|256370317|ref|YP_003107828.1| 16S rRNA-processing protein [Brucella microti CCM 4915]
 gi|260169342|ref|ZP_05756153.1| 16S rRNA-processing protein RimM [Brucella sp. F5/99]
 gi|260546036|ref|ZP_05821776.1| ribosome maturation factor rimM [Brucella abortus NCTC 8038]
 gi|260562832|ref|ZP_05833318.1| ribosome maturation factor rimM [Brucella melitensis bv. 1 str.
           16M]
 gi|260567596|ref|ZP_05838066.1| ribosome maturation factor rimM [Brucella suis bv. 4 str. 40]
 gi|260755594|ref|ZP_05867942.1| ribosome maturation factor rimM [Brucella abortus bv. 6 str. 870]
 gi|260758820|ref|ZP_05871168.1| ribosome maturation factor rimM [Brucella abortus bv. 4 str. 292]
 gi|260760544|ref|ZP_05872887.1| ribosome maturation factor rimM [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260884620|ref|ZP_05896234.1| ribosome maturation factor rimM [Brucella abortus bv. 9 str. C68]
 gi|261214867|ref|ZP_05929148.1| ribosome maturation factor rimM [Brucella abortus bv. 3 str. Tulya]
 gi|261217744|ref|ZP_05932025.1| ribosome maturation factor rimM [Brucella ceti M13/05/1]
 gi|261315041|ref|ZP_05954238.1| ribosome maturation factor rimM [Brucella pinnipedialis M163/99/10]
 gi|261316402|ref|ZP_05955599.1| ribosome maturation factor rimM [Brucella pinnipedialis B2/94]
 gi|261321408|ref|ZP_05960605.1| ribosome maturation factor rimM [Brucella ceti M644/93/1]
 gi|261323862|ref|ZP_05963059.1| ribosome maturation factor rimM [Brucella neotomae 5K33]
 gi|261751063|ref|ZP_05994772.1| ribosome maturation factor rimM [Brucella suis bv. 5 str. 513]
 gi|261755625|ref|ZP_05999334.1| ribosome maturation factor rimM [Brucella suis bv. 3 str. 686]
 gi|261758858|ref|ZP_06002567.1| ribosome maturation factor rimM [Brucella sp. F5/99]
 gi|265987474|ref|ZP_06100031.1| ribosome maturation factor rimM [Brucella pinnipedialis M292/94/1]
 gi|265991946|ref|ZP_06104503.1| ribosome maturation factor rimM [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265993678|ref|ZP_06106235.1| ribosome maturation factor rimM [Brucella melitensis bv. 3 str.
           Ether]
 gi|294851156|ref|ZP_06791829.1| 16S rRNA processing protein RimM [Brucella sp. NVSL 07-0026]
 gi|297247157|ref|ZP_06930875.1| 16S rRNA processing protein RimM [Brucella abortus bv. 5 str.
           B3196]
 gi|54039057|sp|P66652|RIMM_BRUSU RecName: Full=Ribosome maturation factor rimM
 gi|54041927|sp|P66651|RIMM_BRUME RecName: Full=Ribosome maturation factor rimM
 gi|75496198|sp|Q57AY3|RIMM_BRUAB RecName: Full=Ribosome maturation factor rimM
 gi|109893002|sp|Q2YLT0|RIMM_BRUA2 RecName: Full=Ribosome maturation factor rimM
 gi|166226428|sp|A5VSP2|RIMM_BRUO2 RecName: Full=Ribosome maturation factor rimM
 gi|189040127|sp|A9M8Q1|RIMM_BRUC2 RecName: Full=Ribosome maturation factor rimM
 gi|189040128|sp|B0CIR9|RIMM_BRUSI RecName: Full=Ribosome maturation factor rimM
 gi|238689405|sp|B2S869|RIMM_BRUA1 RecName: Full=Ribosome maturation factor rimM
 gi|254797745|sp|C0RFF9|RIMM_BRUMB RecName: Full=Ribosome maturation factor rimM
 gi|17982028|gb|AAL51330.1| 16S ribosomal RNA processing protein rimm [Brucella melitensis bv.
           1 str. 16M]
 gi|23348784|gb|AAN30807.1| 16S rRNA processing protein RimM [Brucella suis 1330]
 gi|62196901|gb|AAX75201.1| RimM, 16S rRNA processing protein [Brucella abortus bv. 1 str.
           9-941]
 gi|82616782|emb|CAJ11871.1| ATP/GTP-binding site motif A (P-loop):RimM protein [Brucella
           melitensis biovar Abortus 2308]
 gi|148370870|gb|ABQ60849.1| 16S rRNA processing protein RimM [Brucella ovis ATCC 25840]
 gi|161336644|gb|ABX62949.1| 16S rRNA processing protein RimM [Brucella canis ATCC 23365]
 gi|163674661|gb|ABY38772.1| 16S rRNA processing protein RimM [Brucella suis ATCC 23445]
 gi|189020556|gb|ACD73278.1| RimM protein [Brucella abortus S19]
 gi|225616939|gb|EEH13986.1| 16S rRNA processing protein RimM [Brucella ceti str. Cudo]
 gi|225641717|gb|ACO01631.1| 16S rRNA processing protein RimM [Brucella melitensis ATCC 23457]
 gi|237788343|gb|EEP62558.1| 16S rRNA processing protein RimM [Brucella abortus str. 2308 A]
 gi|256000480|gb|ACU48879.1| 16S rRNA-processing protein [Brucella microti CCM 4915]
 gi|260096143|gb|EEW80019.1| ribosome maturation factor rimM [Brucella abortus NCTC 8038]
 gi|260152848|gb|EEW87940.1| ribosome maturation factor rimM [Brucella melitensis bv. 1 str.
           16M]
 gi|260157114|gb|EEW92194.1| ribosome maturation factor rimM [Brucella suis bv. 4 str. 40]
 gi|260669138|gb|EEX56078.1| ribosome maturation factor rimM [Brucella abortus bv. 4 str. 292]
 gi|260670976|gb|EEX57797.1| ribosome maturation factor rimM [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260675702|gb|EEX62523.1| ribosome maturation factor rimM [Brucella abortus bv. 6 str. 870]
 gi|260874148|gb|EEX81217.1| ribosome maturation factor rimM [Brucella abortus bv. 9 str. C68]
 gi|260916474|gb|EEX83335.1| ribosome maturation factor rimM [Brucella abortus bv. 3 str. Tulya]
 gi|260922833|gb|EEX89401.1| ribosome maturation factor rimM [Brucella ceti M13/05/1]
 gi|261294098|gb|EEX97594.1| ribosome maturation factor rimM [Brucella ceti M644/93/1]
 gi|261295625|gb|EEX99121.1| ribosome maturation factor rimM [Brucella pinnipedialis B2/94]
 gi|261299842|gb|EEY03339.1| ribosome maturation factor rimM [Brucella neotomae 5K33]
 gi|261304067|gb|EEY07564.1| ribosome maturation factor rimM [Brucella pinnipedialis M163/99/10]
 gi|261738842|gb|EEY26838.1| ribosome maturation factor rimM [Brucella sp. F5/99]
 gi|261740816|gb|EEY28742.1| ribosome maturation factor rimM [Brucella suis bv. 5 str. 513]
 gi|261745378|gb|EEY33304.1| ribosome maturation factor rimM [Brucella suis bv. 3 str. 686]
 gi|262764659|gb|EEZ10580.1| ribosome maturation factor rimM [Brucella melitensis bv. 3 str.
           Ether]
 gi|263003012|gb|EEZ15305.1| ribosome maturation factor rimM [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263093067|gb|EEZ17217.1| ribosome maturation factor rimM [Brucella melitensis bv. 2 str.
           63/9]
 gi|264659671|gb|EEZ29932.1| ribosome maturation factor rimM [Brucella pinnipedialis M292/94/1]
 gi|294819745|gb|EFG36744.1| 16S rRNA processing protein RimM [Brucella sp. NVSL 07-0026]
 gi|297174326|gb|EFH33673.1| 16S rRNA processing protein RimM [Brucella abortus bv. 5 str.
           B3196]
 gi|326409917|gb|ADZ66982.1| RimM protein [Brucella melitensis M28]
 gi|326539630|gb|ADZ87845.1| 16S rRNA processing protein RimM [Brucella melitensis M5-90]
          Length = 189

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 60/182 (32%), Positives = 99/182 (54%), Gaps = 1/182 (0%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKR 59
           M + +  + +A IG  HG  GEV + ++  +P+ +  Y +LY    +   IL+       
Sbjct: 1   MPRPENPIQLAVIGAAHGTRGEVRVKTFTGDPLAIADYGLLYDEQGKAYEILEARVAKTV 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F G+++ ++A  L   +L+  R    DEEL+EDEFF TDL  +E  D  GK +G V
Sbjct: 61  VIVRFKGVNDRNAAEALNGTELFIDRSQLPDEELDEDEFFQTDLIGLEAVDGDGKSYGVV 120

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQY 179
             +++FG G ++E+    ++  LIPFT+ AV E++  +  I ++P AAGL      NP +
Sbjct: 121 SAIFDFGGGDLIELSEKGKRPMLIPFTEAAVPEIDFDKGIIKVEPHAAGLIADEHDNPPH 180

Query: 180 DC 181
           + 
Sbjct: 181 ES 182


>gi|240851323|ref|YP_002972726.1| 16S rRNA processing protein RimM [Bartonella grahamii as4aup]
 gi|240268446|gb|ACS52034.1| 16S rRNA processing protein RimM [Bartonella grahamii as4aup]
          Length = 185

 Score =  120 bits (302), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 63/170 (37%), Positives = 97/170 (57%), Gaps = 2/170 (1%)

Query: 3   KLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKRFI 61
           KL   V +A IG  HG+ G+V++   +  P     Y  LY +  R   I+ +  +  + I
Sbjct: 7   KLKNKVYLAIIGMPHGIKGDVFVKILSAEPQRFKSYSTLYDDMGRSYEIVTLRIQKNKAI 66

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
             F G++N + A  L+ ++LY  R    D+ L+EDEF+  DL  +   D  GK  G+VCG
Sbjct: 67  VRFKGVENRNVAESLKGIRLYVMRDQLIDD-LDEDEFYQVDLIGLRVQDCGGKVVGEVCG 125

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN 171
            +NFGAG +LEI+    K  LIPF+K AV E+ +    +++DP+AAGL++
Sbjct: 126 FFNFGAGDLLEIRLNTSKRVLIPFSKVAVPEICMDSGFLVVDPMAAGLSD 175


>gi|319780737|ref|YP_004140213.1| 16S rRNA processing protein RimM [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317166625|gb|ADV10163.1| 16S rRNA processing protein RimM [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 199

 Score =  120 bits (301), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 64/170 (37%), Positives = 94/170 (55%), Gaps = 2/170 (1%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKR 59
           M KL   V MA IG  HG+ GE+ + ++   P+ L  Y  LY+ D R  +I+ +   N  
Sbjct: 1   MSKLQNPVQMAVIGAAHGIKGELRVKTFTGEPLALADYGPLYARDGRAFQIVDIRPANTV 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +  F GI + ++A  L   +L+  R    D+  EEDEF++ DL  +E  D  G   G+V
Sbjct: 61  VVVRFKGIADRNAAEALAGTELFVDRSMLPDDG-EEDEFYHADLVGLEVRDDTGAVLGKV 119

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
             V+NFG G IL++     K  LIPFT+ AV +V++ E  + +DP AAGL
Sbjct: 120 VAVHNFGGGDILDVTLGGRKGVLIPFTQAAVPQVSIAEGFVRVDPAAAGL 169


>gi|49476238|ref|YP_034279.1| 16s rRNA processing protein rimM [Bartonella henselae str.
           Houston-1]
 gi|59798261|sp|Q6G1R8|RIMM_BARHE RecName: Full=Ribosome maturation factor rimM
 gi|49239046|emb|CAF28346.1| 16s rRNA processing protein rimM [Bartonella henselae str.
           Houston-1]
          Length = 180

 Score =  120 bits (300), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 64/170 (37%), Positives = 97/170 (57%), Gaps = 2/170 (1%)

Query: 3   KLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKRFI 61
           KL   V +A IG  HG+ G+V +   ++ P  L  Y  LY +      I+ +  + K  I
Sbjct: 7   KLKNKVCLAIIGMPHGIKGDVLLKILSSEPQRLKTYGTLYDDRGHSYEIVMLRMQKKNAI 66

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
             F G+++  +A  LR + LY  R    D+ L EDEF+  DL  +   D  G+  G+V G
Sbjct: 67  VHFKGVEDRSAAEALRGIHLYVARDQLVDD-LTEDEFYQVDLIGLRVQDCTGRILGEVSG 125

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN 171
           ++NFGAG +LE++    KT LIPF+K AVLEV +    +++DP+AAGL++
Sbjct: 126 LFNFGAGDLLEMRLNTGKTVLIPFSKAAVLEVCIASGFLVVDPVAAGLSD 175


>gi|260464186|ref|ZP_05812379.1| 16S rRNA processing protein RimM [Mesorhizobium opportunistum
           WSM2075]
 gi|259029989|gb|EEW31272.1| 16S rRNA processing protein RimM [Mesorhizobium opportunistum
           WSM2075]
          Length = 199

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 67/190 (35%), Positives = 98/190 (51%), Gaps = 2/190 (1%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKR 59
           M K    V MA IG  HG+ GE+ + ++   P+ L  Y  LYS D R  +I+ +   N  
Sbjct: 1   MSKPQNPVQMAVIGAAHGIKGELRVKTFTGEPMALADYGPLYSRDGRAFQIIDIRPANTV 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +  F G+ + ++A  L   +L+  R    D+  EEDEF++ DL  +E  D  G   G+V
Sbjct: 61  VVVRFKGVTDRNTAEALAGTELFVDRSMLPDDG-EEDEFYHADLIGLEVRDDTGAALGKV 119

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQY 179
             V+NFG G IL++     K  LIPFT+ AV +V++ E  + IDP AAGL       P  
Sbjct: 120 VAVHNFGGGDILDVTLGGRKGVLIPFTQAAVPQVSIAEGFVRIDPAAAGLVEDEDGEPPR 179

Query: 180 DCPLDSAGKK 189
           +   D  G+ 
Sbjct: 180 EEDFDPKGRP 189


>gi|121602541|ref|YP_988423.1| 16S rRNA processing protein RimM [Bartonella bacilliformis KC583]
 gi|166226425|sp|A1UR20|RIMM_BARBK RecName: Full=Ribosome maturation factor rimM
 gi|120614718|gb|ABM45319.1| 16S rRNA processing protein RimM [Bartonella bacilliformis KC583]
          Length = 191

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 63/168 (37%), Positives = 97/168 (57%), Gaps = 2/168 (1%)

Query: 3   KLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKRFI 61
           +L+K VL+A I   HG+ G+V ++     P  L  Y VLY +  R   I+ M       I
Sbjct: 7   ELNKAVLLAVIRAAHGIRGDVVVNLLGAEPQRLKTYGVLYDDKGRLYEIVSMRVHKNNVI 66

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
             F G+D+  +A  L+ ++LY +R  F D+ L+ DEF+  DL  +  +D   +  G+V G
Sbjct: 67  VRFKGVDDRSTAEALKGVQLYIERDQFADD-LDTDEFYQIDLIGLRVYDNTNQLLGEVSG 125

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
            +NFGAG +LE++    KT LIPF+K AV E+ +    +++DP+AAGL
Sbjct: 126 FFNFGAGDLLEVRLISHKTELIPFSKAAVPEICVASGFLVVDPVAAGL 173


>gi|13473626|ref|NP_105194.1| 16S rRNA-processing protein RimM [Mesorhizobium loti MAFF303099]
 gi|21362871|sp|Q98EE0|RIMM_RHILO RecName: Full=Ribosome maturation factor rimM
 gi|14024376|dbj|BAB50980.1| putative 16S rRNA processing protein [Mesorhizobium loti
           MAFF303099]
          Length = 199

 Score =  119 bits (297), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 63/170 (37%), Positives = 93/170 (54%), Gaps = 2/170 (1%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKR 59
           M K    V MA IG  HG+ GE+ + ++   P+ L  Y  LY+ D R  +I  +   N  
Sbjct: 1   MSKPQNPVQMAVIGAAHGIKGELRVKTFTGEPMALADYGPLYARDGRAFQITDIRPANTV 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +  F GI + ++A  L   +L+  R    D+  EEDEF++ DL  +E  D  G   G+V
Sbjct: 61  VVVRFKGISDRNAAEALAGTELFVDRSMLPDDG-EEDEFYHADLVGLEVRDDTGTALGKV 119

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
             V+NFG G IL++     K  LIPFT+ AV +V++ E  + +DP+AAGL
Sbjct: 120 VAVHNFGGGDILDVTLAGRKGVLIPFTQAAVPDVSVAEGFVRVDPVAAGL 169


>gi|153008278|ref|YP_001369493.1| 16S rRNA-processing protein RimM [Ochrobactrum anthropi ATCC 49188]
 gi|166226460|sp|A6WXG0|RIMM_OCHA4 RecName: Full=Ribosome maturation factor rimM
 gi|151560166|gb|ABS13664.1| 16S rRNA processing protein RimM [Ochrobactrum anthropi ATCC 49188]
          Length = 189

 Score =  118 bits (296), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 56/170 (32%), Positives = 97/170 (57%), Gaps = 1/170 (0%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKR 59
           M + +  + +A IG  HG  GEV + ++  +P+ +  Y +LY    +   +L+       
Sbjct: 1   MPRPENPIQLAVIGAAHGTRGEVRVKTFTGDPLAIAEYGLLYDEQGKSYEVLEARPAKTV 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +  F GI++ ++A  L   +L+  R    D+EL+EDEFF TDL  +   D +GK +G V
Sbjct: 61  VVVRFKGINDRNAAEALNGTELFIDRSQLPDDELDEDEFFQTDLIGLLAVDAEGKTYGVV 120

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
             +++FG G ++E+    ++  LIPFT+ AV E++L +  +L++P AAGL
Sbjct: 121 SALFDFGGGDLIELSEKGKRPMLIPFTEAAVPEIDLDKGTLLVEPYAAGL 170


>gi|110635771|ref|YP_675979.1| 16S rRNA-processing protein [Mesorhizobium sp. BNC1]
 gi|122965539|sp|Q11CR1|RIMM_MESSB RecName: Full=Ribosome maturation factor rimM
 gi|110286755|gb|ABG64814.1| 16S rRNA processing protein RimM [Chelativorans sp. BNC1]
          Length = 212

 Score =  117 bits (293), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 62/174 (35%), Positives = 96/174 (55%), Gaps = 2/174 (1%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKRFIA 62
           ++  V +A IG  HG+ GEV + ++  +P+ L  Y  L+  D R L++  +    +  I 
Sbjct: 14  IENPVQLAVIGAAHGIKGEVRVKTFTEDPMALGSYGPLHMVDGRVLQVAAIRPAKEVVIV 73

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F G+D  ++A  L    L+  R     E+LEE+EF+  DL  M   D +G+  G+V  V
Sbjct: 74  RFKGVDGRNAAEALNGEALFVDRSALP-EKLEEEEFYYADLIGMAVLDEKGENLGRVVAV 132

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKN 176
           +NFGAG +LE +     T +IPFT+ AV +++L  N I ID I AGL+N  +  
Sbjct: 133 HNFGAGDLLEFRENSGPTVIIPFTRDAVPDIDLSNNTIRIDSITAGLDNAELSG 186


>gi|163869251|ref|YP_001610507.1| 16S rRNA-processing protein RimM [Bartonella tribocorum CIP 105476]
 gi|189040126|sp|A9IZB5|RIMM_BART1 RecName: Full=Ribosome maturation factor rimM
 gi|161018954|emb|CAK02512.1| 16S rRNA processing protein [Bartonella tribocorum CIP 105476]
          Length = 181

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 62/170 (36%), Positives = 94/170 (55%), Gaps = 2/170 (1%)

Query: 3   KLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKRFI 61
           KL   V +A IG  HG+ G+V++   + +P     Y  LY +  R   I+ +  +    I
Sbjct: 7   KLKNKVYLAIIGMPHGIRGDVFVKILSADPQRFKSYGTLYDDMGRSYEIVTLRTQKNNAI 66

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
             F G++N ++A  L+ + LY  R    D+ L EDEF+  DL  +   +  GK  G+VCG
Sbjct: 67  VRFKGVENRNAAESLKGIHLYVMRDQLIDD-LREDEFYQVDLIGLRVQEYGGKILGEVCG 125

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN 171
             NFGAG +LEI+    K  LIPF+K AV E+ +    +++DP+AAGL +
Sbjct: 126 FCNFGAGDLLEIRLNTGKRMLIPFSKVAVPEICMDSGFLIVDPMAAGLRD 175


>gi|319407794|emb|CBI81445.1| Ribosome maturation factor rimM [Bartonella sp. 1-1C]
          Length = 171

 Score =  114 bits (286), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 61/167 (36%), Positives = 94/167 (56%), Gaps = 2/167 (1%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKRFIA 62
           + K V +A IG  HG+NG+V +   ++NP  L  Y V Y    R   ++    +    I 
Sbjct: 1   MKKKVYLAIIGAAHGINGDVVVKVLSSNPESLKSYSVFYDETERSYEVVTFRVQKNNAII 60

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F GI+   +A  LR +KLY +R    D+ L+EDEF+  DL  +  ++   ++ G+V G 
Sbjct: 61  HFKGIEERSAAESLRGIKLYVERNQLADD-LDEDEFYQIDLIGLCVYNCAKQFLGKVSGF 119

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           +NFGAG ++EI+    K  LI F+K AV E+ +    +++DPIAAGL
Sbjct: 120 FNFGAGDLIEIQLVSGKKVLISFSKAAVPEICVASGFLIVDPIAAGL 166


>gi|49474760|ref|YP_032802.1| 16s rRNA processing protein rimM [Bartonella quintana str.
           Toulouse]
 gi|59798255|sp|Q6FYH3|RIMM_BARQU RecName: Full=Ribosome maturation factor rimM
 gi|49240264|emb|CAF26734.1| 16s rRNA processing protein rimM [Bartonella quintana str.
           Toulouse]
          Length = 197

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 64/176 (36%), Positives = 99/176 (56%), Gaps = 3/176 (1%)

Query: 3   KLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKRFI 61
           KL   V +A I   HG+ G+V +  ++  P  L  Y +LY +  R   I+ +  +    I
Sbjct: 7   KLKNKVYLAIIDLPHGVKGDVLVKVWSAEPQRLKTYGILYDDTGRPYEIVVLRVQKNNAI 66

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
             F G+++  +A  L+ ++LY  R    D+ L EDEF+  DL  +   D  G+  G+V G
Sbjct: 67  VHFKGVEDRSAAEALKGIRLYVTRDQLVDD-LAEDEFYQVDLIGLRVQDCAGQSLGKVSG 125

Query: 122 VYNFGAGSILEIK-NTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKN 176
            +NFGAG +LEI+ NT + T LIPF+K AV E+ +    ++++P+AAGL N   KN
Sbjct: 126 FFNFGAGDLLEIRLNTRKTTVLIPFSKAAVPEICVTSGFLVVEPVAAGLLNNKEKN 181


>gi|239833041|ref|ZP_04681370.1| 16S rRNA processing protein RimM [Ochrobactrum intermedium LMG
           3301]
 gi|239825308|gb|EEQ96876.1| 16S rRNA processing protein RimM [Ochrobactrum intermedium LMG
           3301]
          Length = 212

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 54/170 (31%), Positives = 96/170 (56%), Gaps = 1/170 (0%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKR 59
           M + +  + +A IG  HG  GEV + ++  +P+ +  Y +LY    +   +L+       
Sbjct: 25  MPRPENPIQLAVIGAAHGTRGEVRVKTFTGDPLAIADYGLLYDEQGKSYEVLEARPAKTV 84

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +  F GI++ ++A  L   +L+  R    D+EL+EDEF+ TDL  +   D +GK +G V
Sbjct: 85  VVVRFKGINDRNAAEALNGTELFIDRSQLPDDELDEDEFYQTDLIGLLAVDAEGKPYGVV 144

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
             +++FG G ++E+    ++  LIPFT+ AV E++  +  +L++P AAGL
Sbjct: 145 SALFDFGGGDLIELSEKGKRPMLIPFTEAAVPEIDFDKGILLVEPHAAGL 194


>gi|319404834|emb|CBI78435.1| Ribosome maturation factor rimM [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 171

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 60/167 (35%), Positives = 93/167 (55%), Gaps = 2/167 (1%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKRFIA 62
           + K V +A IG  HG+ G+V +   ++NP  L  Y V Y    R   ++    +    I 
Sbjct: 1   MKKKVYLAIIGAAHGIKGDVVVKVLSSNPESLKSYSVFYDETERSYEVVSFRMQKNNAII 60

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F GI+   +A  LR +KLY +R    D+ L+EDEF+  DL  +  ++   ++ G+V G 
Sbjct: 61  HFKGIEERSAAESLRGIKLYVERNQLADD-LDEDEFYQIDLIGLCVYNCAKQFLGKVSGF 119

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           +NFGAG ++EI+    K  LI F+K AV E+ +    +++DPIAAGL
Sbjct: 120 FNFGAGDLIEIQLVSGKKVLISFSKAAVPEICVASGFLIVDPIAAGL 166


>gi|319406318|emb|CBI79955.1| Ribosome maturation factor rimM [Bartonella sp. AR 15-3]
          Length = 169

 Score =  108 bits (271), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 58/169 (34%), Positives = 92/169 (54%), Gaps = 2/169 (1%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKRFIA 62
           + K V +A IG  HG+ G+V+I + +  P  L  Y V Y    R   ++    +    I 
Sbjct: 1   MKKKVYLAIIGAAHGIKGDVFIKALSTKPHSLKGYSVFYDETGRSYEVVTFRVQKNNAII 60

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F GI+   +A  LR +KLY +R    D+ L EDEF+  DL  +  ++   +  G+V G 
Sbjct: 61  HFKGIEERSAAEALRGIKLYVERSQLADD-LVEDEFYQIDLIGLCVYNCAKQLLGKVSGF 119

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN 171
           +NFGAG ++EI+    K  LI F+K  V ++ +    +++DPIAAGL++
Sbjct: 120 FNFGAGDLMEIQLVSGKKVLISFSKAVVPKICVSSGFLIVDPIAAGLSH 168


>gi|319899440|ref|YP_004159537.1| 16S rRNA-processing protein rimM [Bartonella clarridgeiae 73]
 gi|319403408|emb|CBI76976.1| putative 16S rRNA-processing protein rimM [Bartonella clarridgeiae
           73]
          Length = 171

 Score =  107 bits (268), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 59/169 (34%), Positives = 91/169 (53%), Gaps = 2/169 (1%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKRFIA 62
           + K V +A I   HG+ G+V++ + +  P  L  Y VLY    R   I+    +    I 
Sbjct: 1   MKKKVYLAIITAAHGIKGDVFVKTLSAEPQRLKSYSVLYDETGRAYEIVTFRVQKNNAIV 60

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F GI+    A  L+ +KLY +R    D+ L EDEF+  DL     +D   +  G+V G 
Sbjct: 61  HFKGIEERSVAESLKGIKLYVERSQLADD-LVEDEFYQIDLIGFCVYDCADQLLGKVSGF 119

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN 171
           +NFGAG +LE++    K  LI F+K AV ++ +    +++DPIAAGL++
Sbjct: 120 FNFGAGDLLEVRLASRKKVLISFSKAAVPKICVDSGFMIVDPIAAGLSH 168


>gi|319409397|emb|CBI83041.1| Ribosome maturation factor rimM [Bartonella schoenbuchensis R1]
          Length = 179

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 61/163 (37%), Positives = 86/163 (52%), Gaps = 2/163 (1%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKRFIATFSG 66
           + +A IG  HG+ G+V++      P  L  Y VLY    R   I     +    I  F G
Sbjct: 12  ICLAIIGAAHGIRGDVWVKVLGGEPERLKAYGVLYDKGGRCYEIATFRVQKNDAIVRFKG 71

Query: 67  IDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFG 126
           ++   +A  L+ + LY KR    D+ L EDEF+  DL  +  +D   K  G+V G +NFG
Sbjct: 72  VEERSAAEALKGINLYIKRDQLLDD-LAEDEFYQIDLIGLCVYDDADKRLGEVSGFFNFG 130

Query: 127 AGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           AG +LEI     K  LIPF+K AV E+ +    I+I+P+AAGL
Sbjct: 131 AGDLLEICLDGGKRELIPFSKAAVPEICVASGFIVINPVAAGL 173


>gi|118591421|ref|ZP_01548819.1| 16S rRNA processing protein RimM [Stappia aggregata IAM 12614]
 gi|118436093|gb|EAV42736.1| 16S rRNA processing protein RimM [Stappia aggregata IAM 12614]
          Length = 184

 Score =  103 bits (258), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 91/160 (56%), Gaps = 4/160 (2%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKRFIAT 63
           D+ VLMA IG  HG+ GEV +  Y ++P+    Y +L + D +    ++  R  K  + T
Sbjct: 6   DQKVLMAKIGAAHGIRGEVRVKPYGDDPLSFADYGILTTRDGKRSFEVERARVQKTVVIT 65

Query: 64  -FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F GI + + A EL  + L+  R      E EEDEF+ +DL  ++  D+ G+  G++  V
Sbjct: 66  KFKGITDRNQAEELNGIDLFIDRDQLP--EPEEDEFYYSDLTGLDVLDQTGETLGKIIAV 123

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
            +FGAG +LE++    ++F IPFTK  V E++L+  ++ +
Sbjct: 124 QDFGAGDLLEVRPKRGRSFYIPFTKDFVPEIDLENGRVCV 163


>gi|114705611|ref|ZP_01438514.1| 16S rRNA-processing protein [Fulvimarina pelagi HTCC2506]
 gi|114538457|gb|EAU41578.1| 16S rRNA-processing protein [Fulvimarina pelagi HTCC2506]
          Length = 185

 Score =  103 bits (257), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 58/169 (34%), Positives = 90/169 (53%), Gaps = 2/169 (1%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFI 61
           +KL+  VL+  +G  HG+ GEV + SY   P D+  Y    ++N     +K  R  K  +
Sbjct: 1   MKLENPVLLGVVGGAHGVRGEVRVKSYTEEPTDIGAYGPLQDENGNRYTVKTARSQKTVV 60

Query: 62  AT-FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
              F  ++  + A  L   +L+ +R    + E E+DEF+  DLE +      G   G V 
Sbjct: 61  VVKFDEVNERNHAERLNGRELFVERALLPEPE-EDDEFYLDDLEGLAVETLSGDPVGIVV 119

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
            V+NFGAG ILE+      T +IPF++ AV E++L+   + +DP+AAGL
Sbjct: 120 AVHNFGAGDILEVAPEEGTTLMIPFSEAAVPELDLETGLLKVDPLAAGL 168


>gi|85714455|ref|ZP_01045443.1| 16S rRNA processing protein RimM [Nitrobacter sp. Nb-311A]
 gi|85698902|gb|EAQ36771.1| 16S rRNA processing protein RimM [Nitrobacter sp. Nb-311A]
          Length = 202

 Score = 99.0 bits (245), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 52/161 (32%), Positives = 84/161 (52%), Gaps = 4/161 (2%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDN-RELRILKMYRKNKRFIA 62
           ++ V +A IG  HGL GEV + ++  +P+ + RY  L + D  R+L +          +A
Sbjct: 31  ERRVCVARIGAAHGLRGEVRLWTFTEDPMSVMRYGPLTTRDGARQLEVAHARAAKDHLVA 90

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
           TF+G+     A  L   +LY  R   K  + ++DEF++ DL  +   D  G   G V  +
Sbjct: 91  TFTGVTTREEAERLNGTELYVARD--KLPKTDDDEFYHADLIGLAAVDAAGTTLGTVAAI 148

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
           +NFGAG I+EI      T L+PFT   V  V++   +++I+
Sbjct: 149 HNFGAGDIIEIAPAQGPTLLLPFTDAVVPTVDIAGGRVVIE 189


>gi|75676965|ref|YP_319386.1| 16S rRNA processing protein RimM [Nitrobacter winogradskyi Nb-255]
 gi|109893027|sp|Q3SNV7|RIMM_NITWN RecName: Full=Ribosome maturation factor rimM
 gi|74421835|gb|ABA06034.1| 16S rRNA processing protein RimM [Nitrobacter winogradskyi Nb-255]
          Length = 173

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 53/161 (32%), Positives = 82/161 (50%), Gaps = 4/161 (2%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDN--RELRILKMYRKNKRFIATFS 65
           V +A IG  HGL GEV + ++  +P+ + RY   S  +  R+L +      +   IAT +
Sbjct: 5   VCVARIGAAHGLRGEVRLWTFTEDPMSVTRYGPLSTKDGARQLEVSHARAASDHLIATLT 64

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNF 125
           G+     A  L   +LY  R   K  E +E EF++ DL  +  FD  G   G V  ++NF
Sbjct: 65  GVTTREEAERLNGTELYVARD--KLPETDEGEFYHADLIGLAAFDAAGTALGTVAAIHNF 122

Query: 126 GAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIA 166
           GAG I+EI      T ++PFT   V  V++   +++I+  A
Sbjct: 123 GAGDIIEIAPARGPTLMLPFTDAVVPIVDIAGGRVVIEAPA 163


>gi|328541717|ref|YP_004301826.1| ribosome maturation factor rimM [polymorphum gilvum SL003B-26A1]
 gi|326411469|gb|ADZ68532.1| Ribosome maturation factor rimM [Polymorphum gilvum SL003B-26A1]
          Length = 183

 Score = 98.2 bits (243), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 50/158 (31%), Positives = 84/158 (53%), Gaps = 4/158 (2%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY--VLYSNDNRELRILKMYRKNKRFIATFS 65
           +LMA IG  HG+ GEV +  + ++P+    Y  +  ++ +R   ++    +    I  F 
Sbjct: 8   ILMARIGAAHGVRGEVRVKPFGDDPLSFADYGPLETADGSRRFEVVGARVQKTVVITRFK 67

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNF 125
           GID+  +A  L  L LY  R+     E  +DEF++ DL  +E  D     +G V  V +F
Sbjct: 68  GIDDRTAAEALNGLDLYVPRERLP--EPGDDEFYHADLIGLEAVDAAASRFGTVVAVQDF 125

Query: 126 GAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
           GAG +LEI+    ++F +PFT+  V  V+L   ++++D
Sbjct: 126 GAGDLLEIRPDRGRSFYVPFTQAFVPTVDLAAGRVVLD 163


>gi|298292732|ref|YP_003694671.1| 16S rRNA processing protein RimM [Starkeya novella DSM 506]
 gi|296929243|gb|ADH90052.1| 16S rRNA processing protein RimM [Starkeya novella DSM 506]
          Length = 180

 Score = 97.8 bits (242), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 49/160 (30%), Positives = 89/160 (55%), Gaps = 4/160 (2%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND--NRELRILKMYRKNKRFIATFS 65
           +L+A IG  HG+ GEV +  +A++P  L RY   +++   R  ++  +      F+A   
Sbjct: 6   ILLARIGAPHGVRGEVRLFVFADDPDSLKRYKPLTDEAGKRVFKVKALRPAKDHFVARIE 65

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNF 125
           G+D   +A  L +  L+  R D   E  +ED+F++ DL  +     +G  +G++  V++F
Sbjct: 66  GVDTREAAEALTNQGLHVSR-DLLPEPEDEDDFYHADLIGLAAVTTEGAPFGKIVAVHDF 124

Query: 126 GAGSILEI-KNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           GAG I+E+      KT ++PFTK  V  V+++  ++++DP
Sbjct: 125 GAGDIIEVAPEGGGKTLMLPFTKAVVPTVDIKGGRVVVDP 164


>gi|144898176|emb|CAM75040.1| 16S rRNA-processing protein RimM [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 180

 Score = 97.8 bits (242), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 54/159 (33%), Positives = 87/159 (54%), Gaps = 4/159 (2%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRI-LKMYRKNKRFI-ATFS 65
           V +  I   HG+ G V + S+  +P+D+  Y    ++  + R  LK+  + K F+ AT  
Sbjct: 7   VCIGAIVGAHGVRGAVRVKSFTADPLDVVAYGPVEDEAGKRRFKLKVTGEAKGFVLATLD 66

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNF 125
           G+++  +A  L+   LY  R      E+EEDEF  TDL  +      G+  G V GV NF
Sbjct: 67  GVNDRDAAEALKGTGLYVSRDRLP--EVEEDEFLYTDLVGLSALGLDGQVIGTVKGVANF 124

Query: 126 GAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           GAG +L+I    + + L+PFTK AV  V++ + ++++DP
Sbjct: 125 GAGDLLDIIRPGQGSLLVPFTKVAVPVVDMVKRQVVVDP 163


>gi|254504892|ref|ZP_05117043.1| 16S rRNA processing protein RimM [Labrenzia alexandrii DFL-11]
 gi|222440963|gb|EEE47642.1| 16S rRNA processing protein RimM [Labrenzia alexandrii DFL-11]
          Length = 186

 Score = 97.1 bits (240), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 56/158 (35%), Positives = 85/158 (53%), Gaps = 4/158 (2%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKRFIAT-FS 65
           VLMA IG  HG+ GEV +  + ++P+    Y VL + D ++   +   R  K  + T F 
Sbjct: 9   VLMAKIGAAHGVRGEVRVKPFGDDPLSFTDYGVLTTKDGKQSFEVVSARVQKTVVVTKFK 68

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNF 125
            + + + A EL   +LY  R      E +EDEF+ +DL  ++  D QG+  G++  V +F
Sbjct: 69  EVTDRNRAEELNGTELYIDRDQLP--ETDEDEFYYSDLNGLDVKDPQGELLGKIVAVQDF 126

Query: 126 GAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
           GAG + EI+    KTF IPFTK  V  +NL    ++ D
Sbjct: 127 GAGDLFEIRPKRGKTFYIPFTKEFVPTINLDSGFVVAD 164


>gi|296446375|ref|ZP_06888320.1| 16S rRNA processing protein RimM [Methylosinus trichosporium OB3b]
 gi|296256148|gb|EFH03230.1| 16S rRNA processing protein RimM [Methylosinus trichosporium OB3b]
          Length = 186

 Score = 95.9 bits (237), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 53/167 (31%), Positives = 86/167 (51%), Gaps = 6/167 (3%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY--VLYSNDNRELRILKMYRKNK- 58
            ++   VL+  +G  HG+ GE+ + S+  +P  ++ Y  +  ++  R   I  +    K 
Sbjct: 12  ARMKNAVLLGRLGAAHGVRGEIRLQSFTADPAAISTYGPLFDASGQRRFVIASLRSLGKD 71

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
            F+A   G+    +A  LR ++LY  R+     +  EDEF+  DLE +    R G+  G 
Sbjct: 72  MFVARLQGVSERSAAEALRGVELYVPREALPAPD--EDEFYLADLEGLRAETRAGETLGV 129

Query: 119 VCGVYNFGAGSILEIKNTM-EKTFLIPFTKFAVLEVNLQENKILIDP 164
           V  V NFGAG ILEI      +T L+PFTK  V  V++   ++L++P
Sbjct: 130 VIAVRNFGAGDILEIAPPQGGETLLLPFTKAVVPIVDVSGGRVLVEP 176


>gi|307943455|ref|ZP_07658799.1| 16S rRNA processing protein RimM [Roseibium sp. TrichSKD4]
 gi|307773085|gb|EFO32302.1| 16S rRNA processing protein RimM [Roseibium sp. TrichSKD4]
          Length = 179

 Score = 95.5 bits (236), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 51/157 (32%), Positives = 90/157 (57%), Gaps = 5/157 (3%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRY--VLYSNDNRELRILKMYRKNKRFIATF 64
           LVLMA IG  HG+ GEV + ++ ++P+    Y  ++  + +    + +   +    +  F
Sbjct: 8   LVLMARIGAAHGIRGEVRVKAFGDDPLSFTDYGELITKSGDTTFEVERARIQKTVVVTKF 67

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
            GI++ ++A EL  ++L+  R      ELE+DEF++ DL  M   D +G   G+V  V +
Sbjct: 68  KGINDRNAAEELNGVELFVHRDQLP--ELEDDEFYHDDLVGMAVTDLEGTDLGKVVMVQD 125

Query: 125 FGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKIL 161
           FGAG +LE++     TF +PF+K  V E+++ EN+++
Sbjct: 126 FGAGDLLEVRPKRGPTFYMPFSKAFVPEIDI-ENRVV 161


>gi|218508548|ref|ZP_03506426.1| 16S rRNA-processing protein [Rhizobium etli Brasil 5]
          Length = 106

 Score = 95.1 bits (235), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 63/86 (73%)

Query: 84  KRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFGAGSILEIKNTMEKTFLI 143
           +R +  DEELE+DEF+  DLE +E  D QG  +G V GV++FGAG +LE+K   ++  LI
Sbjct: 2   ERDNLPDEELEDDEFYYADLEGLEARDDQGVSYGTVTGVFDFGAGDLLELKGPGKRPVLI 61

Query: 144 PFTKFAVLEVNLQENKILIDPIAAGL 169
           PF++ +VLE++L+   +LIDP+AAGL
Sbjct: 62  PFSEASVLEIDLEAGTLLIDPLAAGL 87


>gi|254472163|ref|ZP_05085563.1| 16S rRNA processing protein RimM [Pseudovibrio sp. JE062]
 gi|211958446|gb|EEA93646.1| 16S rRNA processing protein RimM [Pseudovibrio sp. JE062]
          Length = 185

 Score = 94.7 bits (234), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 55/158 (34%), Positives = 85/158 (53%), Gaps = 3/158 (1%)

Query: 3   KLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKRFI 61
           K +  +LMA IG  HG+ GEV +  + ++P+    Y  L S D      +K  R  K  +
Sbjct: 4   KPEDRILMAQIGAAHGIRGEVRVKPFGDDPLSFGDYGKLESEDGSRKFKVKRARVQKNVV 63

Query: 62  AT-FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
            T F G+++ + A  L  LKLY  R+   + E +EDEF+++DL  ++  D   +  G V 
Sbjct: 64  VTKFEGVNDRNEAEALNGLKLYIPRERLPETE-DEDEFYHSDLIGLKALDENKEQIGTVL 122

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQEN 158
            + +FGAG ++EI     K+ L PFTK  V  +NL+E 
Sbjct: 123 ALLDFGAGDLIEIAPKSGKSLLFPFTKAVVPVINLKEG 160


>gi|27375594|ref|NP_767123.1| 16S rRNA-processing protein RimM [Bradyrhizobium japonicum USDA
           110]
 gi|46397690|sp|Q89X39|RIMM_BRAJA RecName: Full=Ribosome maturation factor rimM
 gi|27348731|dbj|BAC45748.1| 16S rRNA processing protein [Bradyrhizobium japonicum USDA 110]
          Length = 173

 Score = 94.7 bits (234), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 84/161 (52%), Gaps = 4/161 (2%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY--VLYSNDNRELRILKMYRKNKRFI 61
           +  LV +A IG  HG+ G V + ++  +P  + RY  +L  +  R+  + +        +
Sbjct: 1   MSALVCVARIGAAHGVRGAVKLWTFTEDPFAIKRYGPLLSKDGKRQFEVAQAREAKDHLV 60

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
           ATF G+     A  L  ++LY  R+  K    +EDE+++TDL  +      G+  G+V  
Sbjct: 61  ATFKGVTTRDEAERLNGIELYVARE--KLPATDEDEYYHTDLIGLAAVTTDGEPLGRVLA 118

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
           ++NFGAG I+EI      + L+PF+   V EV++   ++++
Sbjct: 119 IHNFGAGDIIEIAPPKGASLLLPFSNAVVPEVDVAGGRVVV 159


>gi|146337523|ref|YP_001202571.1| 16S rRNA-processing protein RimM [Bradyrhizobium sp. ORS278]
 gi|166226427|sp|A4YK99|RIMM_BRASO RecName: Full=Ribosome maturation factor rimM
 gi|146190329|emb|CAL74325.1| 16S rRNA processing protein, putative function [Bradyrhizobium sp.
           ORS278]
          Length = 199

 Score = 93.6 bits (231), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 85/162 (52%), Gaps = 4/162 (2%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY--VLYSNDNRELRILKMYRKNKRFI 61
           + KL+ +A IG  HG+ GEV + ++  +P+ +  Y  +   + +R   + K        +
Sbjct: 2   MSKLICVARIGAAHGVRGEVRLWTFTEDPLAVLHYGPLTTKDGSRSFEVTKAREAKDHLV 61

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
           A+F GI + ++A  L  ++LY  R      E ++DE+++ DL  +      G   G+V  
Sbjct: 62  ASFKGITDRNAAERLNGVELYVPRDRLP--ETDDDEYYHADLIGLAAETTAGAPLGRVLA 119

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
           ++NFGAG I+EI      T ++PFT   V  V+L   +++I+
Sbjct: 120 IHNFGAGDIIEIAPPSGSTLMLPFTNAVVPTVDLAGGRVIIE 161


>gi|148251974|ref|YP_001236559.1| 16S rRNA-processing protein RimM [Bradyrhizobium sp. BTAi1]
 gi|166226426|sp|A5E909|RIMM_BRASB RecName: Full=Ribosome maturation factor rimM
 gi|146404147|gb|ABQ32653.1| 16S rRNA processing protein RimM [Bradyrhizobium sp. BTAi1]
          Length = 198

 Score = 93.6 bits (231), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 84/162 (51%), Gaps = 4/162 (2%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY--VLYSNDNRELRILKMYRKNKRFI 61
           + KL+ +A IG  HG+ GEV + ++  +P+ +  Y  +   + +R   + K        +
Sbjct: 1   MSKLICVAKIGAAHGVRGEVRLWTFTEDPLAVLHYGPLTTKDGSRSFEVAKAREAKDHLV 60

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
           AT  G+ + ++A  L  L+LY  R      E ++DE+++ DL  +      G   G+V  
Sbjct: 61  ATIKGVTDRNAAERLNGLELYVPRDRLP--ETDDDEYYHADLIGLAAETTAGAPLGRVLA 118

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
           ++NFGAG I+EI      T ++PFT   V  V+L   +++I+
Sbjct: 119 IHNFGAGDIIEIAPPSGSTLMLPFTNAVVPTVDLAGGRVIIE 160


>gi|260432698|ref|ZP_05786669.1| 16S rRNA processing protein RimM [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260416526|gb|EEX09785.1| 16S rRNA processing protein RimM [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 167

 Score = 93.6 bits (231), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 54/165 (32%), Positives = 89/165 (53%), Gaps = 7/165 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELR---ILKMYRKNKRF 60
           +  L+ + ++  ++G+ GEV + SY   P D+  Y   ++++   R   I+    KN  F
Sbjct: 1   MSDLICVGSVAGSYGVRGEVRLKSYCAVPEDIETYSPLTDESGTERYPLIITRAIKNG-F 59

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
            A   G++    A  L+ L+LYA+R       L +DEF++ DL  +E +D  G   G+V 
Sbjct: 60  AARLGGVETKEQADALKGLRLYARRAQLP--SLPDDEFYHADLIGLEVYDTGGTLLGKVK 117

Query: 121 GVYNFGAGSILEIKNT-MEKTFLIPFTKFAVLEVNLQENKILIDP 164
            V N GA  +LE+    ++ T L+PFTK AV  V+L+  +I+ DP
Sbjct: 118 SVQNHGADDLLELHGPGLKTTVLLPFTKAAVPTVDLEAGRIVADP 162


>gi|149201387|ref|ZP_01878362.1| 16S rRNA processing protein RimM [Roseovarius sp. TM1035]
 gi|149145720|gb|EDM33746.1| 16S rRNA processing protein RimM [Roseovarius sp. TM1035]
          Length = 169

 Score = 93.6 bits (231), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 79/160 (49%), Gaps = 5/160 (3%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDN--RELRILKMYRKNKRFIATFS 65
           + +  IG   G+ GEV + S+   P D+  Y   S ++  R   +    +      A  S
Sbjct: 7   ICVGAIGGAFGVRGEVRLKSFTAMPEDIAAYSPLSTEDGARAFDVTLTGQTTNGLTAQLS 66

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNF 125
           GI    +A  LR ++LYA R    +  L +DEF++ DL  +E +D  G   G+V  V N 
Sbjct: 67  GISTKEAADALRGMRLYALRAQLPN--LPDDEFYHADLIGLEVYDTGGAVLGRVKAVLNH 124

Query: 126 GAGSILEIKNT-MEKTFLIPFTKFAVLEVNLQENKILIDP 164
           GA  ILEI    M  T L+PFT  AV  V+L   +I+ DP
Sbjct: 125 GASDILEIHAPGMSATILLPFTTEAVPTVDLAAGRIIADP 164


>gi|259417349|ref|ZP_05741268.1| 16S rRNA processing protein RimM [Silicibacter sp. TrichCH4B]
 gi|259346255|gb|EEW58069.1| 16S rRNA processing protein RimM [Silicibacter sp. TrichCH4B]
          Length = 171

 Score = 93.6 bits (231), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 85/161 (52%), Gaps = 5/161 (3%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRYV-LYSNDNRELRILKMYRKNKR-FIATF 64
           L+ +  +  + G+ GEV + S+  NP ++  Y  L+  D +    L + R  K  F A  
Sbjct: 8   LICVGALAGSFGVRGEVRLKSFCANPEEIEDYSPLFGEDGQTRYTLAITRAVKNGFAARI 67

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
             +D    A  L+ ++LYA R D     L +DEF++ DL  +E FD  G   G+V  V N
Sbjct: 68  VDVDTKEQADALKGVQLYALRDDLP--SLPDDEFYHADLIGLEVFDTGGTLLGRVKAVQN 125

Query: 125 FGAGSILEIKNT-MEKTFLIPFTKFAVLEVNLQENKILIDP 164
           +GA  +LE+    +  T L+PFTK AV  V+L + +I+ DP
Sbjct: 126 YGADDLLELHGPGLSATVLLPFTKAAVPTVDLTQGRIIADP 166


>gi|158425577|ref|YP_001526869.1| 16S rRNA-processing protein RimM [Azorhizobium caulinodans ORS 571]
 gi|172048026|sp|A8IKV0|RIMM_AZOC5 RecName: Full=Ribosome maturation factor rimM
 gi|158332466|dbj|BAF89951.1| 16S rRNA processing protein [Azorhizobium caulinodans ORS 571]
          Length = 177

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 83/159 (52%), Gaps = 3/159 (1%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDN-RELRILKMYRKNKRFIATFSG 66
           +L+A IG  HG+ GEV + ++  +P+ L RY L      R  ++  +      F+A   G
Sbjct: 5   ILIARIGAPHGVKGEVRLFAFGEDPLALKRYPLTDESGARRFKVQSLRAAKDHFVARLEG 64

Query: 67  IDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFG 126
           I + ++A  L +  L+  R      E +ED F++ DL  +   D+ G   G V  +++FG
Sbjct: 65  IADRNAAEALTNTDLFVPRDALPAAE-DEDTFYHADLMGLRVEDQSGALLGTVLAMHDFG 123

Query: 127 AGSILE-IKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           AG +LE       +T L+PFTK AV  V++   +I++ P
Sbjct: 124 AGDVLEYTPEGGGRTLLLPFTKAAVPVVDVPGGRIVVVP 162


>gi|92119040|ref|YP_578769.1| 16S rRNA-processing protein RimM [Nitrobacter hamburgensis X14]
 gi|122416838|sp|Q1QHI8|RIMM_NITHX RecName: Full=Ribosome maturation factor rimM
 gi|91801934|gb|ABE64309.1| 16S rRNA processing protein RimM [Nitrobacter hamburgensis X14]
          Length = 173

 Score = 92.4 bits (228), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 50/158 (31%), Positives = 77/158 (48%), Gaps = 4/158 (2%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDN--RELRILKMYRKNKRFIATFS 65
           V +A IG  HGL GEV + ++  +PI + RY   S  +  R+  +          +AT +
Sbjct: 5   VCVARIGAAHGLRGEVRLWTFTEDPIAVTRYGSLSTKDGARQFEVTHAREVKDYLVATLT 64

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNF 125
           G+     A  L    LY  R   K    +E EF++ DL  +   D  GK  G V  ++NF
Sbjct: 65  GVTTREEAERLNGTDLYVARD--KLPATDEGEFYHADLIGLAAVDVAGKPLGTVAAIHNF 122

Query: 126 GAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
           GAG I+EI      T ++PFT   V  V++   +++I+
Sbjct: 123 GAGDIIEIAPAHGPTLMLPFTDAVVPTVDIAGGRVVIE 160


>gi|209883426|ref|YP_002287283.1| 16S rRNA processing protein RimM [Oligotropha carboxidovorans OM5]
 gi|209871622|gb|ACI91418.1| 16S rRNA processing protein RimM [Oligotropha carboxidovorans OM5]
          Length = 174

 Score = 92.4 bits (228), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 47/158 (29%), Positives = 79/158 (50%), Gaps = 4/158 (2%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDN--RELRILKMYRKNKRFIATFS 65
           + +A IG  HG+ GEV +  +  +P+ +  Y   S  +  ++  +L+        +AT  
Sbjct: 7   ICVAKIGAAHGVRGEVRLWPFTEDPLAVLHYGPLSTRDGAKQFTVLRARAAKDHLVATLD 66

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNF 125
           G+ N   A  L  ++LY  R    D +  E E+++ DL  +   D QGK  G +  ++NF
Sbjct: 67  GVANRDDAERLNGIELYVSRDALPDTD--EGEYYHADLIGLAAVDPQGKSIGTIIAIHNF 124

Query: 126 GAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
           GAG I+EI      T L+PFT   V  ++L    ++I+
Sbjct: 125 GAGDIIEIAPNNGPTLLLPFTNAVVPTIDLAAGHVVIE 162


>gi|163744763|ref|ZP_02152123.1| 16S rRNA processing protein RimM [Oceanibulbus indolifex HEL-45]
 gi|161381581|gb|EDQ05990.1| 16S rRNA processing protein RimM [Oceanibulbus indolifex HEL-45]
          Length = 175

 Score = 92.4 bits (228), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 58/162 (35%), Positives = 84/162 (51%), Gaps = 7/162 (4%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSND-NRELRILKMYRKNKRFIATF 64
           L+ +  I   +G+ GEV + SY   P D+  Y  LY+ D +R   +  +++    F A  
Sbjct: 6   LICVGAIAGAYGVRGEVRVKSYCAAPEDIETYRPLYTEDGSRTFNLALLHQVKNGFAARI 65

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
           + I     A E+R L L+A R       L +DEF++ DL  +E +D  G   G+V  V N
Sbjct: 66  AEITTKEEADEMRGLSLFAARDQLP--SLPDDEFYHADLIGLEVYDTGGTLLGRVKTVQN 123

Query: 125 FGAGSILE--IKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
            GA  +LE  +K T   TFL PFTK AV  V+L   +I+ DP
Sbjct: 124 HGADDLLELQLKGTSATTFL-PFTKAAVPTVDLASGRIVADP 164


>gi|56698087|ref|YP_168458.1| 16S rRNA-processing protein RimM [Ruegeria pomeroyi DSS-3]
 gi|67461274|sp|Q5LNF0|RIMM_SILPO RecName: Full=Ribosome maturation factor rimM
 gi|56679824|gb|AAV96490.1| 16S rRNA processing protein RimM [Ruegeria pomeroyi DSS-3]
          Length = 167

 Score = 92.4 bits (228), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 88/165 (53%), Gaps = 7/165 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELR---ILKMYRKNKRF 60
           +  L+ + ++  + G+ GEV + S+   P D+  Y   ++++   R   +L    KN  F
Sbjct: 1   MSDLICVGSVAGSFGVRGEVRLKSFCAVPEDIEMYSPLTDESGTARYPIVLTRAIKNG-F 59

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
            A   G++    A  L+ L+LY +R       L +DEF++TDL  +E FD  G   G+V 
Sbjct: 60  AAHLGGVETKEEADALKGLRLYTQRDRLP--SLPDDEFYHTDLIGLEVFDTGGTLLGKVI 117

Query: 121 GVYNFGAGSILEIKNT-MEKTFLIPFTKFAVLEVNLQENKILIDP 164
            V N GA  +LEI    ++   L+PFT+ AV  V+L++ +I+ DP
Sbjct: 118 SVQNHGAADLLEIGGAGLKSPVLLPFTQAAVPTVDLEQRRIVADP 162


>gi|220922841|ref|YP_002498143.1| 16S rRNA-processing protein RimM [Methylobacterium nodulans ORS
           2060]
 gi|254797756|sp|B8IGW5|RIMM_METNO RecName: Full=Ribosome maturation factor rimM
 gi|219947448|gb|ACL57840.1| 16S rRNA processing protein RimM [Methylobacterium nodulans ORS
           2060]
          Length = 204

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 78/162 (48%), Gaps = 6/162 (3%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKR----FIAT 63
           VL+   G  HGL GEV + SY  +P+ +  Y   +  N     L   R         IA 
Sbjct: 28  VLLGEFGRAHGLQGEVRLKSYTADPMAIGSYGPLTGANGRAIALTALRPASGAPDMLIAR 87

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
            SG+    +A  L  L LY +R+     E +EDEFF+ DL  +   D  G   G +  V 
Sbjct: 88  VSGVSGRDAAEALNRLALYVRRECLGAPE-DEDEFFSADLIGLAVVDAAGTRLGTIRAVP 146

Query: 124 NFGAGSILEIKNT-MEKTFLIPFTKFAVLEVNLQENKILIDP 164
           N+G G +LEI+ T      L+PFT+  V +V++   ++ IDP
Sbjct: 147 NYGGGDLLEIEPTGGGAAALLPFTRAFVPKVDIAAREVTIDP 188


>gi|114571436|ref|YP_758116.1| 16S rRNA processing protein RimM [Maricaulis maris MCS10]
 gi|122315003|sp|Q0AKL5|RIMM_MARMM RecName: Full=Ribosome maturation factor rimM
 gi|114341898|gb|ABI67178.1| 16S rRNA processing protein RimM [Maricaulis maris MCS10]
          Length = 185

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 56/164 (34%), Positives = 88/164 (53%), Gaps = 6/164 (3%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSN-DNRELRILKMYRKNK-RFIA 62
           D LV +A I   HG+ GE  + S+A NP D  +Y  + + D + +   K  R  K  F+ 
Sbjct: 6   DDLVFIAAIAGAHGVRGECKVKSFAGNPADAFKYGAFLDIDGKTILTPKAARPVKDGFVV 65

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F+   +   A  L+  KL+  R      ELEEDEF+++DL  ++     G   G +  V
Sbjct: 66  RFAEPLDRDKAQALKGTKLHVLRSALP--ELEEDEFYHSDLLGLKVQGLDGAPMGTLKAV 123

Query: 123 YNFGAGSILEIKNTMEK--TFLIPFTKFAVLEVNLQENKILIDP 164
           +NFG+G +LEI  T ++  ++++PFT+  V  V++ E  I IDP
Sbjct: 124 HNFGSGDLLEITGTPDRNGSWMLPFTREFVPHVSIAEGVITIDP 167


>gi|209965493|ref|YP_002298408.1| 16S rRNA processing protein RimM, putative [Rhodospirillum centenum
           SW]
 gi|238058954|sp|B6IP93|RIMM_RHOCS RecName: Full=Ribosome maturation factor rimM
 gi|209958959|gb|ACI99595.1| 16S rRNA processing protein RimM, putative [Rhodospirillum centenum
           SW]
          Length = 201

 Score = 91.3 bits (225), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 88/161 (54%), Gaps = 3/161 (1%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDN--RELRILKMYRKNKRFIATFS 65
           +++A I   HG++G V + S+  +   +  Y   ++++  RE ++ +       F+A   
Sbjct: 5   IVVAQILGAHGVHGRVKLKSFTADETAVFGYAPLTDESGRREFKLRRTGTGKDHFLAEVD 64

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNF 125
           GI    +A  LR  +LY +R      E +EDEF++ DL  ++T     + +G +  +Y+F
Sbjct: 65  GITGKEAADALRGTRLYIERDRLPAPE-DEDEFYHADLIGLDTVTADDQPFGTIKAIYDF 123

Query: 126 GAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIA 166
           GAG +LEI++  EKT  +PFTK  V  + +   +++++P A
Sbjct: 124 GAGDMLEIRHVSEKTVFLPFTKACVPVIEIAAGRVVVEPPA 164


>gi|240137229|ref|YP_002961698.1| putative 16S rRNA processing protein [Methylobacterium extorquens
           AM1]
 gi|240007195|gb|ACS38421.1| putative 16S rRNA processing protein [Methylobacterium extorquens
           AM1]
          Length = 223

 Score = 90.9 bits (224), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 55/164 (33%), Positives = 82/164 (50%), Gaps = 7/164 (4%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKR----FI 61
           LVL+   G  HGL+GEV + S+ + P+ +  Y  L+S+D R L +  +           I
Sbjct: 44  LVLLGEFGRPHGLHGEVRLKSHTSEPLAIAGYGPLHSSDGRTLELANVRPAAGSSPDLLI 103

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               G+D+   A  L  + L   R+   + E +EDEFF TDL  +   D  G   G +  
Sbjct: 104 VRVKGVDDRSGAEALNRVTLAIARERLGEVE-DEDEFFLTDLIGLTVEDGAGTVIGTIVA 162

Query: 122 VYNFGAGSILEIKNTM-EKTFLIPFTKFAVLEVNLQENKILIDP 164
           V NFG G +LEI+      T L+PFTK  V  +++   K++ DP
Sbjct: 163 VPNFGGGDLLEIRPAAGGPTALLPFTKAFVPSLDIAGGKVVADP 206


>gi|85706778|ref|ZP_01037870.1| 16S rRNA processing protein RimM [Roseovarius sp. 217]
 gi|85668836|gb|EAQ23705.1| 16S rRNA processing protein RimM [Roseovarius sp. 217]
          Length = 169

 Score = 90.5 bits (223), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 57/160 (35%), Positives = 80/160 (50%), Gaps = 5/160 (3%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYV-LYSNDN-RELRILKMYRKNKRFIATFS 65
           + +  IG   G+ GEV + S+   P D+  Y  L S D  R+  I    +    F A  S
Sbjct: 7   ICVGAIGGAFGVRGEVRLKSFTAMPEDIASYSPLTSEDGTRQFDISLTGQTTNGFTAHLS 66

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNF 125
           GI    +A  LR  +LYA R    +  L +DE+++ DL  +E FD  G   G+V  V N 
Sbjct: 67  GIATKEAADALRGTRLYALRAQLPN--LPDDEYYHADLIGLEVFDTGGTLLGRVKAVLNH 124

Query: 126 GAGSILEIKNT-MEKTFLIPFTKFAVLEVNLQENKILIDP 164
           GA  +LEI    +  T L+PFT  AV  V+L   +I+ DP
Sbjct: 125 GASDLLEIHGPGLSATVLLPFTLEAVPTVDLASGRIIADP 164


>gi|254437096|ref|ZP_05050590.1| 16S rRNA processing protein RimM [Octadecabacter antarcticus 307]
 gi|198252542|gb|EDY76856.1| 16S rRNA processing protein RimM [Octadecabacter antarcticus 307]
          Length = 183

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 57/167 (34%), Positives = 87/167 (52%), Gaps = 5/167 (2%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYV-LYSNDNRELRILKMYRKNK- 58
           M   D  +++ TI  + G+NG+V + S+  +P  L  Y  L   D  ++  + +  + K 
Sbjct: 1   MPMSDDRIVVGTIAGSFGVNGDVRLKSFCADPEALANYTPLTRADGSQIMTIVIKGQTKG 60

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
             IA   GI     A  LR + LYA+R       L +DEF++TDL  + T+D  G   G+
Sbjct: 61  SLIARVDGITTKEEADGLRGMDLYAQRDQLP--SLPDDEFYHTDLVGLMTYDTGGAKLGR 118

Query: 119 VCGVYNFGAGSILEIKNTMEK-TFLIPFTKFAVLEVNLQENKILIDP 164
           V  V   GA  +LEI +  +K T L+PFTK  V  V+L   +I++DP
Sbjct: 119 VKAVQTNGADDLLEIISPSDKDTVLVPFTKANVPTVDLASGRIVVDP 165


>gi|146276238|ref|YP_001166397.1| 16S rRNA-processing protein RimM [Rhodobacter sphaeroides ATCC
           17025]
 gi|166226472|sp|A4WNX8|RIMM_RHOS5 RecName: Full=Ribosome maturation factor rimM
 gi|145554479|gb|ABP69092.1| 16S rRNA processing protein RimM [Rhodobacter sphaeroides ATCC
           17025]
          Length = 169

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 56/167 (33%), Positives = 82/167 (49%), Gaps = 6/167 (3%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDN-RELRILKMYRKNK 58
           M + D+L + A  G   G+ GEV + S+   P D+  Y  L++ D  R  R+        
Sbjct: 1   MTRTDRLCVGAIAGA-FGVKGEVRLKSFCAEPSDIASYGPLFTEDGGRSFRVTLTRPVAG 59

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
              A  SG+     A  LR ++LYA R       L +DEF++ DL  +E  D  G   G+
Sbjct: 60  ALGARLSGVATKEEADALRGVQLYADRDRLP--SLGDDEFYHADLIGLEVRDTGGALLGR 117

Query: 119 VCGVYNFGAGSILEIKNTMEK-TFLIPFTKFAVLEVNLQENKILIDP 164
           V  V+N GAG ILE+     +   L+PFT+  V  V+L   +I+ DP
Sbjct: 118 VHAVHNHGAGDILEVTGAGRREALLLPFTRAVVPTVDLSIGRIVADP 164


>gi|163738187|ref|ZP_02145603.1| 16S rRNA processing protein RimM [Phaeobacter gallaeciensis BS107]
 gi|161388803|gb|EDQ13156.1| 16S rRNA processing protein RimM [Phaeobacter gallaeciensis BS107]
          Length = 167

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 54/160 (33%), Positives = 84/160 (52%), Gaps = 5/160 (3%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYV-LYSNDNRELRILKMYRKNKR-FIATFS 65
           + +  I  ++G+ GEV + S+   P D+  Y  L + D  +   + + R  K  F A   
Sbjct: 5   ICVGAISGSYGVRGEVRLKSFCAMPEDIEDYSPLSTEDGSQTYTITLVRAIKNGFTARIG 64

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNF 125
           GI+    A  L+ ++L+A R+   +  L +DE+++TDL  +E +D  G   G V  V N 
Sbjct: 65  GIETKEQADALKGVRLFAPRERLPN--LPDDEYYHTDLMGLEVYDTGGTLLGSVKSVQNH 122

Query: 126 GAGSILEIKNTME-KTFLIPFTKFAVLEVNLQENKILIDP 164
           GA  +LEI    E KT L+PFT  AV  V+L   +I+ DP
Sbjct: 123 GASDLLEIAIPAESKTVLLPFTLAAVPTVDLASGRIIADP 162


>gi|329847287|ref|ZP_08262315.1| 16S rRNA processing protein RimM [Asticcacaulis biprosthecum C19]
 gi|328842350|gb|EGF91919.1| 16S rRNA processing protein RimM [Asticcacaulis biprosthecum C19]
          Length = 166

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 87/159 (54%), Gaps = 4/159 (2%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKRFIATFS 65
           LVL+A +G  HG+ GE  + S+ ++P+ L  +  L     +   ++   R +K  +  F+
Sbjct: 6   LVLVAQVGAPHGVQGEFKLMSFMDDPLSLLEHSPLLDVAGKPALVVTKARAHKGALLVFA 65

Query: 66  GIDNIHSASE-LRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
                 +A+E L+  KLY  R D  D +  E+E++ TDL  M+  D  G   G+V  V N
Sbjct: 66  EQAPDRTAAEKLKGQKLYVDRADLPDTD--EEEYYVTDLIGMDVVDTSGNMVGKVVNVDN 123

Query: 125 FGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
           FGAG +L++K     +F +PFT   V +V+L E +I++D
Sbjct: 124 FGAGDLLDVKPLEGVSFYVPFTLAHVPQVHLAEGRIVVD 162


>gi|188579901|ref|YP_001923346.1| 16S rRNA-processing protein RimM [Methylobacterium populi BJ001]
 gi|209573581|sp|B1ZL68|RIMM_METPB RecName: Full=Ribosome maturation factor rimM
 gi|179343399|gb|ACB78811.1| 16S rRNA processing protein RimM [Methylobacterium populi BJ001]
          Length = 224

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 57/165 (34%), Positives = 81/165 (49%), Gaps = 9/165 (5%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKR-----F 60
           LVL+   G  HGL+GEV + S+   P+ +  Y  L+++D R L  L+  R          
Sbjct: 45  LVLLGEFGRPHGLHGEVRLKSFTGEPLAIAGYGPLHASDGRTLE-LEDARPAPGGSPDLL 103

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           I    G+DN   A  L  + L   R+     E +EDEFF TDL  +   D  G   G + 
Sbjct: 104 IVRVKGVDNRSGAEALNRITLAIARERLGQAE-DEDEFFLTDLIGLAVEDPSGTVIGTIV 162

Query: 121 GVYNFGAGSILEIKNTM-EKTFLIPFTKFAVLEVNLQENKILIDP 164
            V N+G G +LEI+      T L+PFTK  V  ++L   K++ DP
Sbjct: 163 AVPNYGGGDLLEIRPAAGGPTALLPFTKAFVPTLDLAGGKVVADP 207


>gi|295691477|ref|YP_003595170.1| 16S rRNA processing protein RimM [Caulobacter segnis ATCC 21756]
 gi|295433380|gb|ADG12552.1| 16S rRNA processing protein RimM [Caulobacter segnis ATCC 21756]
          Length = 188

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 58/166 (34%), Positives = 83/166 (50%), Gaps = 6/166 (3%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNK-RFIA 62
           D L+L+  +    G+ GEV I +Y  +P+ +  +  L   D      +   RK K   + 
Sbjct: 7   DPLILVGRVAGGFGVRGEVRISTYTEDPMSIAAFKALKRQDGSPALTIASARKTKDGVVC 66

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQG-KYWGQVCG 121
              G++   +A  LR L+LY  R      E +EDEF+ TDL  +     Q  +  G+V  
Sbjct: 67  RCPGVETKEAADALRGLRLYVPRSALP--EPDEDEFYLTDLVGLTVRHIQTDQLLGRVKS 124

Query: 122 VYNFGAGSILEIKNTME-KTFLIPFTKFAVLEVNLQENKILIDPIA 166
           V NFGAG ILEI   +   T+ +PFT+ AV EV + E  IL DP A
Sbjct: 125 VQNFGAGDILEITPDLGGPTWYLPFTRAAVPEVKISEGLILADPPA 170


>gi|316931784|ref|YP_004106766.1| 16S rRNA processing protein RimM [Rhodopseudomonas palustris DX-1]
 gi|315599498|gb|ADU42033.1| 16S rRNA processing protein RimM [Rhodopseudomonas palustris DX-1]
          Length = 176

 Score = 89.0 bits (219), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 47/159 (29%), Positives = 76/159 (47%), Gaps = 4/159 (2%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRY--VLYSNDNRELRILKMYRKNKRFIATF 64
           L+ +A IG  HG+ G V + S+  +P  +N Y  ++  +  R+  I          + T 
Sbjct: 5   LICVARIGAPHGVRGAVRLWSFTADPFAVNDYGPLVTKDGARQFEIASAREAKSHLVVTL 64

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
            G+     A  L  ++LY  R   K    E DE+++ DL  +      G   G+V  ++N
Sbjct: 65  KGVTTRDEAERLNGVELYVARD--KLPPTEADEYYHADLIGLAAVTTAGDALGKVVAIHN 122

Query: 125 FGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
           FGAG I+EI      T L+PFT   V  V+L   +++I+
Sbjct: 123 FGAGDIIEIAPPSGPTLLLPFTNAVVPTVDLAAGQVVIE 161


>gi|39933320|ref|NP_945596.1| 16S rRNA-processing protein RimM [Rhodopseudomonas palustris
           CGA009]
 gi|59798745|sp|Q6ND66|RIMM_RHOPA RecName: Full=Ribosome maturation factor rimM
 gi|39652945|emb|CAE25687.1| putative 16S rRNA processing protein [Rhodopseudomonas palustris
           CGA009]
          Length = 176

 Score = 89.0 bits (219), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 77/160 (48%), Gaps = 4/160 (2%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRY--VLYSNDNRELRILKMYRKNKRFIATF 64
           L+ +A IG  HG+ G V + S+  +P  ++ Y  ++  +  R+  I          + T 
Sbjct: 5   LICVARIGAPHGVRGAVRLWSFTADPFAVSDYGPLVTKDGARQFEIASAREAKSHLVVTL 64

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
            G+     A  L  ++LY  R   K    E DE+++ DL  +      G   G+V  ++N
Sbjct: 65  KGVTTRDEAERLNGVELYVARD--KLPPTEADEYYHADLIGLAAVTTTGDPLGKVVAIHN 122

Query: 125 FGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           FGAG I+EI      T L+PFT   V  V+L   +++I+P
Sbjct: 123 FGAGDIIEIAPPSGPTLLLPFTNAVVPTVDLAVGQVVIEP 162


>gi|218528699|ref|YP_002419515.1| 16S rRNA-processing protein RimM [Methylobacterium chloromethanicum
           CM4]
 gi|254797755|sp|B7KZ57|RIMM_METC4 RecName: Full=Ribosome maturation factor rimM
 gi|218521002|gb|ACK81587.1| 16S rRNA processing protein RimM [Methylobacterium chloromethanicum
           CM4]
          Length = 223

 Score = 89.0 bits (219), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 54/164 (32%), Positives = 82/164 (50%), Gaps = 7/164 (4%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKR----FI 61
           LVL+   G  HGL+GEV + S+ + P+ +  Y  L+++D R L +  +           I
Sbjct: 44  LVLLGEFGRPHGLHGEVRLKSHTSEPLAIAGYGPLHASDGRTLELANVRPAAGSSPDLLI 103

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               G+D+   A  L  + L   R+   + E +EDEFF TDL  +   D  G   G +  
Sbjct: 104 VRVKGVDDRTGAEALNRVTLAIARERLGEVE-DEDEFFLTDLIGLTVEDGAGTVIGTIVA 162

Query: 122 VYNFGAGSILEIKNTM-EKTFLIPFTKFAVLEVNLQENKILIDP 164
           V NFG G +LEI+      T L+PFTK  V  +++   K++ DP
Sbjct: 163 VPNFGGGDLLEIRPAAGGPTALLPFTKAFVPSLDIAGGKVVADP 206


>gi|114763698|ref|ZP_01443092.1| 16S rRNA processing protein RimM [Pelagibaca bermudensis HTCC2601]
 gi|114543699|gb|EAU46712.1| 16S rRNA processing protein RimM [Roseovarius sp. HTCC2601]
          Length = 173

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 83/166 (50%), Gaps = 5/166 (3%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYV-LYSNDNRELRILKMYRKNKR- 59
             + + + + TI    G+NGEV + S+   P  L  Y  L + D      +++ R  K  
Sbjct: 4   ASVSETICVGTIAGAFGVNGEVRLKSFTAEPEALAEYAPLTTEDGSRSFEVQITRSVKGG 63

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
           F A  SG+ +   A  LR   LYA R       L +DEF++TDL  +  FD  G   G+V
Sbjct: 64  FAARLSGVRSKEEADALRGTGLYAPRDRLPT--LPDDEFYHTDLIGLAVFDTGGAELGRV 121

Query: 120 CGVYNFGAGSILEIKNTME-KTFLIPFTKFAVLEVNLQENKILIDP 164
             V N GA  +LE+    + KT L+PFT+ AV  V+L   +I+ DP
Sbjct: 122 KAVLNHGATDLLELTAPGQSKTVLLPFTREAVPTVDLASGRIVADP 167


>gi|89069752|ref|ZP_01157088.1| putative 16S rRNA processing protein [Oceanicola granulosus
           HTCC2516]
 gi|89044698|gb|EAR50809.1| putative 16S rRNA processing protein [Oceanicola granulosus
           HTCC2516]
          Length = 175

 Score = 88.6 bits (218), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 52/163 (31%), Positives = 82/163 (50%), Gaps = 5/163 (3%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYV-LYSNDNRELRILKMYRKNK-RFIA 62
           D  V++ +I    G+ GEV + SY  +P  +  Y  L++ D R +  + +  + K   IA
Sbjct: 6   DSRVVVGSIAGAFGVRGEVRLKSYCADPAAIADYTPLHTEDGRTIAQVVITGETKGALIA 65

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
              GI     A  LR   L+A R       L +DEF++ DL  +  +D  G   G V  V
Sbjct: 66  RLDGIATKEQADALRGTALHAARDRLP--SLPDDEFYHADLLGLPVYDGGGTMLGTVKAV 123

Query: 123 YNFGAGSILEIKNT-MEKTFLIPFTKFAVLEVNLQENKILIDP 164
           ++ GAG +LE+    ++ T L+PFT+  V  V+L   +I+ DP
Sbjct: 124 HDHGAGDLLEVHGPGLKSTVLLPFTREIVPTVDLAAGRIVADP 166


>gi|86747477|ref|YP_483973.1| 16S rRNA-processing protein RimM [Rhodopseudomonas palustris HaA2]
 gi|109893041|sp|Q2J398|RIMM_RHOP2 RecName: Full=Ribosome maturation factor rimM
 gi|86570505|gb|ABD05062.1| 16S rRNA processing protein RimM [Rhodopseudomonas palustris HaA2]
          Length = 182

 Score = 88.2 bits (217), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 84/179 (46%), Gaps = 5/179 (2%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS--NDNRELRILKMYRKNKR 59
           + + + V +A IG  HG+ G + + S+  +P+ +  Y   S  +  R   I         
Sbjct: 6   ISVARQVCVARIGAPHGVRGAMRLWSFTADPLAVGDYGPLSTKDGTRSFEIATARAAKDH 65

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            + T  G+     A  L  L+LY  R        E+DE+++ DL  +      G+  G+V
Sbjct: 66  LVVTLKGVTTRDEAVRLNGLELYVPRDALP--PTEDDEYYHADLIGLPAITTSGEPLGRV 123

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQ 178
             ++NFGAG I+EI      T L+PFT   V  V+L   +++I+ + A +   T  +P+
Sbjct: 124 LAIHNFGAGDIIEIAPASGPTLLLPFTNAVVPTVDLAAGQVIIE-LPAEIEGDTPNHPE 181


>gi|254510633|ref|ZP_05122700.1| 16S rRNA processing protein RimM [Rhodobacteraceae bacterium KLH11]
 gi|221534344|gb|EEE37332.1| 16S rRNA processing protein RimM [Rhodobacteraceae bacterium KLH11]
          Length = 167

 Score = 88.2 bits (217), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 87/165 (52%), Gaps = 7/165 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELR---ILKMYRKNKRF 60
           +  L+ + +I  ++G+ GEV + S+   P D+  Y   +++    R   +L    KN  F
Sbjct: 1   MSDLICVGSIAGSYGVRGEVRLKSFCAVPEDIEGYSPLTDEAGAKRFPVVLTRTIKNG-F 59

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
            A   G++    A  L  L+L+A+R       L +DEF++TDL  +E +D  G   G+V 
Sbjct: 60  AARLGGVETKEEADALSGLRLFARRDQLP--SLPDDEFYHTDLIGLEVYDTGGTLLGRVK 117

Query: 121 GVYNFGAGSILEIKNT-MEKTFLIPFTKFAVLEVNLQENKILIDP 164
            V N GA  +LE+    ++ T L+PFT  AV  V+L + +I+ DP
Sbjct: 118 SVQNHGAADLLELHGPGLKSTVLLPFTLDAVPTVDLDKGRIIADP 162


>gi|84683441|ref|ZP_01011344.1| 16S rRNA processing protein RimM [Maritimibacter alkaliphilus
           HTCC2654]
 gi|84668184|gb|EAQ14651.1| 16S rRNA processing protein RimM [Rhodobacterales bacterium
           HTCC2654]
          Length = 170

 Score = 88.2 bits (217), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 55/163 (33%), Positives = 83/163 (50%), Gaps = 6/163 (3%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKR-FIA 62
           D++ + A  G+  G+ GEV + S+   P D+  Y  L++ D      L + R  K  F A
Sbjct: 4   DRICVGAFAGS-FGVGGEVRVKSFCAEPEDIETYGTLWTEDGTRSFTLSLTRAVKTGFAA 62

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
              GI     A  L+ ++LYA R       L +DEF++ DL  +   D  G   G+V  V
Sbjct: 63  DVDGITTKEQADALKGVRLYADRDALP--SLPDDEFYHADLIGLTVLDTGGAEVGRVSAV 120

Query: 123 YNFGAGSILEIKNTMEKT-FLIPFTKFAVLEVNLQENKILIDP 164
           +N GAG ++E+     KT  L+PFT+  V  V+L   +I+IDP
Sbjct: 121 HNHGAGDLIEVAGPGLKTPALVPFTRANVPTVDLTAGRIVIDP 163


>gi|254449413|ref|ZP_05062850.1| 16S rRNA processing protein RimM [Octadecabacter antarcticus 238]
 gi|198263819|gb|EDY88089.1| 16S rRNA processing protein RimM [Octadecabacter antarcticus 238]
          Length = 183

 Score = 88.2 bits (217), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 55/167 (32%), Positives = 87/167 (52%), Gaps = 5/167 (2%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYV-LYSNDNRELRILKMYRKNK- 58
           M   D  +++ T+  + G+NG+V + S+  +P  L  Y  L   D  E+  + +  + K 
Sbjct: 1   MPMSDDRIVVGTLAGSFGVNGDVRLKSFCADPEALADYTPLTRADGSEITTIVIKGQTKG 60

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
             IA   GI     A  LR ++LYA+R       L +DE+++ DL  + T+D  G   G+
Sbjct: 61  SLIARVDGITTKEEADGLRGMELYARRDQLP--SLPDDEYYHADLVGLMTYDTGGAKLGR 118

Query: 119 VCGVYNFGAGSILEIKNTMEK-TFLIPFTKFAVLEVNLQENKILIDP 164
           V  V   GA  +LEI +  +K T L+PFTK  V  V+L   +I++DP
Sbjct: 119 VKAVQTNGADDLLEIISPSDKDTVLVPFTKVIVPTVDLASGRIVLDP 165


>gi|163850096|ref|YP_001638139.1| 16S rRNA processing protein RimM [Methylobacterium extorquens PA1]
 gi|209573569|sp|A9W0G2|RIMM_METEP RecName: Full=Ribosome maturation factor rimM
 gi|163661701|gb|ABY29068.1| 16S rRNA processing protein RimM [Methylobacterium extorquens PA1]
          Length = 223

 Score = 88.2 bits (217), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 54/164 (32%), Positives = 81/164 (49%), Gaps = 7/164 (4%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKR----FI 61
           LVL+   G  HGL+GEV + S+ + P+ +  Y  L+++D R L +  +           I
Sbjct: 44  LVLLGEFGRPHGLHGEVRLKSHTSEPLAIAGYGPLHASDGRTLELANVRPAAGSSPDLLI 103

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               G+D+   A  L  + L   R+     E +EDEFF TDL  +   D  G   G +  
Sbjct: 104 VRVKGVDDRTGAEALNRVTLAIARERLGKVE-DEDEFFLTDLIGLTVEDGAGTVIGTIVA 162

Query: 122 VYNFGAGSILEIKNTM-EKTFLIPFTKFAVLEVNLQENKILIDP 164
           V NFG G +LEI+      T L+PFTK  V  +++   K++ DP
Sbjct: 163 VPNFGGGDLLEIRPAAGGPTALLPFTKAFVPSLDIAGGKVVADP 206


>gi|254559240|ref|YP_003066335.1| 16S rRNA processing protein [Methylobacterium extorquens DM4]
 gi|254266518|emb|CAX22282.1| putative 16S rRNA processing protein [Methylobacterium extorquens
           DM4]
          Length = 223

 Score = 87.8 bits (216), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 54/164 (32%), Positives = 81/164 (49%), Gaps = 7/164 (4%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKR----FI 61
           LVL+   G  HGL+GEV + S+ + P+ +  Y  L+++D R L +  +           I
Sbjct: 44  LVLLGEFGRPHGLHGEVRLKSHTSEPLAIAGYGPLHASDGRTLELANVRPAAGSSPDLLI 103

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               G+D+   A  L  + L   R+   + E +EDEFF TDL  +   D  G   G +  
Sbjct: 104 VRVKGVDDRTGAEALNRVTLAIARERLGEVE-DEDEFFLTDLIGLTVEDGAGTVIGTIVA 162

Query: 122 VYNFGAGSILEI-KNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           V NFG G +LEI       T L+PFTK  V  +++   K++ DP
Sbjct: 163 VPNFGGGDLLEICPAAGGPTALLPFTKAFVPSLDIAGGKVVADP 206


>gi|217979018|ref|YP_002363165.1| 16S rRNA-processing protein RimM [Methylocella silvestris BL2]
 gi|217504394|gb|ACK51803.1| 16S rRNA processing protein RimM [Methylocella silvestris BL2]
          Length = 199

 Score = 87.8 bits (216), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 53/164 (32%), Positives = 86/164 (52%), Gaps = 6/164 (3%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSN--DNRELRILKMYR-KNKRFI 61
           D+LVL+   G  HG+ GE+ + S+  NP  ++ Y   ++    +   IL     K   F+
Sbjct: 12  DRLVLIGRFGAPHGVRGELRLQSFTENPAAISSYGPLTDRLGAKAFSILTARAVKPDLFV 71

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               G+D+  +A  L +++++  R+  K     EDEF+  DL  +E  D     +G+V  
Sbjct: 72  VKLKGVDDRTAAEALTNVEVFVARE--KLPAAAEDEFYLADLIGLEALDASRAPFGRVKN 129

Query: 122 VYNFGAGSILEIKNT-MEKTFLIPFTKFAVLEVNLQENKILIDP 164
           V +FGAG ILEI+     +T L+PFT+    E++L    I+IDP
Sbjct: 130 VLDFGAGDILEIEPAGGGETLLLPFTRQVAPEIDLAAGFIVIDP 173


>gi|310814611|ref|YP_003962575.1| putative 16S rRNA processing protein [Ketogulonicigenium vulgare
           Y25]
 gi|308753346|gb|ADO41275.1| putative 16S rRNA processing protein [Ketogulonicigenium vulgare
           Y25]
          Length = 168

 Score = 87.8 bits (216), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 87/160 (54%), Gaps = 5/160 (3%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYV-LYSNDNRELRILKMY-RKNKRFIATFS 65
           +++  I  + G+ G++ + S+   P D+  Y  LY++D R  R++ +  + N   +A   
Sbjct: 5   IVLGQIAGSFGVRGDLRLKSFCAIPEDIAIYTPLYTDDGRVFRVVVITGQTNGALVARIE 64

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNF 125
           GI +   A  LR   L A R    +  L +DEF+++DL ++E  D  G   G+V  V N 
Sbjct: 65  GISSKEEADALRGQNLSADRDRLPN--LPDDEFYHSDLIDLEVLDTGGAILGRVKTVLNH 122

Query: 126 GAGSILEIKNTMEK-TFLIPFTKFAVLEVNLQENKILIDP 164
           GAG ILE++ T +  T L+PFT   V  V+L+  +I+ DP
Sbjct: 123 GAGDILEVQLTGKPATALLPFTLAIVPTVDLKAGRIIADP 162


>gi|84515964|ref|ZP_01003325.1| putative 16S rRNA processing protein [Loktanella vestfoldensis
           SKA53]
 gi|84510406|gb|EAQ06862.1| putative 16S rRNA processing protein [Loktanella vestfoldensis
           SKA53]
          Length = 171

 Score = 87.0 bits (214), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 52/163 (31%), Positives = 85/163 (52%), Gaps = 5/163 (3%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYV-LYSNDNREL-RILKMYRKNKRFIATFS 65
           V++  IG + G+ GEV + S+  +P+ +  Y  LY+     + +++   +    F A  S
Sbjct: 5   VIVGMIGGSFGVKGEVRLKSFCADPMAIADYTPLYTEHGDSIAQVVLTGQLKGGFTARLS 64

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNF 125
           G+     A  LR++ LYA+R       L +DE++  DL  +   D  G   GQV  V + 
Sbjct: 65  GVVTKEDADALRNVALYAERAAMP--SLPDDEYYYADLIGLAVLDTGGSKLGQVKSVVDH 122

Query: 126 GAGSILEIKNTMEK-TFLIPFTKFAVLEVNLQENKILIDPIAA 167
           GAG++LE+    +  T L+PFT+ AV  V+L   +I+ DP A 
Sbjct: 123 GAGALLELHVPGQSDTVLLPFTQAAVPTVDLAAGRIIADPPAG 165


>gi|163743781|ref|ZP_02151154.1| 16S rRNA processing protein RimM [Phaeobacter gallaeciensis 2.10]
 gi|161382930|gb|EDQ07326.1| 16S rRNA processing protein RimM [Phaeobacter gallaeciensis 2.10]
          Length = 167

 Score = 87.0 bits (214), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 82/160 (51%), Gaps = 5/160 (3%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKR-FIATFS 65
           + +  I  ++G+ GEV + S+   P D+  Y  L + D  +   + + R  K  F A   
Sbjct: 5   ICVGAISGSYGVRGEVRLKSFCAMPEDIEDYSPLSTEDGSQTYTITLVRAIKNGFTARIG 64

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNF 125
           GI+    A  L+ ++L+A R       L +DE+++TDL  +E +D  G   G V  V N 
Sbjct: 65  GIETKEQADALKGIRLFAPRDRLP--SLPDDEYYHTDLMGLEVYDTGGTLLGTVKSVQNH 122

Query: 126 GAGSILEIKNTME-KTFLIPFTKFAVLEVNLQENKILIDP 164
           GA  +LEI    + KT L+PFT  AV  V+L   +I+ DP
Sbjct: 123 GASDLLEITIPADSKTVLLPFTLAAVPTVDLAAGRIIADP 162


>gi|192288675|ref|YP_001989280.1| 16S rRNA-processing protein RimM [Rhodopseudomonas palustris TIE-1]
 gi|238692575|sp|B3Q855|RIMM_RHOPT RecName: Full=Ribosome maturation factor rimM
 gi|192282424|gb|ACE98804.1| 16S rRNA processing protein RimM [Rhodopseudomonas palustris TIE-1]
          Length = 176

 Score = 87.0 bits (214), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 46/159 (28%), Positives = 76/159 (47%), Gaps = 4/159 (2%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRY--VLYSNDNRELRILKMYRKNKRFIATF 64
           L+ +A IG  HG+ G V + S+  +P  ++ Y  ++  +  R+  I          + T 
Sbjct: 5   LICVARIGAPHGVRGAVRLWSFTADPFAVSDYGPLVTKDGARQFEIASAREAKSHLVVTL 64

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
            G+     A  L  ++LY  R   K    E DE+++ DL  +      G   G+V  ++N
Sbjct: 65  KGVATRDEAERLNGVELYVARD--KLPPTEADEYYHADLIGLAAVTTAGDALGKVVAIHN 122

Query: 125 FGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
           FGAG I+EI      T L+PFT   V  V+L   +++I+
Sbjct: 123 FGAGDIIEIAPPSGPTLLLPFTNAVVPTVDLAAGQVVIE 161


>gi|16127881|ref|NP_422445.1| 16S rRNA processing protein RimM [Caulobacter crescentus CB15]
 gi|221236702|ref|YP_002519139.1| 16S rRNA-processing protein RimM [Caulobacter crescentus NA1000]
 gi|21362873|sp|Q9A2B4|RIMM_CAUCR RecName: Full=Ribosome maturation factor rimM
 gi|13425407|gb|AAK25613.1| 16S rRNA processing protein RimM [Caulobacter crescentus CB15]
 gi|220965875|gb|ACL97231.1| 16S rRNA processing protein rimM [Caulobacter crescentus NA1000]
          Length = 193

 Score = 87.0 bits (214), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 83/166 (50%), Gaps = 6/166 (3%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNK-RFIA 62
           D L+L+  +    G+ GEV I +Y  +P+ +  +  L   D      +   RK K   + 
Sbjct: 7   DPLILVGRVAGGFGVRGEVRITTYTEDPLSIAGFKALKRQDGSPALTIASARKTKDGVVC 66

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQG-KYWGQVCG 121
              G++   +A  LR L+LY  R      E ++DEF+ TDL  +     Q  +  G+V  
Sbjct: 67  RCPGVETKEAADALRGLRLYVPRSALP--EPDDDEFYLTDLVGLTVRHIQTDQLLGRVKS 124

Query: 122 VYNFGAGSILEIKNTME-KTFLIPFTKFAVLEVNLQENKILIDPIA 166
           V NFGAG ILEI   +   T+ +PFT+ AV EV + E  IL DP A
Sbjct: 125 VQNFGAGDILEITPDLGGPTWYLPFTRAAVPEVRVSEGLILADPPA 170


>gi|126463468|ref|YP_001044582.1| 16S rRNA-processing protein RimM [Rhodobacter sphaeroides ATCC
           17029]
 gi|166226471|sp|A3PN94|RIMM_RHOS1 RecName: Full=Ribosome maturation factor rimM
 gi|126105132|gb|ABN77810.1| 16S rRNA processing protein RimM [Rhodobacter sphaeroides ATCC
           17029]
          Length = 169

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 54/167 (32%), Positives = 78/167 (46%), Gaps = 6/167 (3%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND--NRELRILKMYRKNK 58
           M K D+ V +  I    G+ GEV + S+   P D+  Y   S +  +R  R+        
Sbjct: 1   MTKTDR-VCVGAIAGAFGVKGEVRLKSFCTEPTDIASYGPLSTEKGDRSFRVTLTRPVAG 59

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
              A  S +     A  LR + LY  R       L +DEF++ DL  +E  D  G   G+
Sbjct: 60  GLGARLSDVTTKEEADALRGVGLYVDRARLP--SLGDDEFYHADLIGLEVRDTGGALLGR 117

Query: 119 VCGVYNFGAGSILEIKNTMEK-TFLIPFTKFAVLEVNLQENKILIDP 164
           V  V+N GAG ILEI   + +   L+PFT+  V  V+L   +I+ DP
Sbjct: 118 VHAVHNHGAGDILEIAGAVGREGLLLPFTRAVVPTVDLAAGRIVADP 164


>gi|159042900|ref|YP_001531694.1| 16S rRNA-processing protein RimM [Dinoroseobacter shibae DFL 12]
 gi|209573577|sp|A8LMB6|RIMM_DINSH RecName: Full=Ribosome maturation factor rimM
 gi|157910660|gb|ABV92093.1| 16S rRNA processing protein RimM [Dinoroseobacter shibae DFL 12]
          Length = 166

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 49/159 (30%), Positives = 78/159 (49%), Gaps = 4/159 (2%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKRFIATFSG 66
           V +  +    G+ GE+ I S+   P D+  Y  L   D RE  +    +         +G
Sbjct: 5   VCVGAVAGAFGVRGELRIKSFCAVPEDIASYNPLSFEDGRETTLRLTGQIKNGLSGRLTG 64

Query: 67  IDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFG 126
           + N  +A  LR  +LYA R       L +DEF++ DL  +   D  G   G+V  V+N G
Sbjct: 65  VSNKEAADALRGARLYAPRDRLP--RLPDDEFYHADLIGLAVHDTGGTLLGKVAAVHNHG 122

Query: 127 AGSILEIKNT-MEKTFLIPFTKFAVLEVNLQENKILIDP 164
           AG +LE++   ++ + L+PFT+  V  V+L   +I+ DP
Sbjct: 123 AGDLLELRGPGLKGSVLLPFTRAVVPTVDLDAGRIVADP 161


>gi|299133091|ref|ZP_07026286.1| 16S rRNA processing protein RimM [Afipia sp. 1NLS2]
 gi|298593228|gb|EFI53428.1| 16S rRNA processing protein RimM [Afipia sp. 1NLS2]
          Length = 180

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/165 (27%), Positives = 80/165 (48%), Gaps = 4/165 (2%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDN--RELRILKMYRKNK 58
           M K  + + +A IG  HG+ GEV +  +  + + +  Y   S  +  R+  + +      
Sbjct: 1   MAKAAQKICVAKIGAAHGVRGEVRLWPFTEDLLAVLHYGPLSTKDGARQFEVARARAAKD 60

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
             +AT  G+ +  +A  L  ++LY  R      E ++ E+++ DL  +   D QG   G 
Sbjct: 61  HLVATLKGVADRDAAERLNGIELYISRDALP--ETDDGEYYHADLIGLAAIDAQGASLGT 118

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
           V  ++NFGAG I+EI      + L+PFT   V  V+L    ++++
Sbjct: 119 VTAIHNFGAGDIIEIAPKSGPSLLLPFTNAVVPTVDLAAGHVIVE 163


>gi|254476323|ref|ZP_05089709.1| 16S rRNA processing protein RimM [Ruegeria sp. R11]
 gi|214030566|gb|EEB71401.1| 16S rRNA processing protein RimM [Ruegeria sp. R11]
          Length = 167

 Score = 86.7 bits (213), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 54/160 (33%), Positives = 81/160 (50%), Gaps = 5/160 (3%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSN-DNRELRILKMYRKNKR-FIATFS 65
           + +  I  ++G+ GEV + S+   P D+  Y   SN D  +   L + R  K  F A   
Sbjct: 5   ICVGAIAGSYGVRGEVRLKSFCAIPEDIEAYSPLSNEDGTQSYTLVLVRAIKNGFTARVG 64

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNF 125
           G++    A  L+ L+L+A+R       L +DE+++TDL  +E +D  G   G V  V N 
Sbjct: 65  GVETKEQADALKGLRLFAQRDRLP--SLPDDEYYHTDLMGLEVYDTGGTLLGTVKTVQNH 122

Query: 126 GAGSILEIK-NTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           GA  +LEI       T L+PFT  AV  V+L   +I+ DP
Sbjct: 123 GASDLLEITVPGHSSTILLPFTLAAVPTVDLASGRIIADP 162


>gi|89053239|ref|YP_508690.1| 16S rRNA-processing protein RimM [Jannaschia sp. CCS1]
 gi|109893020|sp|Q28UE7|RIMM_JANSC RecName: Full=Ribosome maturation factor rimM
 gi|88862788|gb|ABD53665.1| 16S rRNA processing protein RimM [Jannaschia sp. CCS1]
          Length = 187

 Score = 86.3 bits (212), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 75/157 (47%), Gaps = 5/157 (3%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKR-FIATFSGI 67
           +  I  + G+ GEV + S+   P D+  Y  L + D  +   + + R  K  + A  SG+
Sbjct: 9   VGAISGSFGVRGEVRLKSFCAEPSDIGSYGPLSTEDGAQTYTITLTRPVKAGYAAMLSGV 68

Query: 68  DNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFGA 127
                A  LR  +LYA R       L +DEF++ DL  +   D  G+  G V  V N GA
Sbjct: 69  ATKEDADALRGTRLYAPRSALP--SLPDDEFYHADLVGLTVLDTGGEVIGTVASVANHGA 126

Query: 128 GSILEIKNT-MEKTFLIPFTKFAVLEVNLQENKILID 163
           G ILE+    +    LIPFT   V  V++   ++++D
Sbjct: 127 GDILELSGPGLPSGLLIPFTLAVVPTVDIAAGRVIVD 163


>gi|126738059|ref|ZP_01753780.1| 16S rRNA processing protein RimM [Roseobacter sp. SK209-2-6]
 gi|126720556|gb|EBA17261.1| 16S rRNA processing protein RimM [Roseobacter sp. SK209-2-6]
          Length = 167

 Score = 85.9 bits (211), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 52/164 (31%), Positives = 84/164 (51%), Gaps = 5/164 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYV-LYSNDNRELRILKMYRKNKR-FI 61
           + +L+ +  I  ++G+ GEV + S+   P ++  Y  L S D  +   L + R  K  F 
Sbjct: 1   MSELICVGAIAGSYGVRGEVRLKSFCAVPEEIEAYSPLSSEDGSQSYSLTLTRAIKGGFS 60

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               G++    A  ++ LKL+A R       L  DE++  DL  ME +D  G   G V  
Sbjct: 61  GYLGGVETKEQADAIKGLKLFAPRDRLPS--LPSDEYYYADLVGMEVYDTGGVLLGTVKS 118

Query: 122 VYNFGAGSILEIKN-TMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           V N GA  +LE++   ++ T L+PFT  AV  V+L++ +I+ DP
Sbjct: 119 VQNHGASDLLELQGEAIKGTALLPFTMAAVPTVDLEQGRIIADP 162


>gi|84501321|ref|ZP_00999526.1| 16S rRNA processing protein RimM [Oceanicola batsensis HTCC2597]
 gi|84390612|gb|EAQ03100.1| 16S rRNA processing protein RimM [Oceanicola batsensis HTCC2597]
          Length = 166

 Score = 85.9 bits (211), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 50/163 (30%), Positives = 81/163 (49%), Gaps = 4/163 (2%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKR-FIA 62
           + + V +  I  ++G+ GEV + S+  +P  +  Y   + DN     + + R  K  F A
Sbjct: 1   MTETVCVGAIAGSYGVRGEVRLKSFCADPEAIAEYGPLTGDNGASYSVTLTRPIKNGFAA 60

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
              G+     A  L+ ++L+A R        EEDEF++ DL  +   D  G   G +  V
Sbjct: 61  RLGGVATKEEADALKGVQLFAPRDRLP--ATEEDEFYHADLIGLRVVDTGGTEIGTIRAV 118

Query: 123 YNFGAGSILEIKNT-MEKTFLIPFTKFAVLEVNLQENKILIDP 164
            + GAG +LEIK   ++ T L+PFT+  V  V+L   K++ DP
Sbjct: 119 MDHGAGDLLEIKGPGLKNTVLLPFTRACVPTVDLAGGKVVADP 161


>gi|77464628|ref|YP_354132.1| 16S rRNA-processing protein RimM [Rhodobacter sphaeroides 2.4.1]
 gi|332559521|ref|ZP_08413843.1| 16S rRNA-processing protein RimM [Rhodobacter sphaeroides WS8N]
 gi|109893044|sp|Q3IZ03|RIMM_RHOS4 RecName: Full=Ribosome maturation factor rimM
 gi|77389046|gb|ABA80231.1| 16S rRNA processing protein RimM [Rhodobacter sphaeroides 2.4.1]
 gi|332277233|gb|EGJ22548.1| 16S rRNA-processing protein RimM [Rhodobacter sphaeroides WS8N]
          Length = 169

 Score = 85.9 bits (211), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 53/167 (31%), Positives = 77/167 (46%), Gaps = 6/167 (3%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND--NRELRILKMYRKNK 58
           M K D+ V +  I    G+ GEV + S+   P D+  Y   S +  +R  R+        
Sbjct: 1   MTKTDR-VCVGAIAGAFGVKGEVRLKSFCTEPTDIASYGPLSTEKGDRSFRVTLTRPVAG 59

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
              A  S +     A  LR + LY  R       L +DEF++ DL  +E  D  G   G+
Sbjct: 60  GLGARLSDVTTKEEADALRGVGLYVDRARLP--SLGDDEFYHADLIGLEVRDTGGALLGR 117

Query: 119 VCGVYNFGAGSILEIKNTMEK-TFLIPFTKFAVLEVNLQENKILIDP 164
           V  V+N GAG ILE+     +   L+PFT+  V  V+L   +I+ DP
Sbjct: 118 VHAVHNHGAGDILEVAGAAGREGLLLPFTRAVVPTVDLAAGRIVADP 164


>gi|221640540|ref|YP_002526802.1| 16S rRNA-processing protein RimM [Rhodobacter sphaeroides KD131]
 gi|221161321|gb|ACM02301.1| 16S rRNA-processing protein rimM [Rhodobacter sphaeroides KD131]
          Length = 176

 Score = 85.9 bits (211), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 53/167 (31%), Positives = 77/167 (46%), Gaps = 6/167 (3%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND--NRELRILKMYRKNK 58
           M K D+ V +  I    G+ GEV + S+   P D+  Y   S +  +R  R+        
Sbjct: 8   MTKTDR-VCVGAIAGAFGVKGEVRLKSFCTEPTDIASYGPLSTEKGDRSFRVTLTRPVAG 66

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
              A  S +     A  LR + LY  R       L +DEF++ DL  +E  D  G   G+
Sbjct: 67  GLGARLSDVTTKEEADALRGVGLYVDRARLP--SLGDDEFYHADLIGLEVRDTGGALLGR 124

Query: 119 VCGVYNFGAGSILEIKNTMEK-TFLIPFTKFAVLEVNLQENKILIDP 164
           V  V+N GAG ILE+     +   L+PFT+  V  V+L   +I+ DP
Sbjct: 125 VHAVHNHGAGDILEVAGAAGREGLLLPFTRAVVPTVDLAAGRIVADP 171


>gi|312115619|ref|YP_004013215.1| 16S rRNA processing protein RimM [Rhodomicrobium vannielii ATCC
           17100]
 gi|311220748|gb|ADP72116.1| 16S rRNA processing protein RimM [Rhodomicrobium vannielii ATCC
           17100]
          Length = 193

 Score = 85.5 bits (210), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 52/159 (32%), Positives = 78/159 (49%), Gaps = 5/159 (3%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNK--RFIATF 64
           VL+  IG  HGL GEV I ++   P D+  Y  L S D     ++   R       IA  
Sbjct: 6   VLLGRIGGAHGLRGEVKIATFTAAPEDITAYGPLSSADGTRTFVITGMRAASPGSVIARL 65

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
            G+ +   A  L  ++LY  R      E E+DEF+ +DL  +     +G   G+V GV+N
Sbjct: 66  KGVADRTQAEALNGIELYVPRDSLPPPE-EDDEFYYSDLIGLAAVSPEGAAVGKVIGVHN 124

Query: 125 FGAGSILEIKNTMEK-TFLIPFTKFAVLEVNLQENKILI 162
           FGAG ++E++   E+   LIPF    V  V+L   ++ +
Sbjct: 125 FGAGDLIEVRFGDERQPVLIPFDNAHVPHVDLGAGRVTV 163


>gi|323135866|ref|ZP_08070949.1| 16S rRNA processing protein RimM [Methylocystis sp. ATCC 49242]
 gi|322398957|gb|EFY01476.1| 16S rRNA processing protein RimM [Methylocystis sp. ATCC 49242]
          Length = 177

 Score = 85.5 bits (210), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 83/162 (51%), Gaps = 6/162 (3%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDN--RELRILKMYRKNK-RFIAT 63
           LVL+   G  HG+ GE+ + SY  +P+ +  Y   ++ +  +  ++  +  + K   +A 
Sbjct: 7   LVLLGRFGAPHGVRGEIRLQSYTADPLAIASYGPLTDKSGTKSFKLASVRPQGKDMLVAR 66

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
             G+ +   A  L  ++LY  R+     +  EDEF+  DL  +    R+G   G+V  V 
Sbjct: 67  VEGVSDRTGAEALTGVELYLPREKLPPPD--EDEFYLADLVGLRAQTREGVEIGRVVAVR 124

Query: 124 NFGAGSILEIKNT-MEKTFLIPFTKFAVLEVNLQENKILIDP 164
           NFGAG ILE+      +T + PFT+     V++ E +++I+P
Sbjct: 125 NFGAGDILEVTPPDGGETLMFPFTRAVAPVVSIAEGRVIIEP 166


>gi|149915428|ref|ZP_01903955.1| putative 16S rRNA processing protein [Roseobacter sp. AzwK-3b]
 gi|149810717|gb|EDM70558.1| putative 16S rRNA processing protein [Roseobacter sp. AzwK-3b]
          Length = 170

 Score = 84.7 bits (208), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 53/164 (32%), Positives = 81/164 (49%), Gaps = 6/164 (3%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDN-RELRI-LKMYRKNKRFI 61
           D  + +  I    G++GE+ + S+   P D+  Y  L + D  R   I L         I
Sbjct: 4   DTRICLGAIAGAFGVHGELRLKSFTATPEDIAAYGPLETEDGARSFEITLSGQSAKGGLI 63

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
           A  SG+     A  LR ++LY +R       L ++E+++ DL  +E +D  G   G+V  
Sbjct: 64  ARLSGVTTKEQADALRGVRLYTERDRLP--ALPDEEYYHADLIGLEVYDTGGTLLGRVKA 121

Query: 122 VYNFGAGSILEIKNT-MEKTFLIPFTKFAVLEVNLQENKILIDP 164
           V N GAG ILE+    +  T L+PFT+ AV  V+L   +I+ DP
Sbjct: 122 VLNHGAGDILELHGQGLTSTVLLPFTRQAVPTVDLAAGRIVADP 165


>gi|254464202|ref|ZP_05077613.1| 16S rRNA processing protein RimM [Rhodobacterales bacterium Y4I]
 gi|206685110|gb|EDZ45592.1| 16S rRNA processing protein RimM [Rhodobacterales bacterium Y4I]
          Length = 167

 Score = 84.7 bits (208), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 53/164 (32%), Positives = 84/164 (51%), Gaps = 5/164 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSN-DNRELRILKMYRKNKR-FI 61
           +  L+ +  I  + G+ GEV + S+   P ++  Y   SN D  +   L + R  K  F 
Sbjct: 1   MSDLICVGAIAGSFGVRGEVRLKSFCAVPEEIEDYSPLSNEDGSKTYSLTITRPIKNGFA 60

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
           A   G++    A  ++ L+L+A+R       L +DEF++ DL  +E +D  G   G V  
Sbjct: 61  ALLEGVETKEDADAIKGLRLFARRDQLP--LLPDDEFYHADLIGLEVYDTGGTLLGTVKS 118

Query: 122 VYNFGAGSILEIKNT-MEKTFLIPFTKFAVLEVNLQENKILIDP 164
           V N GA  +LEI    ++ T L+PFT  AV  V+L + +I+ DP
Sbjct: 119 VQNHGASDLLEIHGPGLKATVLLPFTLEAVPTVDLTQGRIIADP 162


>gi|99082449|ref|YP_614603.1| 16S rRNA-processing protein RimM [Ruegeria sp. TM1040]
 gi|122397563|sp|Q1GDC5|RIMM_SILST RecName: Full=Ribosome maturation factor rimM
 gi|99038729|gb|ABF65341.1| 16S rRNA processing protein RimM [Ruegeria sp. TM1040]
          Length = 171

 Score = 84.3 bits (207), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 52/164 (31%), Positives = 83/164 (50%), Gaps = 5/164 (3%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRYV-LYSNDNRELRILKMYRKNKR-FIATF 64
           L+ +  +  + G+ GEV + S+  N  ++  Y  L   D +    L + R  K  F A  
Sbjct: 8   LICVGALAGSFGVRGEVRLKSFCANAEEIEDYSPLLGADGQTRYTLAITRAIKGGFAARI 67

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
             ++    A  L+ ++LYA R       L +DEF++ DL  +E +D  G   G+V  V N
Sbjct: 68  VDVETKEQADALKGVQLYAPRDRLP--SLPDDEFYHADLIGLEVYDTGGTLLGRVKAVQN 125

Query: 125 FGAGSILEIKNT-MEKTFLIPFTKFAVLEVNLQENKILIDPIAA 167
           +GA  +LE+    +  T L+PFTK AV  V+L + +I+ DP A 
Sbjct: 126 YGADDLLELHGPGLSATVLLPFTKAAVPTVDLSQGRIIADPPAG 169


>gi|209573738|sp|B0UCL3|RIMM_METS4 RecName: Full=Ribosome maturation factor rimM
          Length = 209

 Score = 84.0 bits (206), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 52/164 (31%), Positives = 78/164 (47%), Gaps = 6/164 (3%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNR--ELRILKMYRKNKR-FI 61
           +LV++   G  HGL GEV + SY   P+ +  Y  L ++D R  EL  L+         +
Sbjct: 31  RLVVLGEFGRAHGLQGEVRLKSYTAEPMAIGGYGPLLASDGRVVELTALRPAAGTPDILV 90

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
           A  +G+    +A  L  L L   R      E +EDEFF  DL  +   D  G   G +  
Sbjct: 91  ARVAGVAGRSAAEGLNRLTLSVPRDRLGAPE-DEDEFFTADLVGLAAVDAAGTRLGTIRA 149

Query: 122 VYNFGAGSILEIK-NTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           V N+G G +LEI+     +  L+PFT+  V +V +   ++ I P
Sbjct: 150 VPNYGGGDLLEIEPEGGGRPALLPFTRLFVPKVEIAAGRVTIAP 193


>gi|83951191|ref|ZP_00959924.1| putative 16S rRNA processing protein [Roseovarius nubinhibens ISM]
 gi|83839090|gb|EAP78386.1| putative 16S rRNA processing protein [Roseovarius nubinhibens ISM]
          Length = 167

 Score = 84.0 bits (206), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 53/163 (32%), Positives = 80/163 (49%), Gaps = 6/163 (3%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDN-RELRILKMYRKNKRFIA 62
           DK+ + A  G   G+ GE+ + S+   P D+  Y  L + D  R   +    +      A
Sbjct: 3   DKICVGAIAGA-FGVRGELRLKSFTATPEDIATYGPLETEDGARSFAVTLTGQTTNALTA 61

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
             SG+ +   A  LR  +LY  R       L +DE+++ DL  +E FD  G   G+V  V
Sbjct: 62  RLSGVQSKEEADALRGTQLYVARDRLP--SLPDDEYYHADLIGLEVFDSGGALLGRVKAV 119

Query: 123 YNFGAGSILEIKNT-MEKTFLIPFTKFAVLEVNLQENKILIDP 164
            N GA  +LEI    ++ T L+PFT+ AV  V+L   +I+ DP
Sbjct: 120 LNHGASDLLEIHGPGLKSTVLLPFTRAAVPTVDLATGRIVADP 162


>gi|294675923|ref|YP_003576538.1| 16S rRNA processing protein RimM [Rhodobacter capsulatus SB 1003]
 gi|294474743|gb|ADE84131.1| 16S rRNA processing protein RimM [Rhodobacter capsulatus SB 1003]
          Length = 169

 Score = 84.0 bits (206), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 56/167 (33%), Positives = 80/167 (47%), Gaps = 6/167 (3%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRK-NK 58
           M K D++ + A  G   G+ GEV + S+   P D+  Y  LYS D      +++ R    
Sbjct: 1   MSKTDRVCVGAIAGG-FGVKGEVRLKSFCATPEDIAAYGPLYSEDGTRSFTVRLTRPVTG 59

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
              A  SGI     A  L+   L+A R       L +DEF++ DL  +   D  G   G 
Sbjct: 60  GLGARLSGIATKEEADALKGATLWADRDRLP--HLPDDEFYHADLIGLPVQDTGGALIGT 117

Query: 119 VCGVYNFGAGSILEIKNTMEK-TFLIPFTKFAVLEVNLQENKILIDP 164
           V  V +FGAG ILE+     K T ++PFT+  V  V+L   +I+ DP
Sbjct: 118 VRAVLDFGAGDILEVHVPGRKTTLMLPFTRAVVPTVDLTAGRIIADP 164


>gi|114328348|ref|YP_745505.1| 16S rRNA processing protein rimM [Granulibacter bethesdensis
           CGDNIH1]
 gi|122326694|sp|Q0BRH0|RIMM_GRABC RecName: Full=Ribosome maturation factor rimM
 gi|114316522|gb|ABI62582.1| 16S rRNA processing protein rimM [Granulibacter bethesdensis
           CGDNIH1]
          Length = 186

 Score = 84.0 bits (206), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 52/161 (32%), Positives = 85/161 (52%), Gaps = 5/161 (3%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIATFSG 66
           L+L+  IG  HG+ G V++ SY  +P DL  Y L  +D    +I+  +R +     T  G
Sbjct: 5   LILLGVIGRPHGVRGLVHVVSYTADPDDLTAYGLL-HDEAGRQIMLDWRADGLAGITIDG 63

Query: 67  I--DNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMET-FDRQGKYWGQVCGVY 123
           +   +  +A  L + +L+  R      E +ED+F+  DL  +E          GQV  V+
Sbjct: 64  VPVQDRSAAERLTNTRLFINRDALPPVE-DEDDFYLVDLIGLEARLVADETLLGQVAQVH 122

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           ++GAG+ LEI  +   + L+PFT+ AV  V++   ++LIDP
Sbjct: 123 DYGAGASLEITRSGGASLLVPFTRAAVPVVDIAAGRVLIDP 163


>gi|254417860|ref|ZP_05031584.1| 16S rRNA processing protein RimM [Brevundimonas sp. BAL3]
 gi|196184037|gb|EDX79013.1| 16S rRNA processing protein RimM [Brevundimonas sp. BAL3]
          Length = 175

 Score = 84.0 bits (206), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 58/167 (34%), Positives = 80/167 (47%), Gaps = 5/167 (2%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKR 59
           M    +L+L+  IG   G+ GEV + ++  +P+ L  Y  L   D      L   R +K 
Sbjct: 1   MTTDSRLILVGQIGGGFGVRGEVRVTAFTADPLALTAYGPLLRADGTVALTLSATRPDKS 60

Query: 60  -FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
             +     I     A  LR LKLY  R  F   E +EDEF+  DL  +E  D  G+  G 
Sbjct: 61  GVVGRAKEIATKEQADALRGLKLYVPRDRFP--EPDEDEFYLADLLGVEVRDTAGEVMGT 118

Query: 119 VCGVYNFGAGSILEI-KNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           V  V NFGA  +LEI   T   T+ +PFTK A  E++L +  +L  P
Sbjct: 119 VKSVQNFGADDMLEIAPATGGPTWYLPFTKAATPELHLADGWLLAVP 165


>gi|114771309|ref|ZP_01448729.1| 16S rRNA processing protein RimM [alpha proteobacterium HTCC2255]
 gi|114548234|gb|EAU51121.1| 16S rRNA processing protein RimM [alpha proteobacterium HTCC2255]
          Length = 189

 Score = 83.6 bits (205), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 57/180 (31%), Positives = 95/180 (52%), Gaps = 6/180 (3%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKR 59
           M   +++ + A +G   G++GE+ + S+ ++P  +  Y  L     +++  LK+    K 
Sbjct: 1   MTIPERVCVGAVVGA-FGIHGEIRVKSFCSDPESIAEYDQLTDETGKKVFKLKIINPIKG 59

Query: 60  -FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
            F A  SG+     A EL+ + LY  R +  +  L++DEF+ +DL  +E FD  G   G+
Sbjct: 60  GFSARISGVKYRDQAEELKGIALYVCRSEMPN--LDDDEFYYSDLINLEVFDTGGIKIGK 117

Query: 119 VCGVYNFGAGSILEIKNTMEKTF-LIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNP 177
           V  V + GAG  LEIK   +K   L+PFTK +V  ++L+  +I+IDP      N   + P
Sbjct: 118 VISVNDHGAGDFLEIKAYGQKNLALLPFTKKSVPTIDLKLGRIIIDPPHGVFENNEPEEP 177


>gi|119386589|ref|YP_917644.1| 16S rRNA processing protein RimM [Paracoccus denitrificans PD1222]
 gi|171704477|sp|A1B8V4|RIMM_PARDP RecName: Full=Ribosome maturation factor rimM
 gi|119377184|gb|ABL71948.1| 16S rRNA processing protein RimM [Paracoccus denitrificans PD1222]
          Length = 167

 Score = 83.6 bits (205), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 79/160 (49%), Gaps = 5/160 (3%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSND-NRELRILKMYRKNKRFIATFS 65
           V +  I    G+ GEV + S+ + P D+  Y  LY+ D NR   I           A  S
Sbjct: 5   VCVGAIAGAFGVRGEVRLKSFTSQPNDIAGYSPLYTEDGNRSFTIRLTRPVTGGLGARLS 64

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNF 125
           G++    A  L+ + L+A R   K   L +DEF++ DL  +  +D  G   G+V  +Y+ 
Sbjct: 65  GVETREQAEALKGVTLWADRD--KLPALPDDEFYHADLIGLSVYDTGGALLGKVRAIYDH 122

Query: 126 GAGSILEI-KNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           GAG ILEI      +  L+PFT+  V  V+L   +I+ DP
Sbjct: 123 GAGDILEIFGPGRRQVLLLPFTRAFVPTVDLAAGRIVADP 162


>gi|241761943|ref|ZP_04760028.1| 16S rRNA processing protein RimM [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
 gi|241373623|gb|EER63195.1| 16S rRNA processing protein RimM [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
          Length = 163

 Score = 83.6 bits (205), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 79/158 (50%), Gaps = 6/158 (3%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIATF 64
           D+L+ +A +   HG+ GEV +  +  +      Y ++S +   L + K+    K ++A F
Sbjct: 6   DRLITLAVVTGAHGITGEVRLKPFTEDAAQFKAYGIFSANGTPLTLKKLRPDPKGWVARF 65

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
           S I + + A  LR   L   R+   D  L  DE++  DL  +   D  G+  G    V N
Sbjct: 66  SEITDRNQAEALRGTALTVPRKALPD--LPADEYYYIDLIGLPCVDSSGQSIGVSVAVEN 123

Query: 125 FGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
           +GAG ILEI+   EK F++P  +     V++ ++ ++I
Sbjct: 124 YGAGDILEIEKADEKRFMVPIAQ----AVDVHDDHLVI 157


>gi|56551973|ref|YP_162812.1| 16S rRNA processing protein RimM [Zymomonas mobilis subsp. mobilis
           ZM4]
 gi|260752482|ref|YP_003225375.1| 16S rRNA processing protein RimM [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|67461300|sp|Q5NNK9|RIMM_ZYMMO RecName: Full=Ribosome maturation factor rimM
 gi|56543547|gb|AAV89701.1| 16S rRNA processing protein RimM [Zymomonas mobilis subsp. mobilis
           ZM4]
 gi|258551845|gb|ACV74791.1| 16S rRNA processing protein RimM [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
          Length = 163

 Score = 83.6 bits (205), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 79/158 (50%), Gaps = 6/158 (3%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIATF 64
           D+L+ +A +   HG+ GEV +  +  +      Y ++S +   L + K+    K ++A F
Sbjct: 6   DRLITLAVVTGAHGITGEVRLKPFTEDAAQFKAYGIFSANGTPLTLKKLRPDPKGWVARF 65

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
           S I + + A  LR   L   R+   D  L  DE++  DL  +   D  G+  G    V N
Sbjct: 66  SEITDRNQAEALRGTALTVPRKALPD--LPADEYYYIDLIGLPCVDPSGQSIGVSVAVEN 123

Query: 125 FGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
           +GAG ILEI+   EK F++P  +     V++ ++ ++I
Sbjct: 124 YGAGDILEIEKADEKRFMVPIAQ----AVDVHDDHLVI 157


>gi|197103581|ref|YP_002128958.1| 16S rRNA processing protein RimM [Phenylobacterium zucineum HLK1]
 gi|196477001|gb|ACG76529.1| 16S rRNA processing protein RimM [Phenylobacterium zucineum HLK1]
          Length = 167

 Score = 83.6 bits (205), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 57/159 (35%), Positives = 76/159 (47%), Gaps = 4/159 (2%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYV-LYSNDNRELRILKMYRKNKR-FIA 62
           D L+L+  +    G+ GEV + SY   P  L  Y  L   D R    L   R  K   + 
Sbjct: 3   DSLILVGRVAGAFGVRGEVRLTSYTAEPSALLDYRDLKREDGRPALTLLSGRPAKGGLVV 62

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
               ++    A  LR L LY  R      E EEDEF+ TDL  +     QG+  G+V  V
Sbjct: 63  RAQEVETREQAEALRGLNLYIPRDILP--EPEEDEFYVTDLIGLAVETPQGEPLGRVKNV 120

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKIL 161
            +FGAG +LEI+      + +PFTK AV EV L E K++
Sbjct: 121 QDFGAGDLLEIEPPEGAAWYLPFTKEAVPEVRLAEGKVV 159


>gi|90421747|ref|YP_530117.1| 16S rRNA-processing protein RimM [Rhodopseudomonas palustris
           BisB18]
 gi|109893042|sp|Q21CT8|RIMM_RHOPB RecName: Full=Ribosome maturation factor rimM
 gi|90103761|gb|ABD85798.1| 16S rRNA processing protein RimM [Rhodopseudomonas palustris
           BisB18]
          Length = 176

 Score = 83.6 bits (205), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 79/158 (50%), Gaps = 4/158 (2%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNK-RFIATFS 65
           + +A IG  HG+ G V +  +  +P+ +  Y  L + D +    ++  R+ K   +AT  
Sbjct: 6   ICVARIGAPHGVRGAVKLWPFTADPLAVLDYGPLSTKDGKRSFEVETAREAKGHLVATLQ 65

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNF 125
           G+ +   A  L  ++LY  R      E  E E+++ DL  +   D  G   G+V  ++NF
Sbjct: 66  GVVSREDAERLNGVELYIDRAQLPPPE--EGEYYHADLIGLAAVDAAGAPIGKVLAIHNF 123

Query: 126 GAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
           GAG I+EI      T L+PFT   V  V++   +++I+
Sbjct: 124 GAGDIIEIAPPSGPTLLLPFTNAVVPTVDIASGRVVIE 161


>gi|126734921|ref|ZP_01750667.1| 16S rRNA processing protein RimM [Roseobacter sp. CCS2]
 gi|126715476|gb|EBA12341.1| 16S rRNA processing protein RimM [Roseobacter sp. CCS2]
          Length = 171

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 54/160 (33%), Positives = 78/160 (48%), Gaps = 5/160 (3%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYV-LYSNDNREL-RILKMYRKNKRFIATFS 65
           V++  IG   G+ GEV + SY  +P  +  Y  LY+ D R   +I+   +    F A   
Sbjct: 5   VIVGAIGGAFGVQGEVRLKSYCADPQAIADYTPLYTEDGRAFAQIVLTGQLKNGFTARID 64

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNF 125
           G+     A  LR++ LYA R       L +DE++  DL  +   D  G   G V  V + 
Sbjct: 65  GVITKEDADALRNVNLYAPRDIMP--SLPDDEYYYADLIGLTVVDTGGATLGTVKNVMDH 122

Query: 126 GAGSILE-IKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           GAG +LE I      T L+PFT+ AV  V+L   +I+ DP
Sbjct: 123 GAGDLLEIIVPGASDTILLPFTQAAVPTVDLTAKRIVADP 162


>gi|260428907|ref|ZP_05782884.1| 16S rRNA processing protein RimM [Citreicella sp. SE45]
 gi|260419530|gb|EEX12783.1| 16S rRNA processing protein RimM [Citreicella sp. SE45]
          Length = 168

 Score = 83.2 bits (204), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 82/162 (50%), Gaps = 9/162 (5%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNR----ELRILKMYRKNKRFIAT 63
           + + TI    G++GEV + S+  +P  +  Y   +N++     +L+I +  +    F A 
Sbjct: 5   ICVGTIAGAFGVHGEVRLKSFTADPEAIADYAPLTNEDGTRSFDLQITRAVKGG--FAAR 62

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
            SG+ +   A  LR   LY  R       L +DEF++TDL  +  +D  G   G+V  V 
Sbjct: 63  LSGVRSKEEADALRGTGLYVPRDRLP--ALPDDEFYHTDLIGLAVYDTGGVELGRVKAVL 120

Query: 124 NFGAGSILEIK-NTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           N GA  +LE++     KT L+PFT+  V  V+L   +I+ DP
Sbjct: 121 NHGAADLLELQLPGGSKTVLLPFTRAVVPTVDLASGRIVADP 162


>gi|254487378|ref|ZP_05100583.1| 16S rRNA processing protein RimM [Roseobacter sp. GAI101]
 gi|214044247|gb|EEB84885.1| 16S rRNA processing protein RimM [Roseobacter sp. GAI101]
          Length = 194

 Score = 83.2 bits (204), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 56/168 (33%), Positives = 81/168 (48%), Gaps = 5/168 (2%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYV-LYSNDNRELRILKMYRKNKR-FIATFS 65
           + +  I  ++G+ GE+ I SY   P D+  Y  L S D      L + R  K  F+A  +
Sbjct: 18  IPVGAISGSYGVRGELRIKSYCAVPEDIENYSPLTSEDGSRRYALALVRPIKNGFVARIT 77

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNF 125
            + +   A  LR   LYA R       L +DEF++ DL  +E +D  G   G+V  V N 
Sbjct: 78  DVTSKEEADALRGTLLYADRAQLP--SLPDDEFYHADLLGLEVYDTGGTLIGKVKTVQNH 135

Query: 126 GAGSILEIK-NTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNT 172
           GA  +LE +      T  +PFTK AV  V+L   +I+ DP    L +T
Sbjct: 136 GADDLLETQLAGTSATVFLPFTKAAVPTVDLASGRIIADPPDGILPDT 183


>gi|154246453|ref|YP_001417411.1| 16S rRNA-processing protein RimM [Xanthobacter autotrophicus Py2]
 gi|238686722|sp|A7IIB1|RIMM_XANP2 RecName: Full=Ribosome maturation factor rimM
 gi|154160538|gb|ABS67754.1| 16S rRNA processing protein RimM [Xanthobacter autotrophicus Py2]
          Length = 185

 Score = 82.4 bits (202), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 46/161 (28%), Positives = 83/161 (51%), Gaps = 7/161 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY--VLYSNDNRELRILKMYRKNKRFIATFS 65
           +L+A IG  HG+ GEV +  +  +P  +  Y  +  +   +  RI  +      F+A   
Sbjct: 5   ILVARIGAPHGVRGEVRLFVFTEDPGAVLDYDPLTDATGKKRFRIAALRAAKDHFVARIE 64

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNF 125
           GI +  +A  L +L L+  R+     + ++D F++ DL  ++  D  G   G+V  + +F
Sbjct: 65  GIADRTAAEALTNLDLFVPREALPPPD-DDDTFYHADLIGLDVVDEAGVVIGKVVALQDF 123

Query: 126 GAGSILEIKNTME----KTFLIPFTKFAVLEVNLQENKILI 162
           GAG ILE   T+     KT ++PF+K AV  V++   ++++
Sbjct: 124 GAGDILEYAPTLPATKAKTLMVPFSKDAVPVVDVPGRRVVV 164


>gi|91974988|ref|YP_567647.1| 16S rRNA-processing protein RimM [Rhodopseudomonas palustris BisB5]
 gi|123749437|sp|Q13DU3|RIMM_RHOPS RecName: Full=Ribosome maturation factor rimM
 gi|91681444|gb|ABE37746.1| 16S rRNA processing protein RimM [Rhodopseudomonas palustris BisB5]
          Length = 176

 Score = 82.4 bits (202), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 46/159 (28%), Positives = 73/159 (45%), Gaps = 4/159 (2%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDN-RELRILKMYRKNKRFIATF 64
           L+ +A IG  HG+ G + + S+   P+ +  Y  L + D  R   I          + T 
Sbjct: 5   LICIARIGAPHGVRGAMRLWSFTAEPLAVMDYGPLATKDGARSFEIATARPAKDHLVVTL 64

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
            G+     A  L  L+LY  R      E  + E+++ DL  +      G+  G+V  ++N
Sbjct: 65  KGVATREEAERLNGLELYVPRDRLPPTE--DGEYYHADLIGLPAITPAGEPLGRVLAIHN 122

Query: 125 FGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
           FGAG I+EI      T L+PFT   V  V+L    ++I+
Sbjct: 123 FGAGDIIEIAPPQGATLLLPFTNAVVPTVDLTAGHVVIE 161


>gi|163796730|ref|ZP_02190688.1| 50S ribosomal protein L19 [alpha proteobacterium BAL199]
 gi|159177984|gb|EDP62531.1| 50S ribosomal protein L19 [alpha proteobacterium BAL199]
          Length = 179

 Score = 82.4 bits (202), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 81/163 (49%), Gaps = 5/163 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND--NRELRILKMYRKNKRFI 61
           +D++ L A  G  HG+ G+V +  +  NP D+  Y    ++  +R  ++    R     I
Sbjct: 2   VDRVCLGAVAGA-HGVRGQVKVKPFTENPDDVAAYGPVEDERGDRRFKLSVTGRHKDTVI 60

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               G+ + ++A  LR  +LY  R      E EE  F++ DL  +      G+  G+V  
Sbjct: 61  VRIDGVSDRNAAEALRGTRLYVARAVLP--EPEEGAFYHADLIGLSVVSVGGETLGRVTS 118

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           V++FGAG ++E  +      ++PFT   V EV+L   ++++DP
Sbjct: 119 VHDFGAGDLVEYVDASGGQHMLPFTLAMVPEVDLAGGRMVVDP 161


>gi|126732673|ref|ZP_01748469.1| 16S rRNA processing protein RimM [Sagittula stellata E-37]
 gi|126706803|gb|EBA05873.1| 16S rRNA processing protein RimM [Sagittula stellata E-37]
          Length = 167

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 78/163 (47%), Gaps = 4/163 (2%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYV-LYSNDNRELRILKMYRKNKRFIA 62
           +D+ + +  I    G+ GE  + S+  +P  +  Y  L + D R   +         F  
Sbjct: 1   MDQTICVGAIAGAFGVQGEARLKSFTADPRAIEDYAPLTTEDGRSFGLNITREIANGFAV 60

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
             +G+     A  L+ ++LYA R       L +DEF++TDL  +  FD  G   G+V  V
Sbjct: 61  RLTGVATKEEADALKGVRLYAPRDRLP--SLPDDEFYHTDLIGLSVFDTGGVELGKVKAV 118

Query: 123 YNFGAGSILEIKNTMEK-TFLIPFTKFAVLEVNLQENKILIDP 164
            N GA  +LE+  T +  T L+PFT+  V  V+L   +I+ DP
Sbjct: 119 LNHGATDLLELHATGKSGTVLLPFTRACVPTVDLTAGRIVADP 161


>gi|83855064|ref|ZP_00948594.1| 16S rRNA processing protein RimM [Sulfitobacter sp. NAS-14.1]
 gi|83941588|ref|ZP_00954050.1| 16S rRNA processing protein RimM [Sulfitobacter sp. EE-36]
 gi|83842907|gb|EAP82074.1| 16S rRNA processing protein RimM [Sulfitobacter sp. NAS-14.1]
 gi|83847408|gb|EAP85283.1| 16S rRNA processing protein RimM [Sulfitobacter sp. EE-36]
          Length = 173

 Score = 82.0 bits (201), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 57/163 (34%), Positives = 83/163 (50%), Gaps = 6/163 (3%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYV-LYSNDNRELRILKMYRKNKR-FIA 62
           DK+ + A  G  +G+ GE+ I SY   P D+  Y  L S D      L + R  K  F+A
Sbjct: 3   DKISVGAISGA-YGVRGELRIKSYCAVPEDIESYSPLSSEDGTRSFNLALVRPVKNGFVA 61

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
             + + +   A  LR   L+A+R       L +DEF++TDL  +E +D  G   G+V  V
Sbjct: 62  RITDVTSKEEADALRGTVLFAQRDQLP--SLPDDEFYHTDLIGLEVYDTGGTLIGKVKTV 119

Query: 123 YNFGAGSILEIK-NTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
            N GA  +LE +     +T  +PFTK AV  V+L   +I+ DP
Sbjct: 120 QNHGADDLLETQLAGSAQTVFLPFTKAAVPTVDLATGRIIADP 162


>gi|315497157|ref|YP_004085961.1| 16S rRNA processing protein rimm [Asticcacaulis excentricus CB 48]
 gi|315415169|gb|ADU11810.1| 16S rRNA processing protein RimM [Asticcacaulis excentricus CB 48]
          Length = 180

 Score = 81.6 bits (200), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 51/177 (28%), Positives = 93/177 (52%), Gaps = 3/177 (1%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNK-RFI 61
           + +LV +A +  + G+ GE  + S+ ++P+ +  Y  LY+       ++   R +K   +
Sbjct: 1   MTELVFVAQVAASFGVRGEFKLISHMDDPLSVLEYNPLYNPRGEPALVITAARVHKGALV 60

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               GI +   A  L+ LKLY +R+D  + E +ED+F+ TDL  +E     G   G++ G
Sbjct: 61  VKAEGISDKDKADALKGLKLYVRREDLPEVE-DEDDFYITDLIGLEVRSTDGSVIGRLKG 119

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQ 178
           V +FGAG +L+I+     ++ + FT+  V EVN+    ++I P    + N  ++  Q
Sbjct: 120 VEDFGAGDLLDIQPKGGASYYLMFTRENVPEVNIGAGYVVISPPQEVVVNEPLETDQ 176


>gi|115522357|ref|YP_779268.1| 16S rRNA-processing protein RimM [Rhodopseudomonas palustris
           BisA53]
 gi|122297959|sp|Q07UU6|RIMM_RHOP5 RecName: Full=Ribosome maturation factor rimM
 gi|115516304|gb|ABJ04288.1| 16S rRNA processing protein RimM [Rhodopseudomonas palustris
           BisA53]
          Length = 176

 Score = 81.6 bits (200), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 43/160 (26%), Positives = 78/160 (48%), Gaps = 4/160 (2%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY--VLYSNDNRELRILKMYRKNKRFIAT 63
           K + +A IG  HG+ G + +  +  +P+ +  Y  +   + +R   +          +AT
Sbjct: 4   KRICVARIGAPHGVRGALKLWPFTEDPLAVLDYGPLTTQDGSRRFEVETAREAKDHLVAT 63

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
             G+ +   A  L  ++LY  R      E +E E+++ DL  +      G+  G+V  ++
Sbjct: 64  LKGVASRDDAVRLNGIELYIDRDQLP--ETDEGEYYHADLIGLAAVTAAGEPLGKVAAIH 121

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
           NFGAG I+EI      T L+PFT   V  V+L+  +++I+
Sbjct: 122 NFGAGDIIEIAPPSGPTLLLPFTNAVVPTVDLEGGRVVIE 161


>gi|302381701|ref|YP_003817524.1| 16S rRNA processing protein RimM [Brevundimonas subvibrioides ATCC
           15264]
 gi|302192329|gb|ADK99900.1| 16S rRNA processing protein RimM [Brevundimonas subvibrioides ATCC
           15264]
          Length = 174

 Score = 80.9 bits (198), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 78/159 (49%), Gaps = 5/159 (3%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY--VLYSNDNRELRILKMYRKNKRFIAT 63
           KL+L+  +    G+ GEV I +Y  +P+ L  Y  +L ++ +  L +L         +  
Sbjct: 5   KLILVGHVAGGFGVKGEVKITAYTADPLALTAYGPLLRADGSHALTVLSARPTKDGIVGR 64

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
              +     A  LR+LKL+  R  F   E +EDEF+  DL  +E  D  G   G V  V 
Sbjct: 65  VKEVATKEEADALRNLKLHVPRDRFP--EADEDEFYLADLIGVEARDPDGVVLGTVKAVQ 122

Query: 124 NFGAGSILEIKNTM-EKTFLIPFTKFAVLEVNLQENKIL 161
           NFGA  +LEI       T+ +PFT+  V +++L +  +L
Sbjct: 123 NFGADDMLEIAPAAGGPTWFLPFTRACVPDLHLSDGWLL 161


>gi|304392572|ref|ZP_07374512.1| 16S rRNA processing protein RimM [Ahrensia sp. R2A130]
 gi|303295202|gb|EFL89562.1| 16S rRNA processing protein RimM [Ahrensia sp. R2A130]
          Length = 183

 Score = 80.5 bits (197), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 80/163 (49%), Gaps = 3/163 (1%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKR 59
           M     L+L+A IG   G+ GE+ + ++ +NP  L+ Y  L + D R  ++ +M      
Sbjct: 1   MTDPSSLILLAQIGRPQGIKGELRVKAFTDNPEALDDYGALRTADGRRFKVKRMRPGKGV 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F G++    A      +L+ +R      E +EDEF+ TDL  M   D +G   G V
Sbjct: 61  LIVKFEGVNTREEAEAENGTELFIERHRLPPVE-DEDEFYVTDLIGMVVVDGEGLQIGTV 119

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
               +FGAGS+LEI      + ++ FT   V +V+L   ++ +
Sbjct: 120 KDAPDFGAGSVLEITGGA-GSVMVDFTHANVPDVDLAAGRVTV 161


>gi|160933332|ref|ZP_02080720.1| hypothetical protein CLOLEP_02177 [Clostridium leptum DSM 753]
 gi|156867209|gb|EDO60581.1| hypothetical protein CLOLEP_02177 [Clostridium leptum DSM 753]
          Length = 171

 Score = 80.5 bits (197), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 78/156 (50%), Gaps = 6/156 (3%)

Query: 13  IGTTHGLNGEVYIDSYANNPIDLNRY--VLYSNDNRELRILKMYRKNKRFIATFSGIDNI 70
           I  T GL GE+ +D + ++   L R   + +    +EL+++    + +  I    G+D+I
Sbjct: 11  ITGTQGLRGEIRVDPWCDSAEALCRLKRLYFEEGKQELKVVSARTQKRMAILKLEGVDSI 70

Query: 71  HSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDR-QGKYWGQVCGVYNFGAGS 129
             A  LR+  LYA RQDFK   LE   +F  DL  ++  D   G+ +G V  V   GA  
Sbjct: 71  EQADLLRNRVLYASRQDFK---LEPGRYFIQDLLGVKAVDADSGRDYGAVTDVLKTGAND 127

Query: 130 ILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPI 165
           + EI     K +L+P     V+E+ L+E  + I PI
Sbjct: 128 VYEITGDDGKAYLLPAIPMTVIEIRLEEGLMRIRPI 163


>gi|170741841|ref|YP_001770496.1| 16S rRNA-processing protein RimM [Methylobacterium sp. 4-46]
 gi|168196115|gb|ACA18062.1| 16S rRNA processing protein RimM [Methylobacterium sp. 4-46]
          Length = 176

 Score = 79.7 bits (195), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 75/161 (46%), Gaps = 6/161 (3%)

Query: 9   LMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNR--ELRILKMYRKNKR-FIATF 64
           ++   G  HGL GEV + SY   P+ +  Y  L ++D R  EL  L+         +A  
Sbjct: 1   MLGEFGRAHGLQGEVRLKSYTAEPMAIGGYGPLLASDGRVVELTALRPAAGTPDILVARV 60

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
           +G+    +A  L  L L   R      E +EDEFF  DL  +   D  G   G +  V N
Sbjct: 61  AGVAGRSAAEGLNRLTLSVPRDRLGAPE-DEDEFFTADLVGLAAVDAAGTRLGTIRAVPN 119

Query: 125 FGAGSILEIK-NTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           +G G +LEI+     +  L+PFT+  V +V +   ++ I P
Sbjct: 120 YGGGDLLEIEPEGGGRPALLPFTRLFVPKVEIAAGRVTIAP 160


>gi|86137215|ref|ZP_01055793.1| 16S rRNA processing protein RimM [Roseobacter sp. MED193]
 gi|85826539|gb|EAQ46736.1| 16S rRNA processing protein RimM [Roseobacter sp. MED193]
          Length = 171

 Score = 79.7 bits (195), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 81/161 (50%), Gaps = 5/161 (3%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSN-DNRELRILKMYRKNKR-FIATF 64
           L+ +  I  ++G+ GEV + S+   P ++  Y   +N D  +   L + R  K  F    
Sbjct: 8   LICVGAIAGSYGVRGEVRLKSFCAQPEEIETYSPLTNEDGSQSFSLTLGRAVKGGFTGRI 67

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
           S ++    A  L+ ++L+  R   K   L  DE+++ DL  +E FD  G   G V  V N
Sbjct: 68  STVETKEQADALKGIRLFTTRD--KLPTLPSDEYYHADLIGVEVFDTGGALLGTVKSVQN 125

Query: 125 FGAGSILEIKNT-MEKTFLIPFTKFAVLEVNLQENKILIDP 164
            GA  +LE+    ++ T  +PFT  AV  V+L++ +I+ DP
Sbjct: 126 HGASDLLELTGAGLKGTVFLPFTLAAVPTVDLEQGRIIADP 166


>gi|167648844|ref|YP_001686507.1| 16S rRNA-processing protein RimM [Caulobacter sp. K31]
 gi|167351274|gb|ABZ74009.1| 16S rRNA processing protein RimM [Caulobacter sp. K31]
          Length = 200

 Score = 79.7 bits (195), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 83/164 (50%), Gaps = 6/164 (3%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNK-RFIATF 64
           L+L+  +    G+ GE+ I +Y  +P+ L R+  L   D      ++  R  K   +A  
Sbjct: 17  LILVGRVAGAFGVRGELRIATYTEDPLTLTRFKALTRQDGSPALTVQTARVVKDGVVARC 76

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFD-RQGKYWGQVCGVY 123
           +G+D   +A  LR L+LY  R      E +EDE++  DL  +        +  G++  V 
Sbjct: 77  AGVDTKEAADALRGLRLYVPRAALP--EPDEDEYYLADLIGLPVRHVATDELLGKIKSVQ 134

Query: 124 NFGAGSILEIKNTME-KTFLIPFTKFAVLEVNLQENKILIDPIA 166
           NFGA  +LEI   +  +T+ +PFT+ AV EV + +  +L DP A
Sbjct: 135 NFGADDLLEIDPALGGQTWYLPFTRAAVPEVKIADGVVLADPPA 178


>gi|209573746|sp|B0T563|RIMM_CAUSK RecName: Full=Ribosome maturation factor rimM
          Length = 192

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 83/164 (50%), Gaps = 6/164 (3%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNK-RFIATF 64
           L+L+  +    G+ GE+ I +Y  +P+ L R+  L   D      ++  R  K   +A  
Sbjct: 9   LILVGRVAGAFGVRGELRIATYTEDPLTLTRFKALTRQDGSPALTVQTARVVKDGVVARC 68

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFD-RQGKYWGQVCGVY 123
           +G+D   +A  LR L+LY  R      E +EDE++  DL  +        +  G++  V 
Sbjct: 69  AGVDTKEAADALRGLRLYVPRAALP--EPDEDEYYLADLIGLPVRHVATDELLGKIKSVQ 126

Query: 124 NFGAGSILEIKNTME-KTFLIPFTKFAVLEVNLQENKILIDPIA 166
           NFGA  +LEI   +  +T+ +PFT+ AV EV + +  +L DP A
Sbjct: 127 NFGADDLLEIDPALGGQTWYLPFTRAAVPEVKIADGVVLADPPA 170


>gi|110678632|ref|YP_681639.1| 16S rRNA-processing protein RimM [Roseobacter denitrificans OCh
           114]
 gi|123172765|sp|Q16AP0|RIMM_ROSDO RecName: Full=Ribosome maturation factor rimM
 gi|109454748|gb|ABG30953.1| 16S rRNA processing protein RimM [Roseobacter denitrificans OCh
           114]
          Length = 168

 Score = 79.0 bits (193), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 50/163 (30%), Positives = 83/163 (50%), Gaps = 5/163 (3%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYV-LYSNDNRELRILKMYRKNKR-FIA 62
           D+ + +  I   +G+ GE+ I S+     D+  Y  L S D +    L + R  K  F+A
Sbjct: 3   DEKICVGAIAGAYGVRGELRIKSFCATAEDIETYSPLTSEDGQRHFHLALVRPIKGGFVA 62

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
             + + +   A  L+ ++L+A R       L +DE++ TDL  ++  D  G+  G V  V
Sbjct: 63  RIAEVSSKEEADALKGVQLFALRDQLP--SLPDDEYYYTDLIGLQVLDTGGELLGSVKTV 120

Query: 123 YNFGAGSILEIKNT-MEKTFLIPFTKFAVLEVNLQENKILIDP 164
            + GAG ILE++     +T L+PFT+  V  V+L   K++ DP
Sbjct: 121 ADHGAGDILEVQRPGTSETILLPFTRAVVPTVDLLAGKLIADP 163


>gi|163733915|ref|ZP_02141357.1| 16S rRNA processing protein RimM [Roseobacter litoralis Och 149]
 gi|161393026|gb|EDQ17353.1| 16S rRNA processing protein RimM [Roseobacter litoralis Och 149]
          Length = 173

 Score = 78.6 bits (192), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 50/163 (30%), Positives = 82/163 (50%), Gaps = 5/163 (3%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYV-LYSNDNRELRILKMYRKNKR-FIA 62
           D+ + +  I   +G+ GE+ I S+     D+  Y  L S D +    L + R  K  F+A
Sbjct: 8   DEKICVGAIAGAYGVRGELRIKSFCATAEDIETYAPLTSEDGQRHFHLALVRPIKGGFVA 67

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
             + +     A  L+ ++L+A R       L +DE++ TDL  ++  D  G+  G V  V
Sbjct: 68  RIAEVTTKEEADALKGVQLFALRDQLP--SLPDDEYYYTDLIGLQVLDTGGEILGSVKTV 125

Query: 123 YNFGAGSILEIKNT-MEKTFLIPFTKFAVLEVNLQENKILIDP 164
            + GAG ILE++     +T L+PFT   +  V+L+  KI+ DP
Sbjct: 126 ADHGAGDILEVQRVGSSETVLLPFTLAVIPTVDLRAGKIIADP 168


>gi|42521077|ref|NP_966992.1| 16S rRNA processing protein RimM [Wolbachia endosymbiont of
           Drosophila melanogaster]
 gi|58696689|ref|ZP_00372239.1| 16S rRNA processing protein RimM [Wolbachia endosymbiont of
           Drosophila simulans]
 gi|225630985|ref|YP_002727776.1| 16S rRNA processing protein RimM [Wolbachia sp. wRi]
 gi|225677106|ref|ZP_03788108.1| 16S rRNA processing protein RimM [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
 gi|59798785|sp|Q73FP4|RIMM_WOLPM RecName: Full=Ribosome maturation factor rimM
 gi|254797772|sp|C0R4Z3|RIMM_WOLWR RecName: Full=Ribosome maturation factor rimM
 gi|42410818|gb|AAS14926.1| 16S rRNA processing protein RimM [Wolbachia endosymbiont of
           Drosophila melanogaster]
 gi|58537131|gb|EAL60241.1| 16S rRNA processing protein RimM [Wolbachia endosymbiont of
           Drosophila simulans]
 gi|225590865|gb|EEH12090.1| 16S rRNA processing protein RimM [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
 gi|225592966|gb|ACN95985.1| 16S rRNA processing protein RimM [Wolbachia sp. wRi]
          Length = 168

 Score = 78.6 bits (192), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 92/162 (56%), Gaps = 5/162 (3%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY--VLYSNDNRELRILKMYRKNKRFIA 62
           D LV +  I + HG+ G V + ++   P +++ Y  ++  ++N ++  + +   N   IA
Sbjct: 3   DNLVCLGIITSPHGIKGAVKVKTFTEKPENISLYGKLISGDENYKIDSVSVIGDN-LVIA 61

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
           T SG+++ + A  LR+ KLY +R     E  +EDEF+ +DL +ME   +  + +G V  V
Sbjct: 62  TISGVNSRNEAELLRNKKLYIERSKLP-ELNDEDEFYQSDLVDMEVRLKSNELYGYVKSV 120

Query: 123 YNFGAGSILEI-KNTMEKTFLIPFTKFAVLEVNLQENKILID 163
           YNFG+G ILEI   + +K  ++ FTK     +N++   I+++
Sbjct: 121 YNFGSGDILEILVISTKKRIMLSFTKEIFPHINIKGRYIVLN 162


>gi|126698852|ref|YP_001087749.1| putative 16S rRNA processing protein [Clostridium difficile 630]
 gi|254974800|ref|ZP_05271272.1| putative 16S rRNA processing protein [Clostridium difficile
           QCD-66c26]
 gi|255092188|ref|ZP_05321666.1| putative 16S rRNA processing protein [Clostridium difficile CIP
           107932]
 gi|255306212|ref|ZP_05350384.1| putative 16S rRNA processing protein [Clostridium difficile ATCC
           43255]
 gi|255313927|ref|ZP_05355510.1| putative 16S rRNA processing protein [Clostridium difficile
           QCD-76w55]
 gi|255516606|ref|ZP_05384282.1| putative 16S rRNA processing protein [Clostridium difficile
           QCD-97b34]
 gi|255649706|ref|ZP_05396608.1| putative 16S rRNA processing protein [Clostridium difficile
           QCD-37x79]
 gi|260682862|ref|YP_003214147.1| putative 16S rRNA processing protein [Clostridium difficile CD196]
 gi|260686460|ref|YP_003217593.1| putative 16S rRNA processing protein [Clostridium difficile R20291]
 gi|306519819|ref|ZP_07406166.1| putative 16S rRNA processing protein [Clostridium difficile
           QCD-32g58]
 gi|123174578|sp|Q18BB6|RIMM_CLOD6 RecName: Full=Ribosome maturation factor rimM
 gi|115250289|emb|CAJ68111.1| 16S rRNA processing protein RimM [Clostridium difficile]
 gi|260209025|emb|CBA62124.1| putative 16S rRNA processing protein [Clostridium difficile CD196]
 gi|260212476|emb|CBE03385.1| putative 16S rRNA processing protein [Clostridium difficile R20291]
          Length = 171

 Score = 78.6 bits (192), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 52/164 (31%), Positives = 83/164 (50%), Gaps = 5/164 (3%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPI---DLNRYVLYSNDNRELRILKMYRKNKRFIATFSG 66
           +  I  T GL GEV +    ++     +L  + L  + N +L + K+  K    I    G
Sbjct: 10  VGQIVNTQGLKGEVRVYPLTDDIERFDELKDFYLGKDLNNKLAVEKVRYKGSMVIMKIKG 69

Query: 67  IDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFG 126
           ID+I  A +L++  +Y  R+D +  ELEE EFF  D+  ME     GKY G +  V  + 
Sbjct: 70  IDSIEKAEKLKNKFMYVSREDSR--ELEEGEFFIADMIGMEVLTVDGKYVGILEDVLQYS 127

Query: 127 AGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           A  +  +K   +K F+IP  K  V  +++ E K++IDPI   ++
Sbjct: 128 ANDVYVVKGEEDKEFMIPAIKKFVPTIDIDERKMIIDPIKGMID 171


>gi|255100272|ref|ZP_05329249.1| putative 16S rRNA processing protein [Clostridium difficile
           QCD-63q42]
          Length = 171

 Score = 78.2 bits (191), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 52/164 (31%), Positives = 83/164 (50%), Gaps = 5/164 (3%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPI---DLNRYVLYSNDNRELRILKMYRKNKRFIATFSG 66
           +  I  T GL GEV +    ++     +L  + L  + N +L + K+  K    I    G
Sbjct: 10  VGQIVNTQGLKGEVRVYPLTDDIERFDELKDFYLGKDLNNKLAVEKVRYKGSMVIMKIKG 69

Query: 67  IDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFG 126
           ID+I  A +L++  +Y  R+D +  ELEE EFF  D+  ME     GKY G +  V  + 
Sbjct: 70  IDSIEKAEKLKNKFMYVAREDSR--ELEEGEFFIADMIGMEVLTVDGKYVGILEDVLQYS 127

Query: 127 AGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           A  +  +K   +K F+IP  K  V  +++ E K++IDPI   ++
Sbjct: 128 ANDVYVVKGEEDKEFMIPAIKKFVPTIDIDERKMIIDPIKGMID 171


>gi|52859961|ref|ZP_00208181.2| COG0806: RimM protein, required for 16S rRNA processing
           [Magnetospirillum magnetotacticum MS-1]
          Length = 168

 Score = 78.2 bits (191), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 48/151 (31%), Positives = 79/151 (52%), Gaps = 4/151 (2%)

Query: 16  THGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRI-LKMYRKNKRF-IATFSGIDNIHSA 73
            HG+ G V I S+  +P D+  Y    N+    +  LK+  + K   IAT  G+ +  +A
Sbjct: 5   VHGVRGAVRIKSFTEDPADIGFYSPVENEAGGTKFRLKVTGEVKGLVIATLEGVCDRDAA 64

Query: 74  SELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFGAGSILEI 133
             L+  +L+  R+      L EDEF  TDL  +  +   GK  G V  V ++GAG +L+I
Sbjct: 65  EALKGTELWVARERLP--RLAEDEFLYTDLIGLVAYGVDGKRLGIVKAVADYGAGDVLDI 122

Query: 134 KNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           K   +   ++PFTK +V EV++   ++++ P
Sbjct: 123 KLEPKGDMMVPFTKDSVPEVDIAGARLVVIP 153


>gi|58698384|ref|ZP_00373297.1| 16S rRNA processing protein RimM [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|58535097|gb|EAL59183.1| 16S rRNA processing protein RimM [Wolbachia endosymbiont of
           Drosophila ananassae]
          Length = 168

 Score = 77.8 bits (190), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 50/162 (30%), Positives = 92/162 (56%), Gaps = 5/162 (3%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY--VLYSNDNRELRILKMYRKNKRFIA 62
           D LV +  I + HG+ G V + ++   P +++ Y  ++  ++N ++  + +   N   IA
Sbjct: 3   DNLVCLGIITSPHGIKGAVKVKTFTEKPENISLYGKLISGDENYKIDSVSVIGDN-LVIA 61

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
           T SG+++ + A  LR+ KLY +R     E  +EDEF+ +DL +ME   +  + +G V  V
Sbjct: 62  TISGVNSRNEAELLRNKKLYIERSKLP-ELNDEDEFYQSDLVDMEVRLKSNELYGYVKSV 120

Query: 123 YNFGAGSILEI-KNTMEKTFLIPFTKFAVLEVNLQENKILID 163
           YNFG+G ILE+   + +K  ++ FTK     +N++   I+++
Sbjct: 121 YNFGSGDILEVLVISTKKRIMLSFTKEIFPHINIKGRYIVLN 162


>gi|260574844|ref|ZP_05842846.1| 16S rRNA processing protein RimM [Rhodobacter sp. SW2]
 gi|259022849|gb|EEW26143.1| 16S rRNA processing protein RimM [Rhodobacter sp. SW2]
          Length = 167

 Score = 77.8 bits (190), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 49/159 (30%), Positives = 80/159 (50%), Gaps = 5/159 (3%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKRFI-ATFS 65
           + +  I  + G+ GEV + S+ ++P  +  Y  L++ D      +K+ R     + A  S
Sbjct: 5   ICVGAIAGSFGVKGEVRLKSFCSDPEAIAGYGPLFTEDGTRQFSVKLTRPVAGGLGARLS 64

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNF 125
           G+     A  LR   LY  +      +L +DEF++ DL  ME  D  G   G+V  V+N 
Sbjct: 65  GVATKEEADALRGTSLYVDKTRLP--KLPDDEFYHADLIGMEVRDTGGVLLGRVQAVHNH 122

Query: 126 GAGSILEIKNT-MEKTFLIPFTKFAVLEVNLQENKILID 163
           GAG +LEI    +++  L+PFT   V  V+L   +I++D
Sbjct: 123 GAGDLLEIAGAGLKEPILLPFTLAVVPTVDLVAGRIVVD 161


>gi|90421130|ref|ZP_01229032.1| 16S rRNA processing protein rimM [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90334622|gb|EAS48402.1| 16S rRNA processing protein rimM [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 194

 Score = 77.0 bits (188), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 84/169 (49%), Gaps = 4/169 (2%)

Query: 3   KLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY--VLYSNDNRELRILKMYRKNKRF 60
           KL+  VL+  +G   G+ GE  + S+  +P DL  Y  ++ ++ NR   +     KN   
Sbjct: 6   KLENPVLLGVVGGAQGIKGECRVRSFTADPTDLGAYGPLVDASGNRYTVLSARVAKNV-V 64

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +  F  + + + A  L   KL+  R     E  ++DEF+  DL         G   G V 
Sbjct: 65  VVRFKEVADRNHAERLNGRKLFVDRSVLP-EPADDDEFYLEDLVGYAVETVAGDAVGTVI 123

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
             ++F AG I+EI+ T  +T +IPF++ A+  ++ +   ++++P  AGL
Sbjct: 124 AFHDFNAGDIVEIRPTKGQTLMIPFSEAAIPVIDAERRLMVVEPGPAGL 172


>gi|255655266|ref|ZP_05400675.1| putative 16S rRNA processing protein [Clostridium difficile
           QCD-23m63]
 gi|296451251|ref|ZP_06892991.1| 16S rRNA processing protein RimM [Clostridium difficile NAP08]
 gi|296880397|ref|ZP_06904360.1| 16S rRNA processing protein RimM [Clostridium difficile NAP07]
 gi|296259857|gb|EFH06712.1| 16S rRNA processing protein RimM [Clostridium difficile NAP08]
 gi|296428638|gb|EFH14522.1| 16S rRNA processing protein RimM [Clostridium difficile NAP07]
          Length = 171

 Score = 77.0 bits (188), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 83/164 (50%), Gaps = 5/164 (3%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPI---DLNRYVLYSNDNRELRILKMYRKNKRFIATFSG 66
           +  I  T GL GEV +    ++     +L  + L  + N +L + K+  K    I    G
Sbjct: 10  VGQIVNTQGLKGEVRVYPLTDDIERFDELKDFYLGKDLNNKLSVEKVRYKGSMVIMKIKG 69

Query: 67  IDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFG 126
           ID+I  A +L++  +Y  R+D +  ELEE EFF  D+  +E     GKY G +  V  + 
Sbjct: 70  IDSIEKAEKLKNKFMYVSREDSR--ELEEGEFFIADMIGIEVLTVDGKYVGILEDVLQYS 127

Query: 127 AGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           A  +  +K   +K F+IP  K  V  +++ E K++IDPI   ++
Sbjct: 128 ANDVYVVKGEEDKEFMIPAIKKFVPTIDIDERKMIIDPIKGMID 171


>gi|15604216|ref|NP_220731.1| 16S rRNA-processing protein RimM [Rickettsia prowazekii str. Madrid
           E]
 gi|14423906|sp|Q9ZDI0|RIMM_RICPR RecName: Full=Ribosome maturation factor rimM
 gi|3860908|emb|CAA14808.1| unknown [Rickettsia prowazekii]
 gi|292571956|gb|ADE29871.1| 16S rRNA processing protein RimM [Rickettsia prowazekii Rp22]
          Length = 165

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 47/149 (31%), Positives = 76/149 (51%), Gaps = 5/149 (3%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKR- 59
           M  L  L+L+  I + HG+ G V + S+      +    L +     +RI K+  +N + 
Sbjct: 1   MNSLKNLILIGVIKSCHGIQGHVILKSFTEPSTKILERTLVNESGANIRI-KLISQNAKG 59

Query: 60  -FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
             I TF+ I   + A  L+  K++  R      +LEEDEF+  DL  ++  D+  K  G+
Sbjct: 60  ELICTFNDIATRNEAENLKGYKIFCLRTSLP--KLEEDEFYIADLNHLQILDQSNKEIGK 117

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTK 147
           +  + NFGAG I+EI+   + T L+PF K
Sbjct: 118 IKNILNFGAGDIIEIEFLDKTTELLPFNK 146


>gi|34580601|ref|ZP_00142081.1| 16S rRNA processing protein RimM [Rickettsia sibirica 246]
 gi|28261986|gb|EAA25490.1| 16S rRNA processing protein RimM [Rickettsia sibirica 246]
          Length = 165

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 47/149 (31%), Positives = 78/149 (52%), Gaps = 5/149 (3%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKR- 59
           M  L+KL+L+  I + HG+ G V + S+ +    +    L +     + I K+  +N + 
Sbjct: 1   MNSLEKLILVGVIKSCHGIKGHVMLKSFTDPATKILERNLVNESGANIHI-KLISQNAKG 59

Query: 60  -FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
             I TF+ I   + A  L+  K++  R      ELEEDEF+  DL  +   ++  K  G+
Sbjct: 60  ELICTFNDIATRNEAENLKGYKIFCLRASLP--ELEEDEFYIADLTHLPVLNQDHKEIGK 117

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTK 147
           +  + NFGAG I+EI+ + + T L+PF K
Sbjct: 118 IKNILNFGAGDIIEIEFSDQTTELLPFNK 146


>gi|51473542|ref|YP_067299.1| 16S rRNA-processing protein [Rickettsia typhi str. Wilmington]
 gi|59798673|sp|Q68X25|RIMM_RICTY RecName: Full=Ribosome maturation factor rimM
 gi|51459854|gb|AAU03817.1| 16S rRNA processing protein RimM [Rickettsia typhi str. Wilmington]
          Length = 165

 Score = 76.6 bits (187), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 77/149 (51%), Gaps = 5/149 (3%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKR- 59
           M  L+ L+L+  I + HG+ G V + S+      +    L +    ++RI K+  +N + 
Sbjct: 1   MNSLENLILIGIIKSCHGIQGHVILRSFTEPATKILERNLVNESGADIRI-KLISQNAKG 59

Query: 60  -FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
             I TF+ I   + A  L+  K++  R      ELEEDEF+  DL  +   D+  K  G+
Sbjct: 60  ELICTFNDITTRNEAENLKGYKIFCLRTSLP--ELEEDEFYIADLNHLRILDQYNKEIGK 117

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTK 147
           +  + NFGAG I+EI+   + T L+PF K
Sbjct: 118 IKNILNFGAGDIIEIEFLDKTTKLLPFNK 146


>gi|94495533|ref|ZP_01302113.1| 16S rRNA processing protein [Sphingomonas sp. SKA58]
 gi|94424921|gb|EAT09942.1| 16S rRNA processing protein [Sphingomonas sp. SKA58]
          Length = 159

 Score = 76.3 bits (186), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/159 (28%), Positives = 72/159 (45%), Gaps = 7/159 (4%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIATF 64
           DK V +A +   HG+ GEV +  + + P  L  Y  +    R L +  +       +A F
Sbjct: 3   DKPVTLAVVTGAHGVTGEVRLKLFGDGPDSLKGYGAFMAAGRTLTLKSVRAGPNGAVARF 62

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
           + I +  +A  LR  +L   R       L E E+++ DL ++      G+  G V  V N
Sbjct: 63  AEIGDRGAAEALRGTELTVPRSALP--PLGEGEYYHVDLIDLPCASSTGEALGTVVAVEN 120

Query: 125 FGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
           FGAG I+E++    K F++P        V L +   +ID
Sbjct: 121 FGAGDIVEVQRASGKRFMVPMHA-----VTLGDGGAVID 154


>gi|255262386|ref|ZP_05341728.1| 16S rRNA processing protein RimM [Thalassiobium sp. R2A62]
 gi|255104721|gb|EET47395.1| 16S rRNA processing protein RimM [Thalassiobium sp. R2A62]
          Length = 168

 Score = 76.3 bits (186), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 51/160 (31%), Positives = 80/160 (50%), Gaps = 5/160 (3%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYV-LYSNDNRELRILKMYRKNKR-FIATFS 65
           + + T+G + G+ GEV + S+  +P D+  Y  L + D      L +  + K  F A   
Sbjct: 5   ITIGTLGGSFGVKGEVRLKSFCADPQDIEAYSPLTTPDGVAFDGLTLTGRLKNGFSARLL 64

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNF 125
           G++    A  LR  +L   R    +  L +DE++ TDL  +E  D  G   G V  V N 
Sbjct: 65  GVETKEQADALRGTELQVDRDAMPN--LPDDEYYYTDLMGLEVRDTGGTVLGTVKSVQNH 122

Query: 126 GAGSILEI-KNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           GA  +LE+  +T  +T L+PFT  +V  V+L   +I+ DP
Sbjct: 123 GATDLLEVLPSTGGETILLPFTMTSVPTVDLTAGRIIADP 162


>gi|170750014|ref|YP_001756274.1| 16S rRNA processing protein RimM [Methylobacterium radiotolerans
           JCM 2831]
 gi|209573582|sp|B1LVU1|RIMM_METRJ RecName: Full=Ribosome maturation factor rimM
 gi|170656536|gb|ACB25591.1| 16S rRNA processing protein RimM [Methylobacterium radiotolerans
           JCM 2831]
          Length = 231

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/162 (28%), Positives = 74/162 (45%), Gaps = 7/162 (4%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKR----FI 61
           LVL+   G  HGL GEV + SY  +P  +  Y  L ++D R L +  +           I
Sbjct: 52  LVLLGEFGRAHGLTGEVRLKSYTGDPQAIAGYGALQTSDGRTLALADVRPAPGSSPDMLI 111

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
           A   G+    +A  L  + L+  R      E ++DE +  DL      D  G   G +  
Sbjct: 112 ARVKGVSGRSAAEALNRVALFVPRDRLAAPE-DDDEVYAADLIGAAAVDEAGTLVGTIVA 170

Query: 122 VYNFGAGSILEIKNT-MEKTFLIPFTKFAVLEVNLQENKILI 162
           V N+G G +LE++      T L+PFTK  V  +++ + ++ +
Sbjct: 171 VPNYGGGDLLELRPPNGGATALLPFTKAFVPVLDVAQRRVTV 212


>gi|87199427|ref|YP_496684.1| 16S rRNA processing protein RimM [Novosphingobium aromaticivorans
           DSM 12444]
 gi|109893028|sp|Q2G8H3|RIMM_NOVAD RecName: Full=Ribosome maturation factor rimM
 gi|87135108|gb|ABD25850.1| 16S rRNA processing protein RimM [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 166

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 48/162 (29%), Positives = 80/162 (49%), Gaps = 7/162 (4%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY--SNDNRELRILKMYRKNKR-FI 61
           D+ V +A I   HG+ GEV +  +      L RY  +  S D   L ++K+    K   I
Sbjct: 3   DRPVTLAAITGAHGVAGEVRLKLFGEGVAALKRYRAFNDSGDGSGLTVVKIKDDGKGGAI 62

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
           A F+ + +  +A +LR   L  +R +     L E E+++ DL  +     +G+  G+   
Sbjct: 63  ARFAEVPDRTAAEKLRGTALTVRRSELPS--LPEGEYYHADLIGLPAVSTEGEMLGECIA 120

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
           V NFGAG ++EI+    K F++P    AV E    + +I+I+
Sbjct: 121 VENFGAGDVIEIRKADGKKFMVPMKTEAVPE--WTDERIVIE 160


>gi|148261143|ref|YP_001235270.1| 16S rRNA processing protein RimM [Acidiphilium cryptum JF-5]
 gi|326404544|ref|YP_004284626.1| ribosome maturation factor RimM [Acidiphilium multivorum AIU301]
 gi|172047775|sp|A5G0G9|RIMM_ACICJ RecName: Full=Ribosome maturation factor rimM
 gi|146402824|gb|ABQ31351.1| 16S rRNA processing protein RimM [Acidiphilium cryptum JF-5]
 gi|325051406|dbj|BAJ81744.1| ribosome maturation factor RimM [Acidiphilium multivorum AIU301]
          Length = 169

 Score = 75.9 bits (185), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 87/176 (49%), Gaps = 30/176 (17%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIATF 64
           D+L+LM  IG  HG+ G V++ +Y+ +P  L    L   D R  R+   +        T 
Sbjct: 3   DRLILMGVIGRPHGVRGAVHVTTYSPDPEGLAELPL--RDERGRRVGLAW--------TG 52

Query: 65  SGIDNI--------------HSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFD 110
           +GI  +               +A++L +L+LY +R D    E +EDEF+  DL  +    
Sbjct: 53  AGIARVTIGEGDEAAAIADRDAAAKLTNLRLYVRRADLPPPE-DEDEFYFADLIGLHAVG 111

Query: 111 RQGKYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENK-ILIDPI 165
             G   G +  V++FGAG+ +E+ +      L+PFT+  V E++L   + +++ P+
Sbjct: 112 PDGAALGTIRAVHDFGAGASIELSDGS----LLPFTRAVVPEIDLPGGRAVVVRPV 163


>gi|288957358|ref|YP_003447699.1| 16S rRNA processing protein [Azospirillum sp. B510]
 gi|288909666|dbj|BAI71155.1| 16S rRNA processing protein [Azospirillum sp. B510]
          Length = 192

 Score = 75.5 bits (184), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 43/160 (26%), Positives = 79/160 (49%), Gaps = 7/160 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELR----ILKMYRKNKRFIAT 63
           + +     +HG+ G V + S+   P D+  Y   S++    R    +  M + N  F+A 
Sbjct: 5   ICVGQFAGSHGVRGLVKLRSFTAEPADIATYGPLSDEAGARRFTLTLQGMVKDN--FLAK 62

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
             G+ +   A  L  ++L+  R      E +EDEF++ DL  +      G  +G V  +Y
Sbjct: 63  VDGVTSREQAQALAGVRLHVDRDALPATE-DEDEFYHADLIGLRAELADGSLYGTVKAIY 121

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
           +FGAG +LE++       ++PF+K  V  V+++  +I++D
Sbjct: 122 DFGAGDVLEVRTAGGPLEMLPFSKACVPVVDVRGGRIVVD 161


>gi|58584390|ref|YP_197963.1| RimM protein, required for 16S rRNA processing [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
 gi|67461242|sp|Q5GTF3|RIMM_WOLTR RecName: Full=Ribosome maturation factor rimM
 gi|58418706|gb|AAW70721.1| RimM protein, required for 16S rRNA processing [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
          Length = 168

 Score = 75.5 bits (184), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 50/162 (30%), Positives = 89/162 (54%), Gaps = 5/162 (3%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY--VLYSNDNRELRILKMYRKNKRFIA 62
           D LV M  I + HG+ G V +  +   P +++ Y  ++  + N ++  + +  +N   IA
Sbjct: 3   DNLVCMGIITSPHGIKGAVKVKIFTEKPENISLYGKLISGSKNYDIDSVSVIGEN-LVIA 61

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
           T +G+++ + A  LR+ KLY +R        +E+EF+ +DL  ME      + +G +  +
Sbjct: 62  TINGVNSRNEAEFLRNKKLYVERNKLLKLN-DENEFYQSDLVNMEIRLENDELYGYIKSI 120

Query: 123 YNFGAGSILEIKN-TMEKTFLIPFTKFAVLEVNLQENKILID 163
           YNFG+G ILEI   + +K  ++PFTK     VN++E  I ++
Sbjct: 121 YNFGSGDILEISVISTKKNIMLPFTKEIFPYVNIKERYITLN 162


>gi|330994000|ref|ZP_08317930.1| Ribosome maturation factor rimM [Gluconacetobacter sp. SXCC-1]
 gi|329758946|gb|EGG75460.1| Ribosome maturation factor rimM [Gluconacetobacter sp. SXCC-1]
          Length = 183

 Score = 75.1 bits (183), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 55/159 (34%), Positives = 80/159 (50%), Gaps = 8/159 (5%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKRFI-ATFS 65
           VLM  +G  HG+ G V++ SY   P DL  Y  L  +  R  R+        R   A   
Sbjct: 6   VLMGVVGRPHGVRGLVHVHSYTAVPEDLATYDGLVDDQGRPWRLSWHGTGIARLHDAAGQ 65

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQG--KYWGQVCGVY 123
            ID+  +A +L + KLY  R        +EDEF+  DL  +E  + QG  +  G+V  V+
Sbjct: 66  AIDSREAARQLVNRKLYVPRASLPAP--DEDEFYFADLVGLEARE-QGTDRVLGRVGAVH 122

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
           ++GAG+ LEI N    + L+PFT+  V  VN++   I I
Sbjct: 123 DYGAGTSLEI-NGAGGSLLLPFTRACVPVVNVRGGWIDI 160


>gi|15892396|ref|NP_360110.1| 16S rRNA-processing protein [Rickettsia conorii str. Malish 7]
 gi|20139550|sp|Q92IE7|RIMM_RICCN RecName: Full=Ribosome maturation factor rimM
 gi|15619547|gb|AAL03011.1| 16S rRNA processing protein RimM [Rickettsia conorii str. Malish 7]
          Length = 165

 Score = 75.1 bits (183), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 46/149 (30%), Positives = 77/149 (51%), Gaps = 5/149 (3%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKR- 59
           M  L+ L+L+  I + HG+ G V + S+ +    +    L +     + I K+  +N + 
Sbjct: 1   MNSLENLILVGVIKSCHGIKGHVMLKSFTDPATKILERNLVNESGANIHI-KLISQNAKG 59

Query: 60  -FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
             I TF+ I   + A  L+  K++  R      ELEEDEF+  DL  +   ++  K  G+
Sbjct: 60  ELICTFNDIATRNEAENLKGYKIFCLRASLP--ELEEDEFYIADLTHLPVLNQDHKEIGK 117

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTK 147
           +  + NFGAG I+EI+ + + T L+PF K
Sbjct: 118 IKNILNFGAGDIIEIEFSNQTTELLPFNK 146


>gi|157828347|ref|YP_001494589.1| 16S rRNA-processing protein RimM [Rickettsia rickettsii str.
           'Sheila Smith']
 gi|166226475|sp|A8GRQ6|RIMM_RICRS RecName: Full=Ribosome maturation factor rimM
 gi|157800828|gb|ABV76081.1| 16S rRNA-processing protein [Rickettsia rickettsii str. 'Sheila
           Smith']
          Length = 165

 Score = 75.1 bits (183), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 46/149 (30%), Positives = 77/149 (51%), Gaps = 5/149 (3%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKR- 59
           M  L+ L+L+  I + HG+ G V + S+ +    +    L +     + I K+  +N + 
Sbjct: 1   MNSLENLILVGVIKSCHGIKGHVMLKSFTDPATKILERNLVNESGANIHI-KLISQNAKG 59

Query: 60  -FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
             I TF+ I   + A  L+  K++  R      ELEEDEF+  DL  +   ++  K  G+
Sbjct: 60  ELICTFNDIATRNEAEHLKGYKIFCLRASLP--ELEEDEFYIADLTHLPVLNQDHKEIGK 117

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTK 147
           +  + NFGAG I+EI+ + + T L+PF K
Sbjct: 118 IKNILNFGAGDIIEIEFSDQTTELLPFNK 146


>gi|83592522|ref|YP_426274.1| 16S rRNA processing protein RimM [Rhodospirillum rubrum ATCC 11170]
 gi|109893043|sp|Q2RV58|RIMM_RHORT RecName: Full=Ribosome maturation factor rimM
 gi|83575436|gb|ABC21987.1| 16S rRNA processing protein RimM [Rhodospirillum rubrum ATCC 11170]
          Length = 201

 Score = 75.1 bits (183), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 46/168 (27%), Positives = 83/168 (49%), Gaps = 3/168 (1%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKR--FIATFS 65
           +L+  I  +HG+ G V + S+  + + L  Y   S++    R     R   +   I    
Sbjct: 5   LLVGVIVGSHGVRGLVRVKSFTQDEMALCDYGPLSDETGTRRFAVEVRNQAKGVVICQIP 64

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNF 125
           G+ +  +A  L+  +L+  R     + LEEDE+++ DL  +      G   G V  V++F
Sbjct: 65  GVSDRTAADALKGTRLFLDRAALPADALEEDEYYHADLIGLPVDLVDGGRLGVVHSVHDF 124

Query: 126 GAGSILEIKNTM-EKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNT 172
           GAG +LE+      ++ L+PFTK  V  V+++  +++ DP    L++T
Sbjct: 125 GAGDMLEVTLAQGRRSVLLPFTKAVVPLVDVKAGRLVADPPLGLLDDT 172


>gi|329114610|ref|ZP_08243369.1| Ribosome maturation factor RimM [Acetobacter pomorum DM001]
 gi|326696090|gb|EGE47772.1| Ribosome maturation factor RimM [Acetobacter pomorum DM001]
          Length = 180

 Score = 75.1 bits (183), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 50/173 (28%), Positives = 85/173 (49%), Gaps = 38/173 (21%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIATFSG 66
           L+LM  +G  HG+ G V + +YA NP  L +     +D           + +++  ++ G
Sbjct: 5   LILMGVVGKPHGVRGLVRVRAYAENPQTLEQSGALQDD-----------QGRKWFLSWRG 53

Query: 67  IDNIHSASELRDL-----------------KLYAKRQDFKDEELEEDEFFNTDLEEMETF 109
            D++   +ELRD                  +LY  R      E EE+EF++ DL  ME F
Sbjct: 54  ADSV---AELRDANGTPLADRDAAQALVNTRLYVPRTALP--EPEEEEFYHADLIGMEAF 108

Query: 110 DRQGKYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
           +  G   G+V  V+++GAG+ LE+ +      L+PFT+  V +V+L++  I +
Sbjct: 109 E-NGLSLGRVVMVHDYGAGASLELSDGS----LVPFTQACVPQVHLEQRTITV 156


>gi|229586614|ref|YP_002845115.1| 16S rRNA-processing protein RimM [Rickettsia africae ESF-5]
 gi|228021664|gb|ACP53372.1| 16S rRNA processing protein RimM [Rickettsia africae ESF-5]
          Length = 165

 Score = 74.7 bits (182), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 46/149 (30%), Positives = 77/149 (51%), Gaps = 5/149 (3%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKR- 59
           M  L+ L+L+  I + HG+ G V + S+ +    +    L +     + I K+  +N + 
Sbjct: 1   MNSLENLILVGVIKSCHGIKGHVMLKSFTDPATKILERNLVNESGANIHI-KLISQNAKG 59

Query: 60  -FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
             I TF+ I   + A  L+  K++  R      ELEEDEF+  DL  +   ++  K  G+
Sbjct: 60  ELICTFNDIATRNEAENLKGYKIFCLRASLP--ELEEDEFYIADLTHLPVLNQDHKEIGK 117

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTK 147
           +  + NFGAG I+EI+ + + T L+PF K
Sbjct: 118 IKNILNFGAGDIIEIEFSDQTTELLPFNK 146


>gi|103488203|ref|YP_617764.1| 16S rRNA processing protein RimM [Sphingopyxis alaskensis RB2256]
 gi|123252941|sp|Q1GPJ1|RIMM_SPHAL RecName: Full=Ribosome maturation factor rimM
 gi|98978280|gb|ABF54431.1| 16S rRNA processing protein RimM [Sphingopyxis alaskensis RB2256]
          Length = 163

 Score = 74.7 bits (182), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 68/146 (46%), Gaps = 2/146 (1%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIATF 64
           D+ V +A I   HG+ GEV +  +      L  + ++   +R+L +  +   N+  +A F
Sbjct: 4   DRPVTLAAIAGAHGVRGEVRLKLFGEGAETLRAFSVFDAGDRKLTLKSVRPANQGAVAAF 63

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
             I +  +A  LR   L   R       L   E+++ DL  +     +G   G V  V N
Sbjct: 64  VEIADRSAAEALRGTLLTVPRSALP--PLGPGEYYHHDLIGLPCVSTEGAPVGHVAAVDN 121

Query: 125 FGAGSILEIKNTMEKTFLIPFTKFAV 150
           FGAG ILEI+    K F++P T  AV
Sbjct: 122 FGAGDILEIEKPDGKRFMVPMTVTAV 147


>gi|157803912|ref|YP_001492461.1| 16S rRNA-processing protein RimM [Rickettsia canadensis str.
           McKiel]
 gi|166226474|sp|A8EZ93|RIMM_RICCK RecName: Full=Ribosome maturation factor rimM
 gi|157785175|gb|ABV73676.1| 16S rRNA-processing protein [Rickettsia canadensis str. McKiel]
          Length = 165

 Score = 74.3 bits (181), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 80/158 (50%), Gaps = 7/158 (4%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYA--NNPIDLNRYVLYSNDNRELRILKMYRKNK 58
           M  L+ L+L+  I + HG+ G + + S+      I     V  S +N  ++++    K +
Sbjct: 1   MNSLENLILVGVIKSCHGIKGHIILKSFTIPTTKILERNLVNESQENINIKLISQNAKGE 60

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
             I TF+ I   + A  L+  KL+  R      ELEEDEF+  DL  +   D+  K  G+
Sbjct: 61  -LICTFNDISTRNEAENLKGYKLFCLRASLP--ELEEDEFYIADLNHLTILDQDHKKVGK 117

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTK--FAVLEVN 154
           +  + NFGAG I+EI+   + T L+PF K  F V+  N
Sbjct: 118 IKNILNFGAGDIIEIEFLDQTTELLPFNKQFFPVITKN 155


>gi|190571183|ref|YP_001975541.1| 16S rRNA processing protein RimM [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|213018585|ref|ZP_03334393.1| 16S rRNA processing protein RimM [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|209573628|sp|B3CLX1|RIMM_WOLPP RecName: Full=Ribosome maturation factor rimM
 gi|190357455|emb|CAQ54889.1| 16S rRNA processing protein RimM [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|212995536|gb|EEB56176.1| 16S rRNA processing protein RimM [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 166

 Score = 74.3 bits (181), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 49/159 (30%), Positives = 87/159 (54%), Gaps = 5/159 (3%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY--VLYSNDNRELRILKMYRKNKRFIATFS 65
           + +  I + HG+ G V I ++   P ++  Y  ++  ++N ++ ++ +   N   IAT S
Sbjct: 3   ICLGIITSPHGIKGAVKIKTFTEKPENIFLYGELISGSENYKISLVSVV-SNNLVIATIS 61

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNF 125
           G+++ + A  LR+ KLY +R        +EDEF+  DL  ME      + +G V  V+NF
Sbjct: 62  GVNSRNEAELLRNKKLYIERNKLPQLN-DEDEFYQNDLVNMEVRLESNELYGYVKSVHNF 120

Query: 126 GAGSILEI-KNTMEKTFLIPFTKFAVLEVNLQENKILID 163
           G+G ILEI   + +K  ++ FTK     +N++E  I+I+
Sbjct: 121 GSGDILEILVISTKKNIMLSFTKEIFPYINMKERYIVIN 159


>gi|239947509|ref|ZP_04699262.1| 16S rRNA processing protein RimM [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239921785|gb|EER21809.1| 16S rRNA processing protein RimM [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 165

 Score = 74.3 bits (181), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 46/149 (30%), Positives = 76/149 (51%), Gaps = 5/149 (3%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKR- 59
           M  L+ L+L+  I + HG+ G V + S+ +    +    L +     + I K+  +N + 
Sbjct: 1   MNSLENLILVGVIKSCHGIKGHVILKSFTDPATKILERNLVNESGENIHI-KLISQNAKG 59

Query: 60  -FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
             I TF+ I   + A  L+  K++  R      ELEEDEF+  DL  +   D+  K  G+
Sbjct: 60  ELICTFNDIATRNEAENLKGYKIFCLRASLP--ELEEDEFYIADLNHLPILDQDHKEIGK 117

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTK 147
           +  + NFGA  I+EI+ + + T L+PF K
Sbjct: 118 IKNILNFGASDIIEIEFSDQTTELLPFNK 146


>gi|254419610|ref|ZP_05033334.1| 16S rRNA processing protein RimM [Brevundimonas sp. BAL3]
 gi|196185787|gb|EDX80763.1| 16S rRNA processing protein RimM [Brevundimonas sp. BAL3]
          Length = 184

 Score = 74.3 bits (181), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 71/147 (48%), Gaps = 5/147 (3%)

Query: 18  GLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKR-FIATFSGIDNIHSASE 75
           G+ GEV + ++  +P+ L  Y  L   D      L   R +K   +     I     A  
Sbjct: 22  GVRGEVRVTAFTADPLALTAYGPLLRADGTVALTLSATRPDKSGVVGRAKEIATKEQADA 81

Query: 76  LRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFGAGSILEI-K 134
           LR LKLY  R  F   E +EDEF+  DL  +E  D  G+  G V  V NFGA  +LEI  
Sbjct: 82  LRGLKLYVPRDRFP--EPDEDEFYLADLLGVEVRDTAGEVMGTVKSVQNFGADDMLEIAP 139

Query: 135 NTMEKTFLIPFTKFAVLEVNLQENKIL 161
            T   T+ +PFTK A  E++L +  +L
Sbjct: 140 ATGGPTWYLPFTKAATPELHLADGWLL 166


>gi|154251873|ref|YP_001412697.1| 16S rRNA-processing protein RimM [Parvibaculum lavamentivorans
           DS-1]
 gi|171769584|sp|A7HT07|RIMM_PARL1 RecName: Full=Ribosome maturation factor rimM
 gi|154155823|gb|ABS63040.1| 16S rRNA processing protein RimM [Parvibaculum lavamentivorans
           DS-1]
          Length = 188

 Score = 73.9 bits (180), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 78/166 (46%), Gaps = 3/166 (1%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKRF-IA 62
           DK V +  +   HG+ G V +  Y   P  +  Y  + + D      + +    K   I 
Sbjct: 11  DKKVCLGVVTGAHGVRGLVRVKPYTEMPEGVAAYGPVETKDGATSFAISLKGMAKDLVIC 70

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
              G+D+   A+ LR  +LY  R+       +E+ ++  DL  +      G+ +G++ GV
Sbjct: 71  KLEGVDDRDVAAALRGTELYVPRERLPRASGDEEGWYYADLIGLRAVGLDGRDYGRIAGV 130

Query: 123 YNFGAGSILEIKNT-MEKTFLIPFTKFAVLEVNLQENKILIDPIAA 167
            NFGAG +LEI      +T L+ FT   V EV++   +++IDP A 
Sbjct: 131 ENFGAGDLLEIAPAEGGQTVLMGFTDENVPEVDIAGGRVVIDPPAG 176


>gi|165933056|ref|YP_001649845.1| 16S rRNA-processing protein RimM [Rickettsia rickettsii str. Iowa]
 gi|189040849|sp|B0BX63|RIMM_RICRO RecName: Full=Ribosome maturation factor rimM
 gi|165908143|gb|ABY72439.1| 16S rRNA processing protein [Rickettsia rickettsii str. Iowa]
          Length = 165

 Score = 73.9 bits (180), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/149 (30%), Positives = 77/149 (51%), Gaps = 5/149 (3%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKR- 59
           M  L+ L+L+  I + HG+ G V + S+ +    +    L +     + I K+  +N + 
Sbjct: 1   MNSLENLILVGVIKSCHGIKGHVMLKSFTDPATKILERNLVNESGANIYI-KLISQNAKG 59

Query: 60  -FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
             I TF+ I   + A  L+  K++  R      ELEEDEF+  DL  +   ++  K  G+
Sbjct: 60  ELICTFNDIATRNEAEHLKGYKIFCLRASLP--ELEEDEFYIADLTHLPVLNQDHKEIGK 117

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTK 147
           +  + NFGAG I+EI+ + + T L+PF K
Sbjct: 118 IKNILNFGAGDIIEIEFSDQTTELLPFNK 146


>gi|303257145|ref|ZP_07343159.1| 16S rRNA processing protein RimM [Burkholderiales bacterium 1_1_47]
 gi|302860636|gb|EFL83713.1| 16S rRNA processing protein RimM [Burkholderiales bacterium 1_1_47]
          Length = 174

 Score = 73.6 bits (179), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 81/161 (50%), Gaps = 9/161 (5%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLN----RYVLYSNDNRELRILKMYRKNKRFIAT 63
           +++  +   +GL G V +  +      L     ++VL   + R + + K        +A 
Sbjct: 12  IVLGALHGAYGLKGWVRVQPFQGTSALLGSKHWQHVLPDGEVRPVELEKAKLHGAGIVAK 71

Query: 64  FSGIDNIHSASELRD-LKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
           F GID    A+ LR  + LY  R+DF   E EE+E++  DL   E  +++G+  GQV G+
Sbjct: 72  FQGIDTPEDAAALRGAVALY--RKDFP--EAEENEYYWVDLIGCEVVNKEGQSIGQVKGM 127

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
            + G   IL +K    K  LIPF +  + EVN++  KI++D
Sbjct: 128 IDNGVHDILNVKRADGKEVLIPFVEDYLAEVNVEAKKIVVD 168


>gi|307294707|ref|ZP_07574549.1| 16S rRNA processing protein RimM [Sphingobium chlorophenolicum L-1]
 gi|306879181|gb|EFN10399.1| 16S rRNA processing protein RimM [Sphingobium chlorophenolicum L-1]
          Length = 159

 Score = 73.6 bits (179), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 68/148 (45%), Gaps = 2/148 (1%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIATF 64
           DK V +A I   HG+ GEV +  +      L  Y  +    R L +  +       +A F
Sbjct: 3   DKPVTLAVIIGAHGVAGEVRLKLFGEGAETLKSYGGFDAGGRTLTLRSVRPGPNGAVARF 62

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
           + + +  +A  LR  +L   R       L E E+++ DL ++  F  +G+  G V  V N
Sbjct: 63  AEVGDRTAAEGLRGTELTVPRSALP--ALGEGEYYHADLIDLPCFSSEGEGLGHVVAVEN 120

Query: 125 FGAGSILEIKNTMEKTFLIPFTKFAVLE 152
           FGAG I+E++    K F++P     V E
Sbjct: 121 FGAGDIIEVERPNGKRFMVPMHAVTVAE 148


>gi|67458947|ref|YP_246571.1| 16S rRNA-processing protein [Rickettsia felis URRWXCal2]
 gi|75536615|sp|Q4UM17|RIMM_RICFE RecName: Full=Ribosome maturation factor rimM
 gi|67004480|gb|AAY61406.1| 16S rRNA processing protein RimM [Rickettsia felis URRWXCal2]
          Length = 165

 Score = 73.2 bits (178), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/149 (30%), Positives = 76/149 (51%), Gaps = 5/149 (3%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKR- 59
           M  L+ L+L+  I + HG+ G V + S+      +    L +    ++ I K+  +N + 
Sbjct: 1   MNSLENLILVGVIKSCHGIKGHVILKSFTEPATKILERNLVNESGEDIHI-KLISQNTKG 59

Query: 60  -FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
             I TF+ I   + A  L+  KL+  R      +LEEDEF+  DL  +   ++  K  G+
Sbjct: 60  ELICTFNDIATRNEAENLKGYKLFCLRASLP--KLEEDEFYIADLNHLPVLNQDHKEIGK 117

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTK 147
           +  + NFGAG I+EI+   + T L+PF K
Sbjct: 118 IKNILNFGAGDIIEIEFLDQTTELLPFNK 146


>gi|237746850|ref|ZP_04577330.1| ribosome maturation factor rimM [Oxalobacter formigenes HOxBLS]
 gi|229378201|gb|EEO28292.1| ribosome maturation factor rimM [Oxalobacter formigenes HOxBLS]
          Length = 179

 Score = 73.2 bits (178), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 85/164 (51%), Gaps = 9/164 (5%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNP---IDLNRYVLYSNDNRELRILKMYRKNKRFIAT 63
           LV +  +G  +G+ G V I  Y+      + +  + L S+ +RE+++L+   +    +A 
Sbjct: 13  LVEVGHVGGAYGIRGWVRIKPYSAGAEALLAVKEWWLDSSGSREVKVLQARWQGADVVAC 72

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
            +G+ +  +A  LR   +   R+ F   +  E E++  DL  +  F+RQG   G V G+ 
Sbjct: 73  LAGVSDRDAAEALRGAVVRISRRHFPAPD--EGEYYWVDLIGLAVFNRQGDCLGTVKGLM 130

Query: 124 NFGAGSILEIKNTM----EKTFLIPFTKFAVLEVNLQENKILID 163
           + GA  +L+I+  M    ++  LIPF +  V +++++  K+ +D
Sbjct: 131 DNGAHPVLQIETGMPEDKKRELLIPFVERHVGKIDIENRKMTVD 174


>gi|88606853|ref|YP_505787.1| 16S rRNA processing protein RimM [Anaplasma phagocytophilum HZ]
 gi|109892998|sp|Q2GIL4|RIMM_ANAPZ RecName: Full=Ribosome maturation factor rimM
 gi|88597916|gb|ABD43386.1| 16S rRNA processing protein RimM [Anaplasma phagocytophilum HZ]
          Length = 171

 Score = 73.2 bits (178), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 79/161 (49%), Gaps = 3/161 (1%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKM-YRKNKRFIAT 63
           D  +L+  I   HG+ G V I ++ ++P D+  Y   ++ +  L++  M   KN   IA 
Sbjct: 5   DTFILLGVIYAAHGVRGCVKIKTFTHDPSDIAAYGPLTDGSESLKVSVMSVIKNGCVIAK 64

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
            SGID+  SA  L++ KLY         +L+ DEF+  +L  +         +G V  V+
Sbjct: 65  ISGIDDRCSAEALKNKKLYVSSSCL--PKLKNDEFYKDELIGLSVKLPDDTIFGIVTEVF 122

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           NFG+G I+EI     K  +  FT      ++++  ++ I P
Sbjct: 123 NFGSGDIVEISTPQGKKEMFSFTSNIFPSIDMKTREMTIVP 163


>gi|238651045|ref|YP_002916902.1| 16S rRNA-processing protein [Rickettsia peacockii str. Rustic]
 gi|238625143|gb|ACR47849.1| 16S rRNA-processing protein [Rickettsia peacockii str. Rustic]
          Length = 165

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 76/149 (51%), Gaps = 5/149 (3%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKR- 59
           M  L+ L+L+  I + HG+ G V + S+ +    +    L +     + I K+  +N + 
Sbjct: 1   MNSLENLILVGVIKSCHGIKGHVMLKSFTDPATKILERNLVNESGANIHI-KLISQNAKG 59

Query: 60  -FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
             I TF+ I   + A  L+  K++  R      ELEEDEF+  DL  +   ++  K  G+
Sbjct: 60  ELICTFNDIATRNEAEHLKGYKIFCLRASLP--ELEEDEFYIADLTHLPVLNQDHKEIGK 117

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTK 147
           +  + NFGA  I+EI+ + + T L+PF K
Sbjct: 118 IKNILNFGASDIIEIEFSDQTTELLPFNK 146


>gi|91205583|ref|YP_537938.1| 16S rRNA-processing protein [Rickettsia bellii RML369-C]
 gi|109893045|sp|Q1RIG5|RIMM_RICBR RecName: Full=Ribosome maturation factor rimM
 gi|91069127|gb|ABE04849.1| 16S rRNA processing protein RimM [Rickettsia bellii RML369-C]
          Length = 166

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 43/149 (28%), Positives = 77/149 (51%), Gaps = 5/149 (3%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKR- 59
           M  L+ L+L+  I + HG+ G + + S+ +  + +    L +    ++ I  + ++N + 
Sbjct: 1   MDSLENLILVGVIKSCHGIKGHIILRSFTDPTVKITERELVNESGEKVNI-NLIKQNSKG 59

Query: 60  -FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
             I  F+ I   + A+ L+  KL+  R      +LEEDEF+ TDL  +   D      G+
Sbjct: 60  ELICQFNDISTRNEAANLKGYKLFCLRSSLP--KLEEDEFYITDLNNLPILDNNHTEIGK 117

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTK 147
           +  + NFGAG I+E++   + T L+PF K
Sbjct: 118 IKNILNFGAGDIIEVEFLDKTTELLPFNK 146


>gi|331000897|ref|ZP_08324534.1| 16S rRNA processing protein RimM [Parasutterella excrementihominis
           YIT 11859]
 gi|329569856|gb|EGG51613.1| 16S rRNA processing protein RimM [Parasutterella excrementihominis
           YIT 11859]
          Length = 174

 Score = 72.0 bits (175), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 48/161 (29%), Positives = 81/161 (50%), Gaps = 9/161 (5%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLN----RYVLYSNDNRELRILKMYRKNKRFIAT 63
           +++  +   +GL G V +  +      L     ++VL   + R + + K        +A 
Sbjct: 12  IVLGALHGAYGLKGWVRVQPFQGTSALLGSKHWQHVLPDGEVRPVELEKAKLHGAGIVAK 71

Query: 64  FSGIDNIHSASELRD-LKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
           F GID    A+ LR  + LY  R+DF   E EE+E++  DL   +  +++G+  GQV G+
Sbjct: 72  FQGIDTPEDAAALRGAVALY--RKDFP--EAEENEYYWVDLIGCDVVNKEGQSIGQVKGM 127

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
            + G   IL +K    K  LIPF +  + EVN++  KI++D
Sbjct: 128 IDNGVHDILNVKRADGKEVLIPFVEDYLAEVNVEAKKIVVD 168


>gi|258423920|ref|ZP_05686805.1| 16S rRNA processing protein RimM [Staphylococcus aureus A9635]
 gi|257845949|gb|EEV69978.1| 16S rRNA processing protein RimM [Staphylococcus aureus A9635]
          Length = 167

 Score = 72.0 bits (175), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 90/168 (53%), Gaps = 8/168 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDS---YANNPIDLNRYVLYSNDNRELR-ILKMYRKNKRF-IA 62
           V +  I  THG+ GE+ + S   + +      + +   ++N +L+  +K +R +K   + 
Sbjct: 3   VEVGQIVNTHGIKGEIKVKSNSDFTDVRFQPGQVLTVVHNNNDLKYTVKSHRVHKGLHML 62

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
           TF GI+NI+    L+   +Y +R D +D  LEE+EF+ +D+     FD Q    G+V  +
Sbjct: 63  TFEGINNINDIEHLKGSSIYQER-DHEDIVLEENEFYYSDIIGCTVFDDQETPIGRVINI 121

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           +  GA  +  IK +  K +LIP+    V EV+++  KI+I P+   L+
Sbjct: 122 FETGANDVWVIKGS--KEYLIPYIADVVKEVDVENKKIIITPMEGLLD 167


>gi|88194946|ref|YP_499746.1| 16S rRNA-processing protein RimM [Staphylococcus aureus subsp.
           aureus NCTC 8325]
 gi|122539706|sp|Q2FZ44|RIMM_STAA8 RecName: Full=Ribosome maturation factor rimM
 gi|87202504|gb|ABD30314.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           NCTC 8325]
          Length = 167

 Score = 71.6 bits (174), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 54/171 (31%), Positives = 92/171 (53%), Gaps = 14/171 (8%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY-------VLYSNDNRELRILKMYRKNKRF 60
           V +  I  THG+ GE+ + S  N+     R+       V+++N++ E  + K +R +K  
Sbjct: 3   VEVGQIVNTHGIKGEIKVKS--NSDFTDVRFQPGQVLTVVHNNNDLEYTV-KSHRVHKGL 59

Query: 61  -IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            + TF GI+NI+    L+   +Y +R D +D  LEE+EF+ +D+     FD Q    G+V
Sbjct: 60  HMLTFEGINNINDIEHLKGSSIYQER-DHEDIVLEENEFYYSDIIGCAVFDDQKTPIGRV 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
             ++  GA  +  IK +  K +LIP+    V EV+++  KI+I P+   L+
Sbjct: 119 INIFETGANDVWVIKGS--KEYLIPYIADVVKEVDVENKKIIITPMEGLLD 167


>gi|157827297|ref|YP_001496361.1| 16S rRNA-processing protein RimM [Rickettsia bellii OSU 85-389]
 gi|157802601|gb|ABV79324.1| 16S rRNA-processing protein [Rickettsia bellii OSU 85-389]
          Length = 166

 Score = 71.6 bits (174), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 43/149 (28%), Positives = 76/149 (51%), Gaps = 5/149 (3%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKR- 59
           M  L+ L+L+  I + HG+ G + + S+ +  + +    L +    ++ I  + ++N + 
Sbjct: 1   MDSLENLILVGVIKSCHGIKGHIILRSFTDPTVKITERELVNESGEKVNI-NLIKQNSKG 59

Query: 60  -FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
             I  F+ I   + A  L+  KL+  R      +LEEDEF+ TDL  +   D      G+
Sbjct: 60  ELICQFNDISTRNEAENLKGYKLFCLRSSLP--KLEEDEFYITDLNNLPILDNNHTEIGK 117

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTK 147
           +  + NFGAG I+E++   + T L+PF K
Sbjct: 118 IKNILNFGAGDIIEVEFLDKTTELLPFNK 146


>gi|157964428|ref|YP_001499252.1| 16S rRNA-processing protein RimM [Rickettsia massiliae MTU5]
 gi|166985969|sp|A8F1B9|RIMM_RICM5 RecName: Full=Ribosome maturation factor rimM
 gi|157844204|gb|ABV84705.1| 16S rRNA processing protein RimM [Rickettsia massiliae MTU5]
          Length = 165

 Score = 71.6 bits (174), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 76/149 (51%), Gaps = 5/149 (3%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKR- 59
           M  L+ L+L+  I + HG+ G V + S+ +    +    L +     + I K+  +N + 
Sbjct: 1   MNSLENLILVGVIKSCHGIKGHVMLKSFTDPATKILERNLVNESGANIHI-KLISQNAKG 59

Query: 60  -FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
             I TF+ I   + A  L+  K++  R      ELEEDEF+  DL  +   ++  K  G+
Sbjct: 60  ELICTFNDIATRNEAENLKGYKIFCLRASLP--ELEEDEFYIADLTHLPILNQDHKEIGK 117

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTK 147
           +  + NFGAG I+EI+ + + T L+P  K
Sbjct: 118 IKNILNFGAGDIIEIEFSDQTTELLPCNK 146


>gi|298694532|gb|ADI97754.1| 16S rRNA processing protein [Staphylococcus aureus subsp. aureus
           ED133]
          Length = 167

 Score = 71.6 bits (174), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 54/171 (31%), Positives = 92/171 (53%), Gaps = 14/171 (8%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY-------VLYSNDNRELRILKMYRKNKRF 60
           V +  I  THG+ GE+ + S  N+     R+       V+++N++ E  + K +R +K  
Sbjct: 3   VEVGQIVNTHGIKGEIKVKS--NSDFTDVRFQPGQVLTVVHNNNDLEYTV-KSHRVHKGL 59

Query: 61  -IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            + TF GI+NI+    L+   +Y +R D +D  LEE+EF+ +D+     FD Q    G+V
Sbjct: 60  HMLTFEGINNINDIEHLKGSSIYQER-DHEDIVLEENEFYYSDIIGCTVFDDQETPIGRV 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
             ++  GA  +  IK +  K +LIP+    V EV+++  KI+I P+   L+
Sbjct: 119 INIFETGANDVWVIKGS--KEYLIPYIADVVKEVDIENKKIIITPMEGLLD 167


>gi|329733641|gb|EGG69969.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus 21193]
          Length = 167

 Score = 71.2 bits (173), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 54/171 (31%), Positives = 92/171 (53%), Gaps = 14/171 (8%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY-------VLYSNDNRELRILKMYRKNKRF 60
           V +  I  THG+ GE+ + S  N+     R+       V+++N++ E  + K +R +K  
Sbjct: 3   VEVGQIVNTHGIKGEIKVKS--NSDFTDVRFQPGQVLTVVHNNNDLEYTV-KSHRVHKGL 59

Query: 61  -IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            + TF GI+NI+    L+   +Y +R D +D  LEE+EF+ +D+     FD Q    G+V
Sbjct: 60  HMLTFEGINNINDIEHLKGSSIYQER-DHEDIVLEENEFYYSDIIGCTVFDDQETPIGRV 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
             ++  GA  +  IK +  K +LIP+    V EV+++  KI+I P+   L+
Sbjct: 119 TNIFETGANDVWVIKGS--KEYLIPYIADVVKEVDVENKKIIITPMEGLLD 167


>gi|15924229|ref|NP_371763.1| 16S rRNA-processing protein RimM [Staphylococcus aureus subsp.
           aureus Mu50]
 gi|15926822|ref|NP_374355.1| 16S rRNA-processing protein RimM [Staphylococcus aureus subsp.
           aureus N315]
 gi|21282851|ref|NP_645939.1| 16S rRNA-processing protein RimM [Staphylococcus aureus subsp.
           aureus MW2]
 gi|49486078|ref|YP_043299.1| 16S rRNA-processing protein RimM [Staphylococcus aureus subsp.
           aureus MSSA476]
 gi|57651808|ref|YP_186114.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus COL]
 gi|87162204|ref|YP_493829.1| 16S rRNA-processing protein RimM [Staphylococcus aureus subsp.
           aureus USA300_FPR3757]
 gi|148267730|ref|YP_001246673.1| 16S rRNA-processing protein RimM [Staphylococcus aureus subsp.
           aureus JH9]
 gi|150393788|ref|YP_001316463.1| 16S rRNA-processing protein RimM [Staphylococcus aureus subsp.
           aureus JH1]
 gi|151221361|ref|YP_001332183.1| 16S rRNA-processing protein RimM [Staphylococcus aureus subsp.
           aureus str. Newman]
 gi|156979560|ref|YP_001441819.1| 16S rRNA-processing protein RimM [Staphylococcus aureus subsp.
           aureus Mu3]
 gi|221142029|ref|ZP_03566522.1| 16S rRNA-processing protein [Staphylococcus aureus subsp. aureus
           str. JKD6009]
 gi|253315597|ref|ZP_04838810.1| 16S rRNA-processing protein RimM [Staphylococcus aureus subsp.
           aureus str. CF-Marseille]
 gi|253731857|ref|ZP_04866022.1| 16S rRNA processing protein [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253733523|ref|ZP_04867688.1| 16S rRNA processing protein [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|255006026|ref|ZP_05144627.2| 16S rRNA-processing protein RimM [Staphylococcus aureus subsp.
           aureus Mu50-omega]
 gi|257425293|ref|ZP_05601718.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus 55/2053]
 gi|257427953|ref|ZP_05604351.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus 65-1322]
 gi|257430586|ref|ZP_05606968.1| ribosome maturation factor rimM [Staphylococcus aureus subsp.
           aureus 68-397]
 gi|257433347|ref|ZP_05609705.1| ribosome maturation factor rimM [Staphylococcus aureus subsp.
           aureus E1410]
 gi|257436189|ref|ZP_05612236.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus M876]
 gi|257795705|ref|ZP_05644684.1| 16S rRNA processing protein RimM [Staphylococcus aureus A9781]
 gi|258415929|ref|ZP_05682199.1| ribosome maturation factor rimM [Staphylococcus aureus A9763]
 gi|258421691|ref|ZP_05684615.1| 16S rRNA processing protein RimM [Staphylococcus aureus A9719]
 gi|258434847|ref|ZP_05688921.1| ribosome maturation factor rimM [Staphylococcus aureus A9299]
 gi|258444577|ref|ZP_05692906.1| ribosome maturation factor rimM [Staphylococcus aureus A8115]
 gi|258447590|ref|ZP_05695734.1| ribosome maturation factor rimM [Staphylococcus aureus A6300]
 gi|258449432|ref|ZP_05697535.1| ribosome maturation factor rimM [Staphylococcus aureus A6224]
 gi|258452537|ref|ZP_05700543.1| ribosome maturation factor rimM [Staphylococcus aureus A5948]
 gi|258454811|ref|ZP_05702775.1| 16S rRNA processing protein RimM [Staphylococcus aureus A5937]
 gi|262048137|ref|ZP_06021024.1| probable 16S rRNA processing protein [Staphylococcus aureus D30]
 gi|262051868|ref|ZP_06024084.1| probable 16S rRNA processing protein [Staphylococcus aureus
           930918-3]
 gi|269202855|ref|YP_003282124.1| 16S rRNA-processing protein RimM [Staphylococcus aureus subsp.
           aureus ED98]
 gi|282892726|ref|ZP_06300961.1| 16S rRNA processing protein RimM [Staphylococcus aureus A8117]
 gi|282903793|ref|ZP_06311681.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus C160]
 gi|282905557|ref|ZP_06313412.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus Btn1260]
 gi|282908532|ref|ZP_06316362.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus WW2703/97]
 gi|282910811|ref|ZP_06318614.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus WBG10049]
 gi|282914015|ref|ZP_06321802.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus M899]
 gi|282918937|ref|ZP_06326672.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus C427]
 gi|282920022|ref|ZP_06327751.1| 16S rRNA processing protein RimM [Staphylococcus aureus A9765]
 gi|282924060|ref|ZP_06331736.1| 16S rRNA processing protein [Staphylococcus aureus subsp. aureus
           C101]
 gi|282927580|ref|ZP_06335196.1| 16S rRNA processing protein RimM [Staphylococcus aureus A10102]
 gi|283957981|ref|ZP_06375432.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus A017934/97]
 gi|293501047|ref|ZP_06666898.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus 58-424]
 gi|293510008|ref|ZP_06668716.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus M809]
 gi|293526595|ref|ZP_06671280.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus M1015]
 gi|294848233|ref|ZP_06788980.1| 16S rRNA processing protein RimM [Staphylococcus aureus A9754]
 gi|295406174|ref|ZP_06815981.1| 16S rRNA processing protein RimM [Staphylococcus aureus A8819]
 gi|295427725|ref|ZP_06820357.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus EMRSA16]
 gi|296274796|ref|ZP_06857303.1| 16S rRNA-processing protein RimM [Staphylococcus aureus subsp.
           aureus MR1]
 gi|297208117|ref|ZP_06924548.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus ATCC 51811]
 gi|297244402|ref|ZP_06928285.1| 16S rRNA processing protein RimM [Staphylococcus aureus A8796]
 gi|297591316|ref|ZP_06949954.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus MN8]
 gi|300912197|ref|ZP_07129640.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus TCH70]
 gi|304381197|ref|ZP_07363850.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus ATCC BAA-39]
 gi|54039059|sp|P66656|RIMM_STAAN RecName: Full=Ribosome maturation factor rimM
 gi|54039060|sp|P66657|RIMM_STAAW RecName: Full=Ribosome maturation factor rimM
 gi|54041929|sp|P66655|RIMM_STAAM RecName: Full=Ribosome maturation factor rimM
 gi|56749523|sp|Q6G9X4|RIMM_STAAS RecName: Full=Ribosome maturation factor rimM
 gi|67461252|sp|Q5HGJ3|RIMM_STAAC RecName: Full=Ribosome maturation factor rimM
 gi|109893052|sp|Q2FHJ9|RIMM_STAA3 RecName: Full=Ribosome maturation factor rimM
 gi|166226477|sp|A7X1K9|RIMM_STAA1 RecName: Full=Ribosome maturation factor rimM
 gi|172048857|sp|A6QGD9|RIMM_STAAE RecName: Full=Ribosome maturation factor rimM
 gi|189040856|sp|A6U158|RIMM_STAA2 RecName: Full=Ribosome maturation factor rimM
 gi|189040857|sp|A5ISC4|RIMM_STAA9 RecName: Full=Ribosome maturation factor rimM
 gi|13701039|dbj|BAB42334.1| probable 16S rRNA processing protein [Staphylococcus aureus subsp.
           aureus N315]
 gi|14247009|dbj|BAB57401.1| probable 16S rRNA processing protein [Staphylococcus aureus subsp.
           aureus Mu50]
 gi|21204290|dbj|BAB94987.1| probable 16S rRNA processing protein [Staphylococcus aureus subsp.
           aureus MW2]
 gi|49244521|emb|CAG42950.1| 16S rRNA processing protein [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|57285994|gb|AAW38088.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus COL]
 gi|87128178|gb|ABD22692.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus USA300_FPR3757]
 gi|147740799|gb|ABQ49097.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus JH9]
 gi|149946240|gb|ABR52176.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus JH1]
 gi|150374161|dbj|BAF67421.1| 16S rRNA processing protein [Staphylococcus aureus subsp. aureus
           str. Newman]
 gi|156721695|dbj|BAF78112.1| probable 16S rRNA processing protein [Staphylococcus aureus subsp.
           aureus Mu3]
 gi|253724409|gb|EES93138.1| 16S rRNA processing protein [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253728577|gb|EES97306.1| 16S rRNA processing protein [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|257271750|gb|EEV03888.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus 55/2053]
 gi|257274794|gb|EEV06281.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus 65-1322]
 gi|257278714|gb|EEV09333.1| ribosome maturation factor rimM [Staphylococcus aureus subsp.
           aureus 68-397]
 gi|257281440|gb|EEV11577.1| ribosome maturation factor rimM [Staphylococcus aureus subsp.
           aureus E1410]
 gi|257284471|gb|EEV14591.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus M876]
 gi|257789677|gb|EEV28017.1| 16S rRNA processing protein RimM [Staphylococcus aureus A9781]
 gi|257839265|gb|EEV63739.1| ribosome maturation factor rimM [Staphylococcus aureus A9763]
 gi|257842377|gb|EEV66802.1| 16S rRNA processing protein RimM [Staphylococcus aureus A9719]
 gi|257849208|gb|EEV73190.1| ribosome maturation factor rimM [Staphylococcus aureus A9299]
 gi|257850070|gb|EEV74023.1| ribosome maturation factor rimM [Staphylococcus aureus A8115]
 gi|257853781|gb|EEV76740.1| ribosome maturation factor rimM [Staphylococcus aureus A6300]
 gi|257857420|gb|EEV80318.1| ribosome maturation factor rimM [Staphylococcus aureus A6224]
 gi|257859755|gb|EEV82597.1| ribosome maturation factor rimM [Staphylococcus aureus A5948]
 gi|257863194|gb|EEV85958.1| 16S rRNA processing protein RimM [Staphylococcus aureus A5937]
 gi|259160269|gb|EEW45297.1| probable 16S rRNA processing protein [Staphylococcus aureus
           930918-3]
 gi|259163703|gb|EEW48258.1| probable 16S rRNA processing protein [Staphylococcus aureus D30]
 gi|262075145|gb|ACY11118.1| 16S rRNA-processing protein RimM [Staphylococcus aureus subsp.
           aureus ED98]
 gi|269940731|emb|CBI49112.1| 16S rRNA processing protein [Staphylococcus aureus subsp. aureus
           TW20]
 gi|282314032|gb|EFB44424.1| 16S rRNA processing protein [Staphylococcus aureus subsp. aureus
           C101]
 gi|282316747|gb|EFB47121.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus C427]
 gi|282322083|gb|EFB52407.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus M899]
 gi|282325416|gb|EFB55725.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus WBG10049]
 gi|282327594|gb|EFB57877.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus WW2703/97]
 gi|282330849|gb|EFB60363.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus Btn1260]
 gi|282590583|gb|EFB95660.1| 16S rRNA processing protein RimM [Staphylococcus aureus A10102]
 gi|282594738|gb|EFB99722.1| 16S rRNA processing protein RimM [Staphylococcus aureus A9765]
 gi|282595411|gb|EFC00375.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus C160]
 gi|282764723|gb|EFC04848.1| 16S rRNA processing protein RimM [Staphylococcus aureus A8117]
 gi|283790130|gb|EFC28947.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus A017934/97]
 gi|285816921|gb|ADC37408.1| 16S rRNA processing protein RimM [Staphylococcus aureus 04-02981]
 gi|290920667|gb|EFD97730.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus M1015]
 gi|291096052|gb|EFE26313.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus 58-424]
 gi|291466952|gb|EFF09470.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus M809]
 gi|294825033|gb|EFG41455.1| 16S rRNA processing protein RimM [Staphylococcus aureus A9754]
 gi|294968762|gb|EFG44784.1| 16S rRNA processing protein RimM [Staphylococcus aureus A8819]
 gi|295128083|gb|EFG57717.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus EMRSA16]
 gi|296887360|gb|EFH26262.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus ATCC 51811]
 gi|297178432|gb|EFH37678.1| 16S rRNA processing protein RimM [Staphylococcus aureus A8796]
 gi|297576202|gb|EFH94918.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus MN8]
 gi|300886443|gb|EFK81645.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus TCH70]
 gi|302751062|gb|ADL65239.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus str. JKD6008]
 gi|304340180|gb|EFM06121.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus ATCC BAA-39]
 gi|312438383|gb|ADQ77454.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus TCH60]
 gi|312829633|emb|CBX34475.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus ECT-R 2]
 gi|315131032|gb|EFT87016.1| probable 16S rRNA processing protein [Staphylococcus aureus subsp.
           aureus CGS03]
 gi|315194127|gb|EFU24520.1| probable 16S rRNA processing protein [Staphylococcus aureus subsp.
           aureus CGS00]
 gi|315198478|gb|EFU28807.1| probable 16S rRNA processing protein [Staphylococcus aureus subsp.
           aureus CGS01]
 gi|320140945|gb|EFW32792.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus MRSA131]
 gi|320144340|gb|EFW36106.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus MRSA177]
 gi|329313908|gb|AEB88321.1| Ribosome maturation factor rimM [Staphylococcus aureus subsp.
           aureus T0131]
 gi|329724775|gb|EGG61280.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus 21189]
 gi|329727338|gb|EGG63794.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus 21172]
          Length = 167

 Score = 71.2 bits (173), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 54/171 (31%), Positives = 92/171 (53%), Gaps = 14/171 (8%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY-------VLYSNDNRELRILKMYRKNKRF 60
           V +  I  THG+ GE+ + S  N+     R+       V+++N++ E  + K +R +K  
Sbjct: 3   VEVGQIVNTHGIKGEIKVKS--NSDFTDVRFQPGQVLTVVHNNNDLEYTV-KSHRVHKGL 59

Query: 61  -IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            + TF GI+NI+    L+   +Y +R D +D  LEE+EF+ +D+     FD Q    G+V
Sbjct: 60  HMLTFEGINNINDIEHLKGSSIYQER-DHEDIVLEENEFYYSDIIGCTVFDDQETPIGRV 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
             ++  GA  +  IK +  K +LIP+    V EV+++  KI+I P+   L+
Sbjct: 119 INIFETGANDVWVIKGS--KEYLIPYIADVVKEVDVENKKIIITPMEGLLD 167


>gi|49483402|ref|YP_040626.1| 16S rRNA-processing protein RimM [Staphylococcus aureus subsp.
           aureus MRSA252]
 gi|56749570|sp|Q6GHJ6|RIMM_STAAR RecName: Full=Ribosome maturation factor rimM
 gi|49241531|emb|CAG40217.1| 16S rRNA processing protein [Staphylococcus aureus subsp. aureus
           MRSA252]
          Length = 167

 Score = 71.2 bits (173), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 54/171 (31%), Positives = 92/171 (53%), Gaps = 14/171 (8%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY-------VLYSNDNRELRILKMYRKNKRF 60
           V +  I  THG+ GE+ + S  N+     R+       V+++N++ E  + K +R +K  
Sbjct: 3   VEVGQIVNTHGIKGEIKVKS--NSDFTDVRFQPGQVLTVVHNNNDLEYTV-KSHRVHKGL 59

Query: 61  -IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            + TF GI+NI+    L+   +Y +R D +D  LEE+EF+ +D+     FD Q    G+V
Sbjct: 60  HMLTFEGINNINDIEHLKGSSIYQER-DHEDIVLEENEFYYSDIIGCTVFDDQETPIGRV 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
             ++  GA  +  IK +  K +LIP+    V EV+++  KI+I P+   L+
Sbjct: 119 INIFETGANDVWVIKES--KEYLIPYIADVVKEVDVENKKIIITPMEGLLD 167


>gi|296116584|ref|ZP_06835194.1| 16S rRNA processing protein RimM [Gluconacetobacter hansenii ATCC
           23769]
 gi|295976796|gb|EFG83564.1| 16S rRNA processing protein RimM [Gluconacetobacter hansenii ATCC
           23769]
          Length = 185

 Score = 71.2 bits (173), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 77/158 (48%), Gaps = 8/158 (5%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIATFSG- 66
           +LM  +G  HG+ G V + SYA  P DL RY    +++     L    +    +   +G 
Sbjct: 6   ILMGVVGRPHGVRGLVRVHSYAAVPEDLARYGALRDEHGNAWHLSWRGQGIAELRNDAGQ 65

Query: 67  -IDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQG---KYWGQVCGV 122
            + +   A +L + KLY  R D    E EEDEF+  DL  M+  ++ G      G V  V
Sbjct: 66  ALSSREDAQKLVNRKLYVGRVDLP--EPEEDEFYVADLVGMQVIEQAGTPLHELGHVRLV 123

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKI 160
           +++GAG  LEI      T L+PFT+  V  V++   +I
Sbjct: 124 HDYGAGVSLEITG-QGGTILLPFTRACVPVVDMGARRI 160


>gi|294085385|ref|YP_003552145.1| 16S rRNA processing protein [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292664960|gb|ADE40061.1| 16S rRNA processing protein [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 190

 Score = 71.2 bits (173), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 80/158 (50%), Gaps = 6/158 (3%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRE--LRILKMYRKNKRFIATFSG 66
           +A I  +HG+ G V I  +   P  L R+  +Y  D ++  L+IL    K    +A    
Sbjct: 14  VAAITGSHGVRGNVKIKPFTETPESLGRFDKVYLEDGQQVALKILSFGSKGV-VLARLGK 72

Query: 67  IDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFG 126
           +++  ++  LR   LY  R    D  L +DE ++ DL  ++         G++  +++FG
Sbjct: 73  VESRDASDALRGQHLYVDRAALPD--LADDEIYHADLLGLDAVLEDDSLLGRIDAIHDFG 130

Query: 127 AGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           AG+++EI      + ++PF+  A++ V L + ++++ P
Sbjct: 131 AGNVVEIIPPQGSSIMLPFSGSALVRVELDKRRVILAP 168


>gi|288553086|ref|YP_003425021.1| 16S rRNA processing protein [Bacillus pseudofirmus OF4]
 gi|288544246|gb|ADC48129.1| 16S rRNA processing protein [Bacillus pseudofirmus OF4]
          Length = 173

 Score = 70.9 bits (172), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 87/169 (51%), Gaps = 10/169 (5%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPID-----LNRYVLYSNDNRELRILKM-YRKNKRF 60
           L+ +  I  THG+ GE+ + S  + P +        +++ +N  + + ++   +R +K F
Sbjct: 4   LLKVGKIVNTHGVRGEIRVISSTDFPDERYAKGCELWIVDANTKKHISVVVANHRVHKNF 63

Query: 61  -IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            + TF G D+I+   E +   LY  +    D  L+E EF+  ++   E +    ++ GQ+
Sbjct: 64  DLLTFEGYDSINQVEEFKGSTLYVSKDQLSD--LDEGEFYYHEIIGCEVYTTNNEHLGQI 121

Query: 120 CGVYNFGAGSILEIKNTME-KTFLIPFTKFAVLEVNLQENKILIDPIAA 167
             +   GA  +  I+     K  LIP+ +  V+E+NL+ENK++IDP+  
Sbjct: 122 KEIIETGANDVWVIRRAGGGKDILIPYIEDVVIEINLEENKVIIDPMEG 170


>gi|294011043|ref|YP_003544503.1| 16S rRNA processing protein RimM [Sphingobium japonicum UT26S]
 gi|292674373|dbj|BAI95891.1| 16S rRNA processing protein RimM [Sphingobium japonicum UT26S]
          Length = 159

 Score = 70.9 bits (172), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 65/141 (46%), Gaps = 2/141 (1%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIATF 64
           DK V +A I   HG+ GEV +  +      L  Y  +    R L +  +       +A F
Sbjct: 3   DKPVTLAVIIGAHGVTGEVRLKLFGEGAETLKSYGGFDAAGRTLTLKSVRPGPNGAVARF 62

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
           + + +  +A  LR  +L   R       L E E+++ DL ++  F  +G+  G V  V N
Sbjct: 63  AEVGDRSAAEALRGTELTVPRSALPP--LGEGEYYHADLIDLPCFSSEGEGLGHVVAVEN 120

Query: 125 FGAGSILEIKNTMEKTFLIPF 145
           FGAG I+E++    K F+ P 
Sbjct: 121 FGAGDIIEVERPNGKRFMAPM 141


>gi|218462267|ref|ZP_03502358.1| 16S rRNA-processing protein [Rhizobium etli Kim 5]
          Length = 89

 Score = 70.9 bits (172), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 45/60 (75%)

Query: 110 DRQGKYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           D QG  +G V GV++FGAG +LE+K   ++  LIPF++ +VLE++L+   +LIDP+AAGL
Sbjct: 11  DDQGVSYGTVTGVFDFGAGDLLELKGPGKRPVLIPFSEASVLEIDLEAGTLLIDPLAAGL 70


>gi|330685679|gb|EGG97320.1| 16S rRNA processing protein RimM [Staphylococcus epidermidis
           VCU121]
          Length = 167

 Score = 70.9 bits (172), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 91/171 (53%), Gaps = 14/171 (8%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDN---RELRILKMYRKNKRF 60
           V +  I  THG+ GEV + S  N+     R+    VL +  N   +EL +   YR +K F
Sbjct: 3   VEVGQIVNTHGIKGEVKVKS--NSDFTDTRFQPGEVLTAKLNQIEKELTVTS-YRTHKGF 59

Query: 61  -IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +  F GIDNI+    L+   LY +R D +D ELEE+EF+ +D+     FD + +  G++
Sbjct: 60  HMLKFEGIDNINDIEYLKGALLYQER-DHEDIELEENEFYYSDIIGCTVFDDEQQPIGRI 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
             ++  GA  +  +K   +K +LIP+    V EV+++   ++I P+   L+
Sbjct: 119 TSIFETGANDVWVVKG--DKEYLIPYIADVVKEVDVENKTVIITPMEGLLD 167


>gi|284024232|ref|ZP_06378630.1| 16S rRNA-processing protein RimM [Staphylococcus aureus subsp.
           aureus 132]
          Length = 167

 Score = 70.5 bits (171), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 54/171 (31%), Positives = 92/171 (53%), Gaps = 14/171 (8%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY-------VLYSNDNRELRILKMYRKNKRF 60
           V +  I  THG+ GE+ + S  N+     R+       V+++N++ E  + K +R +K  
Sbjct: 3   VEVGQIVNTHGIKGEIKVKS--NSDFTDVRFQPGQVLTVVHNNNDLEYTV-KSHRVHKGL 59

Query: 61  -IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            + TF GI+NI+    L+   +Y +R D +D  LEE+EF+ +D+     FD Q    G+V
Sbjct: 60  HMLTFEGINNINDIEHLKGSSIYQER-DHEDIVLEENEFYYSDIIGCTVFDDQETPIGRV 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
             ++  GA  +  IK +  K +LIP+    V EV+++  KI+I P+   L+
Sbjct: 119 INIFETGANDVWVIKGS--KEYLIPYIADVVKEVDVENKKIIIMPMEGLLD 167


>gi|164688560|ref|ZP_02212588.1| hypothetical protein CLOBAR_02205 [Clostridium bartlettii DSM
           16795]
 gi|164602973|gb|EDQ96438.1| hypothetical protein CLOBAR_02205 [Clostridium bartlettii DSM
           16795]
          Length = 170

 Score = 70.5 bits (171), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 54/164 (32%), Positives = 79/164 (48%), Gaps = 6/164 (3%)

Query: 10  MATIGTTHGLNGEVYIDSYA---NNPIDLNRYVLYSNDNRELRILKMYRKNKRFIATFSG 66
           +  I  T GL GEV +  Y    N   DL  + L    N +  + ++  K    I    G
Sbjct: 10  IGQIVNTQGLKGEVRVYPYTDDINRFDDLEYFYLDKGLNNKYEVERVRYKGNMVIMKIKG 69

Query: 67  IDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFG 126
           ID+I  A +L+   +Y  R   K  ELEEDEFF  DL  ++ F   G+  G V  V    
Sbjct: 70  IDSIELAQKLKTKNMYIGRDQGK--ELEEDEFFVADLIGLDVFTVDGEKVGVVKDVLQHA 127

Query: 127 AGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
              +  + N  EK +LIP  +  V  ++L+ENK++I+PI   L+
Sbjct: 128 INDVYVVNNG-EKEYLIPSIEKFVPTIDLEENKMIINPIKGMLD 170


>gi|302332843|gb|ADL23036.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus JKD6159]
          Length = 167

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 53/171 (30%), Positives = 92/171 (53%), Gaps = 14/171 (8%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY-------VLYSNDNRELRILKMYRKNKRF 60
           V +  I  THG+ GE+ + S  N+     R+       V+++N++ E  + K +R +K  
Sbjct: 3   VEVGQIVNTHGIKGEIKVKS--NSDFTDVRFQPGQVLTVVHNNNDLEYTV-KSHRVHKGL 59

Query: 61  -IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            + TF GI+NI+    L+   +Y +R D +D  LEE+E++ +D+     FD Q    G+V
Sbjct: 60  HMLTFEGINNINDIEHLKGSSIYQER-DHEDIVLEENEYYYSDIIGCTVFDDQETPIGRV 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
             ++  GA  +  IK +  K +LIP+    V EV+++  KI+I P+   L+
Sbjct: 119 INIFETGANDVWVIKGS--KEYLIPYIADVVKEVDVENKKIIIKPMEGLLD 167


>gi|82750843|ref|YP_416584.1| 16S rRNA-processing protein RimM [Staphylococcus aureus RF122]
 gi|282916489|ref|ZP_06324251.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus D139]
 gi|283770301|ref|ZP_06343193.1| ribosome maturation factor rimM [Staphylococcus aureus subsp.
           aureus H19]
 gi|109893053|sp|Q2YXK2|RIMM_STAAB RecName: Full=Ribosome maturation factor rimM
 gi|82656374|emb|CAI80792.1| 16S rRNA processing protein [Staphylococcus aureus RF122]
 gi|282319929|gb|EFB50277.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus D139]
 gi|283460448|gb|EFC07538.1| ribosome maturation factor rimM [Staphylococcus aureus subsp.
           aureus H19]
          Length = 167

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 53/171 (30%), Positives = 92/171 (53%), Gaps = 14/171 (8%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY-------VLYSNDNRELRILKMYRKNKRF 60
           V +  I  THG+ GE+ + S  N+     R+       V+++N++ E  + K +R +K  
Sbjct: 3   VEVGQIVNTHGIKGEIKVKS--NSDFTDVRFQPGQVLTVVHNNNDLEYTV-KSHRVHKGL 59

Query: 61  -IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            + TF GI+NI+    L+   +Y +R D +D  LEE+E++ +D+     FD Q    G+V
Sbjct: 60  HMLTFEGINNINDIEHLKGSSIYQER-DHEDIVLEENEYYYSDIIGCTVFDDQETPIGRV 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
             ++  GA  +  IK +  K +LIP+    V EV+++  KI+I P+   L+
Sbjct: 119 INIFETGANDVWVIKGS--KEYLIPYIADVVKEVDVENKKIIITPMEGLLD 167


>gi|239622499|ref|ZP_04665530.1| 16S rRNA processing protein [Bifidobacterium longum subsp. infantis
           CCUG 52486]
 gi|239514496|gb|EEQ54363.1| 16S rRNA processing protein [Bifidobacterium longum subsp. infantis
           CCUG 52486]
          Length = 202

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 57/196 (29%), Positives = 96/196 (48%), Gaps = 30/196 (15%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNRELRILKMYRKNK-RF 60
           +L+ +A IG   GL GEV +  Y ++P    R+    VLYS D     I++  R  K R+
Sbjct: 9   ELLRVARIGRAQGLKGEVTVRLYTDDP--EWRFEPDSVLYSQDGESEYIVEGSRTFKDRW 66

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQG------- 113
           I    G+D+ ++A  L  ++LY +  D +D  LE DE++  DL  +E    +G       
Sbjct: 67  ILKLEGVDDRNAAEALNGVELYGEVDDAEDM-LEADEWYPKDLIGLEARLVEGNGLGLPA 125

Query: 114 -KYWGQVCGVYNFGAGSILEIK--------------NTMEKTFLIPFTKFAVLEVNLQEN 158
            +  G+V  V +  A S+L+I+              + +EKT L+PF +  V +++L+E 
Sbjct: 126 GQVVGKVADVVDSPAQSLLKIRLTEPVVTGQNSKGEDVVEKTALVPFVEALVPDIDLEEQ 185

Query: 159 KILIDPIAAGLNNTTM 174
            + +DP    +    M
Sbjct: 186 YLTLDPPGGLIPGCGM 201


>gi|283470452|emb|CAQ49663.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus ST398]
          Length = 167

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 53/171 (30%), Positives = 92/171 (53%), Gaps = 14/171 (8%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY-------VLYSNDNRELRILKMYRKNKRF 60
           V +  I  THG+ GE+ + S  N+     R+       V+++N++ E  + K +R +K  
Sbjct: 3   VEVGQIVNTHGIKGEIKVKS--NSDFTDVRFQPGQVLTVVHNNNDLEYTV-KSHRVHKGL 59

Query: 61  -IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            + TF GI+NI+    L+   +Y +R D +D  L+E+EF+ +D+     FD Q    G+V
Sbjct: 60  HMLTFEGINNINDIEHLKGSSIYQER-DHEDIVLDENEFYYSDIIGCTVFDDQETPIGRV 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
             ++  GA  +  IK +  K +LIP+    V EV+++  KI+I P+   L+
Sbjct: 119 INIFETGANDVWVIKGS--KEYLIPYIADVVKEVDVENKKIIITPMEGLLD 167


>gi|323441015|gb|EGA98722.1| 16S rRNA-processing protein RimM [Staphylococcus aureus O11]
 gi|323442332|gb|EGA99962.1| 16S rRNA-processing protein RimM [Staphylococcus aureus O46]
          Length = 167

 Score = 70.1 bits (170), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 54/171 (31%), Positives = 91/171 (53%), Gaps = 14/171 (8%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY-------VLYSNDNRELRILKMYRKNKRF 60
           V +  I  THG+ GE+ + S  N+     R+       V+++N++ E  + K +R +K  
Sbjct: 3   VEVGQIVNTHGIKGEIKVKS--NSDFTDVRFQPGQVLTVVHNNNDLEYTV-KSHRVHKGL 59

Query: 61  -IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            + TF GI+NI+    L+   +Y +R D +D  LEE+EF+ +D+     FD Q    G+V
Sbjct: 60  HMLTFEGINNINDIEHLKGSSIYQER-DHEDIVLEENEFYYSDIIGCTVFDDQETPIGRV 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
             ++  GA  +  IK +  K +LIP+    V EV+++  KI I P+   L+
Sbjct: 119 INIFETGANDVWVIKGS--KEYLIPYIADVVKEVDIENKKISITPMEGLLD 167


>gi|296536510|ref|ZP_06898600.1| 16S rRNA processing protein RimM [Roseomonas cervicalis ATCC 49957]
 gi|296263166|gb|EFH09701.1| 16S rRNA processing protein RimM [Roseomonas cervicalis ATCC 49957]
          Length = 209

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 73/151 (48%), Gaps = 4/151 (2%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIATFSGI 67
           +L+  IG  HG+ G V ++++  +P  +  Y   S+++   R    +  N   +A   G+
Sbjct: 6   ILVGEIGRPHGVRGIVRVNAFTADPAAIAGYGPLSDESGARRFALQWLGNG--LARIEGV 63

Query: 68  DNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFGA 127
            +  +A+ L   +LY +R        EE+EF+  DL  +   D  G   G V  V ++GA
Sbjct: 64  ADRDAAARLTGTRLYVERDRLP--ATEEEEFYLADLVGLAVRDGSGATLGSVRSVEDYGA 121

Query: 128 GSILEIKNTMEKTFLIPFTKFAVLEVNLQEN 158
           G  L + +   +  L+PFT+  V +V + E 
Sbjct: 122 GPFLTVIDGEGRELLLPFTRAVVPQVIIAEG 152


>gi|239636282|ref|ZP_04677284.1| 16S rRNA processing protein RimM [Staphylococcus warneri L37603]
 gi|239597637|gb|EEQ80132.1| 16S rRNA processing protein RimM [Staphylococcus warneri L37603]
          Length = 167

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 54/171 (31%), Positives = 91/171 (53%), Gaps = 14/171 (8%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDN---RELRILKMYRKNKRF 60
           V +  I  THG+ GEV + S  N+     R+    VL +  N   +EL +   YR +K F
Sbjct: 3   VEVGQIVNTHGIKGEVKVKS--NSDFTDTRFQPGEVLTAKLNQIEKELTVTS-YRTHKGF 59

Query: 61  -IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +  F GIDNI+    L+   LY +R D +D ELEE+EF+ +D+     FD + +  G++
Sbjct: 60  HMLKFEGIDNINDIEYLKGAVLYQER-DHEDIELEENEFYYSDIIGCTVFDDEQQPIGRI 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
             ++  GA  +  +K   +K +LIP+    V +V+++   ++I P+   L+
Sbjct: 119 TSIFETGANDVWVVKG--DKEYLIPYIADVVKDVDVENKTVIITPMEGLLD 167


>gi|227545804|ref|ZP_03975853.1| 16S rRNA processing protein RimM [Bifidobacterium longum subsp.
           infantis ATCC 55813]
 gi|312133333|ref|YP_004000672.1| rimm [Bifidobacterium longum subsp. longum BBMN68]
 gi|322688487|ref|YP_004208221.1| 16S rRNA-processing protein [Bifidobacterium longum subsp. infantis
           157F]
 gi|322690497|ref|YP_004220067.1| 16S rRNA-processing protein [Bifidobacterium longum subsp. longum
           JCM 1217]
 gi|227213920|gb|EEI81759.1| 16S rRNA processing protein RimM [Bifidobacterium longum subsp.
           infantis ATCC 55813]
 gi|311772552|gb|ADQ02040.1| RimM [Bifidobacterium longum subsp. longum BBMN68]
 gi|320455353|dbj|BAJ65975.1| putative 16S rRNA-processing protein [Bifidobacterium longum subsp.
           longum JCM 1217]
 gi|320459823|dbj|BAJ70443.1| putative 16S rRNA-processing protein [Bifidobacterium longum subsp.
           infantis 157F]
          Length = 207

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 57/196 (29%), Positives = 96/196 (48%), Gaps = 30/196 (15%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNRELRILKMYRKNK-RF 60
           +L+ +A IG   GL GEV +  Y ++P    R+    VLYS D     I++  R  K R+
Sbjct: 14  ELLRVARIGRAQGLKGEVTVRLYTDDP--EWRFEPDSVLYSQDGETEYIVEGSRTFKDRW 71

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQG------- 113
           I    G+D+ ++A  L  ++LY +  D +D  LE DE++  DL  +E    +G       
Sbjct: 72  ILKLEGVDDRNAAEALNGVELYGEVDDAEDM-LEADEWYPKDLIGLEARLVEGNGLGLPA 130

Query: 114 -KYWGQVCGVYNFGAGSILEIK--------------NTMEKTFLIPFTKFAVLEVNLQEN 158
            +  G+V  V +  A S+L+I+              + +EKT L+PF +  V +++L+E 
Sbjct: 131 GQVVGKVVDVIDSPAQSLLKIRLTEPVVTGQNSKGEDVVEKTALVPFVEALVPDIDLEEQ 190

Query: 159 KILIDPIAAGLNNTTM 174
            + +DP    +    M
Sbjct: 191 YLTLDPPGGLIPGCGM 206


>gi|320096203|ref|ZP_08027791.1| 16S rRNA processing protein RimM [Actinomyces sp. oral taxon 178
           str. F0338]
 gi|319976868|gb|EFW08623.1| 16S rRNA processing protein RimM [Actinomyces sp. oral taxon 178
           str. F0338]
          Length = 170

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 43/160 (26%), Positives = 71/160 (44%), Gaps = 9/160 (5%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDL--NRYVLYSNDNRELRILKMYRKNKRFIATF 64
           L+  A IG  HGL GEV +D  +++P  L     ++ S     + +        R +A  
Sbjct: 2   LMTAAIIGPAHGLKGEVVLDVRSDDPAVLAPGASLVLSGSGSGVVVESTRVHKGRVLARL 61

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
            G+     A  LR   L     D      EED ++   L+ +   D QG+  G V G+  
Sbjct: 62  GGVGTREEAEALRGAALLVAPHD------EEDAWYPHQLKGLRAEDPQGRPLGSVSGLRP 115

Query: 125 FGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
            GA  +L +  T     ++PF +  V  V+++  +++IDP
Sbjct: 116 GGAQDLLLV-GTERGEVMVPFVRQLVPTVDVEGGRVVIDP 154


>gi|83313163|ref|YP_423427.1| 16S rRNA-processing protein RimM [Magnetospirillum magneticum
           AMB-1]
 gi|109893022|sp|Q2VZV7|RIMM_MAGMM RecName: Full=Ribosome maturation factor rimM
 gi|82948004|dbj|BAE52868.1| RimM protein, required for 16S rRNA processing [Magnetospirillum
           magneticum AMB-1]
          Length = 176

 Score = 68.9 bits (167), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 44/144 (30%), Positives = 75/144 (52%), Gaps = 4/144 (2%)

Query: 23  VYIDSYANNPIDLNRYVLYSNDNRELRI-LKMYRKNKRF-IATFSGIDNIHSASELRDLK 80
           V I S+  +P D+  Y    N+   ++  LK+  + K   IAT  GI +  +A  L+  +
Sbjct: 20  VRIKSFTEDPADIGFYSPVENEAGSIKYRLKVTGEVKGLVIATLDGIGDRDAAEALKGTE 79

Query: 81  LYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFGAGSILEIKNTMEKT 140
           L+  R+      L EDEF  +DL  +      GK  G V  V ++GAG +L+IK   +  
Sbjct: 80  LWVARERLP--RLAEDEFLYSDLIGLVAEGVDGKRLGIVKAVADYGAGDVLDIKLEPKGD 137

Query: 141 FLIPFTKFAVLEVNLQENKILIDP 164
            ++PFT+ +V EV++   ++++ P
Sbjct: 138 MMVPFTQASVPEVDIAGGRLVVVP 161


>gi|317482001|ref|ZP_07941026.1| 16S rRNA processing protein RimM [Bifidobacterium sp. 12_1_47BFAA]
 gi|316916568|gb|EFV37965.1| 16S rRNA processing protein RimM [Bifidobacterium sp. 12_1_47BFAA]
          Length = 204

 Score = 68.9 bits (167), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 94/186 (50%), Gaps = 30/186 (16%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNRELRILKMYRKNK-RF 60
           +L+ +A IG   GL GEV +  Y ++P    R+    VLYS D     I++  R  K R+
Sbjct: 14  ELLRVARIGRAQGLKGEVTVRLYTDDP--EWRFEPDSVLYSQDGETEYIVEGSRTFKDRW 71

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQG------- 113
           I    G+D+ ++A  L  ++LY +  D +D  LE DE++  DL  +E    +G       
Sbjct: 72  ILKLEGVDDRNAAEALNGVELYGEVDDAEDM-LEADEWYPKDLIGLEARLVEGNGLGLPA 130

Query: 114 -KYWGQVCGVYNFGAGSILEIK--------------NTMEKTFLIPFTKFAVLEVNLQEN 158
            +  G+V  V +  A S+L+I+              + +EKT L+PF +  V +++L+E 
Sbjct: 131 GQVVGKVADVIDSPAQSLLKIRLTEPVVTGQNSKGEDVVEKTALVPFVEELVPDIDLEEQ 190

Query: 159 KILIDP 164
            + +DP
Sbjct: 191 YLTLDP 196


>gi|300024813|ref|YP_003757424.1| 16S rRNA processing protein RimM [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299526634|gb|ADJ25103.1| 16S rRNA processing protein RimM [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 185

 Score = 68.9 bits (167), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 75/159 (47%), Gaps = 4/159 (2%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYR-KNKRFIAT 63
           K +L+  I   HG+ G++ + +Y   P  +  Y  L      +   LK+ R  +K  +A 
Sbjct: 8   KRILLGEISGVHGIRGDILVRTYTATPDAIASYGPLTDATGTKTFSLKIVRVTDKGVVAR 67

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
            +GI +  +A  LR  KL+  R+     E    EF+++DL  +          G++  V 
Sbjct: 68  IAGISDRTTAEALRGTKLFIAREKLP--ETSASEFYHSDLIGLNAVAEDNTPIGKIVSVQ 125

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
           NFGAG +LE++     +  IPF    V +V+L    ++I
Sbjct: 126 NFGAGDLLELQPPEGASEFIPFEDQWVPKVDLSARTVVI 164


>gi|125973285|ref|YP_001037195.1| 16S rRNA processing protein RimM [Clostridium thermocellum ATCC
           27405]
 gi|256003765|ref|ZP_05428753.1| 16S rRNA processing protein RimM [Clostridium thermocellum DSM
           2360]
 gi|281417489|ref|ZP_06248509.1| 16S rRNA processing protein RimM [Clostridium thermocellum JW20]
 gi|166226436|sp|A3DDH3|RIMM_CLOTH RecName: Full=Ribosome maturation factor rimM
 gi|125713510|gb|ABN52002.1| 16S rRNA processing protein RimM [Clostridium thermocellum ATCC
           27405]
 gi|255992326|gb|EEU02420.1| 16S rRNA processing protein RimM [Clostridium thermocellum DSM
           2360]
 gi|281408891|gb|EFB39149.1| 16S rRNA processing protein RimM [Clostridium thermocellum JW20]
 gi|316940483|gb|ADU74517.1| 16S rRNA processing protein RimM [Clostridium thermocellum DSM
           1313]
          Length = 174

 Score = 68.6 bits (166), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 49/160 (30%), Positives = 81/160 (50%), Gaps = 8/160 (5%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNR----YVL--YSNDNRELRILKMYRKNKRFIAT 63
           +  I  THG+ GEV      +NP   N+    YV    SN+  +  I+ +       I  
Sbjct: 7   VGKIVNTHGIKGEVKAIPLTDNPRRFNKLKWAYVSKEISNEMPKFDIVSVKHHKNFVILK 66

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           FSGID++++A +L++  +   R+D    +L +D FF  DL  M  FD + K  G +  V 
Sbjct: 67  FSGIDDMNAAEKLKEHFVIIDRKDA--VKLPKDTFFICDLIGMNVFDTEEKKLGVLTDVL 124

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
           + G+  +  +K+   K  LIP  K  V +V  ++NK+++D
Sbjct: 125 STGSNDVYVVKSDNNKEILIPALKSVVKKVCFEDNKMVVD 164


>gi|281412660|ref|YP_003346739.1| 16S rRNA processing protein RimM [Thermotoga naphthophila RKU-10]
 gi|281373763|gb|ADA67325.1| 16S rRNA processing protein RimM [Thermotoga naphthophila RKU-10]
          Length = 176

 Score = 68.2 bits (165), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 89/164 (54%), Gaps = 9/164 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNP---IDLNRYVLYSNDNRE---LRILKMYRKN 57
           LD+ V +  I  THGL GEV    Y N+     +L+  +LY+++ +    L +  + R N
Sbjct: 9   LDERVAIGKIVNTHGLKGEVKFFPYTNSEEIVKNLSDVILYNSEKKAFYNLTVESVRRMN 68

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
           K F+  F  ID I +A +++  +++ K ++    +L EDE++  ++ + + F   G+  G
Sbjct: 69  KLFLIRFKSIDTIEAAEKIKGCEVFVKYEELP--KLNEDEYYFYEILDCDVFYESGENVG 126

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKIL 161
           +V  +   G+  +L ++   ++T LIP TK  ++E++    +I+
Sbjct: 127 KVVDIIETGSNDVLVVRKKKKET-LIPMTKDCIVEIDKGAKRII 169


>gi|226945996|ref|YP_002801069.1| 16S rRNA-processing protein RimM [Azotobacter vinelandii DJ]
 gi|259585642|sp|C1DDY6|RIMM_AZOVD RecName: Full=Ribosome maturation factor rimM
 gi|226720923|gb|ACO80094.1| 16S rRNA processing protein RimM [Azotobacter vinelandii DJ]
          Length = 178

 Score = 68.2 bits (165), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 86/168 (51%), Gaps = 12/168 (7%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPID-LNRYVLYS----NDNRELRILKMYRKNKR 59
           D L+++  I + HG+ GEV + S+  +PID L  Y  ++    ++ R++ +++   + + 
Sbjct: 9   DGLIVLGKITSVHGVRGEVKVYSF-TDPIDNLLDYRFWTLRRGDERRQIELVRGRPQGRL 67

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +A   GI++   A  L D ++           L+E EF+   LE +   DR+G+ +G+V
Sbjct: 68  LVARLKGIEDRDGARALADFEVCVPIAQLP--RLDEGEFYWHQLEGLRVVDREGRLFGKV 125

Query: 120 CGVYNFGAGSILEIKNTM----EKTFLIPFTKFAVLEVNLQENKILID 163
             +   GA  +L ++       ++  L+P+T   VL V+L   +I +D
Sbjct: 126 DHLLETGANDVLVVRPCTGSLDDRERLLPYTDQCVLRVDLAAGEIRVD 173


>gi|150021669|ref|YP_001307023.1| 16S rRNA processing protein RimM [Thermosipho melanesiensis BI429]
 gi|172048673|sp|A6LNY7|RIMM_THEM4 RecName: Full=Ribosome maturation factor rimM
 gi|149794190|gb|ABR31638.1| 16S rRNA processing protein RimM [Thermosipho melanesiensis BI429]
          Length = 178

 Score = 68.2 bits (165), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 46/161 (28%), Positives = 79/161 (49%), Gaps = 8/161 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPI---DLNRYVLYSNDNREL---RILKMYRKNKRFI 61
           V +A +G THGLNGE+ +    N P     L    +Y+   ++L   RI+ M   N  +I
Sbjct: 13  VPIAVLGKTHGLNGELRLFPLTNMPEVIESLEEVFIYNEKVKKLLIGRIIHMSLANGYYI 72

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
             F GID ++ A +     LY ++       L  DE++  ++  M+ +D +G + G +  
Sbjct: 73  VKFRGIDTLNDAKKFVGSTLYIEKSRLPI--LSSDEYYFYEVIGMKVYDEKGIFLGNIDE 130

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
           V   G+  +  I    +   LIP  K  VL+++ + NKI++
Sbjct: 131 VIQTGSNDVFVINKDTKDEILIPVIKEYVLQIDKKSNKIVV 171


>gi|115377061|ref|ZP_01464277.1| 16S rRNA processing protein RimM [Stigmatella aurantiaca DW4/3-1]
 gi|115365900|gb|EAU64919.1| 16S rRNA processing protein RimM [Stigmatella aurantiaca DW4/3-1]
          Length = 163

 Score = 68.2 bits (165), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 72/159 (45%), Gaps = 8/159 (5%)

Query: 13  IGTTHGLNGEVYIDSYANNPIDLNRYV------LYSNDNRELRILKMYRKNKRFIATFSG 66
           +   HG+ GE+ I ++   P   +  V        + + R LRI  +    K  I    G
Sbjct: 1   MARAHGIRGEIAIRTFEXRPRRRSMVVERLSVRTRAGEERVLRIEDVRPTPKENIVALEG 60

Query: 67  IDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFG 126
           +D   +A  L    ++A R+D   E  +E EFF  DL  +   D  G+  G V  ++N G
Sbjct: 61  VDTREAAEALVGAAVFAYREDL--EPPQEGEFFQGDLVGLTAVDEAGQALGTVEEIWNTG 118

Query: 127 AGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPI 165
               L I++  +   ++PF    V  V+L + KI+I P+
Sbjct: 119 EVPNLVIRSAGQAELIVPFADEFVPSVDLPQGKIVIRPL 157


>gi|310821319|ref|YP_003953677.1| ribosome maturation factor rimm [Stigmatella aurantiaca DW4/3-1]
 gi|309394391|gb|ADO71850.1| Ribosome maturation factor RimM [Stigmatella aurantiaca DW4/3-1]
          Length = 173

 Score = 68.2 bits (165), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 44/158 (27%), Positives = 75/158 (47%), Gaps = 7/158 (4%)

Query: 13  IGTTHGLNGEVYIDSY--ANNPIDLNRYV---LYSNDNRELRILKMYRKNKRFIATFSGI 67
           +   HG+ GE+ I ++  A+  +D+   +     + + R LRI  +    K  I    G+
Sbjct: 12  VARAHGIRGEIAIRTFDAASEALDVVERLSVRTRAGEERVLRIEDVRPTPKENIVALEGV 71

Query: 68  DNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFGA 127
           D   +A  L    ++A R+D   E  +E EFF  DL  +   D  G+  G V  ++N G 
Sbjct: 72  DTREAAEALVGAAVFAYREDL--EPPQEGEFFQGDLVGLTAVDEAGQALGTVEEIWNTGE 129

Query: 128 GSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPI 165
              L I++  +   ++PF    V  V+L + KI+I P+
Sbjct: 130 VPNLVIRSAGQAELIVPFADEFVPSVDLPQGKIVIRPL 167


>gi|15644316|ref|NP_229368.1| 16S rRNA processing protein, putative [Thermotoga maritima MSB8]
 gi|148270354|ref|YP_001244814.1| 16S rRNA processing protein RimM [Thermotoga petrophila RKU-1]
 gi|170289020|ref|YP_001739258.1| 16S rRNA processing protein RimM [Thermotoga sp. RQ2]
 gi|6685868|sp|Q9X1Q4|RIMM_THEMA RecName: Full=Ribosome maturation factor rimM
 gi|166226486|sp|A5IM15|RIMM_THEP1 RecName: Full=Ribosome maturation factor rimM
 gi|4982137|gb|AAD36635.1|AE001802_4 16S rRNA processing protein, putative [Thermotoga maritima MSB8]
 gi|147735898|gb|ABQ47238.1| 16S rRNA processing protein RimM [Thermotoga petrophila RKU-1]
 gi|170176523|gb|ACB09575.1| 16S rRNA processing protein RimM [Thermotoga sp. RQ2]
          Length = 176

 Score = 68.2 bits (165), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 88/164 (53%), Gaps = 9/164 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNP---IDLNRYVLYSNDNRE---LRILKMYRKN 57
           L++ V +  I  THGL GEV    Y N+     +L+  VLY+++ +    L +  + R N
Sbjct: 9   LNERVAIGKIVNTHGLKGEVKFFPYTNSEEIVKNLSSVVLYNSEKKAFYNLTVESVRRMN 68

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
           K F+  F  ID I +A  ++  +++ K ++    +L EDE++  ++ + + F   G+  G
Sbjct: 69  KLFLIRFKSIDTIEAAERIKGCEVFIKYEELP--KLSEDEYYFYEILDCDVFYESGENVG 126

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKIL 161
           +V  +   G+  +L ++   ++T LIP TK  ++E++    KI+
Sbjct: 127 KVVDIIETGSNDVLVVRKKKKET-LIPMTKDCIVEIDKGAKKII 169


>gi|157825607|ref|YP_001493327.1| 16S rRNA-processing protein RimM [Rickettsia akari str. Hartford]
 gi|166226473|sp|A8GN44|RIMM_RICAH RecName: Full=Ribosome maturation factor rimM
 gi|157799565|gb|ABV74819.1| 16S rRNA-processing protein [Rickettsia akari str. Hartford]
          Length = 165

 Score = 68.2 bits (165), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 74/149 (49%), Gaps = 5/149 (3%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKR- 59
           M  L+ L+L+  I + HG+ G V + S+      +    L  N++RE   +++  +N + 
Sbjct: 1   MNSLENLILVGVIKSCHGIKGHVILKSFTEPATKILAKNLV-NESREDIHIQLISQNAKG 59

Query: 60  -FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
             I  F+ I   + A  L+  K++  R      E  EDEF+  DL  +   D   K  G+
Sbjct: 60  ELICRFNDITTRNEAENLKGYKIFCLRASLP--EPAEDEFYIADLNHLPVLDPNHKEIGK 117

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTK 147
           +  + NFGAG I+EI+   + T L+PF K
Sbjct: 118 IKNILNFGAGDIIEIEFLDQTTELLPFNK 146


>gi|149184774|ref|ZP_01863092.1| 16S rRNA processing protein [Erythrobacter sp. SD-21]
 gi|148832094|gb|EDL50527.1| 16S rRNA processing protein [Erythrobacter sp. SD-21]
          Length = 161

 Score = 67.8 bits (164), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 47/147 (31%), Positives = 72/147 (48%), Gaps = 5/147 (3%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKR-FIAT 63
           D  V +A +   HG+ GEV +  +      L  +   S +   L + K+   NK   IA 
Sbjct: 3   DTPVTLAAVTGAHGVAGEVRLKLFGEGLEGLKPH--KSFNEGALTLSKLRSDNKGGAIAR 60

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F+ + +  +A +LR   L   R+      LEE EF+ +DL  +      G+  G+VC V 
Sbjct: 61  FAEVADRTAAEKLRGTVLTVPREALP--ALEEGEFYYSDLLGLPVVTDTGEAVGRVCAVE 118

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAV 150
           NFGA  I+EI+    K F++P T+ AV
Sbjct: 119 NFGATEIVEIEKPDGKKFMVPLTRQAV 145


>gi|167769123|ref|ZP_02441176.1| hypothetical protein ANACOL_00446 [Anaerotruncus colihominis DSM
           17241]
 gi|167668763|gb|EDS12893.1| hypothetical protein ANACOL_00446 [Anaerotruncus colihominis DSM
           17241]
          Length = 185

 Score = 67.8 bits (164), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 74/157 (47%), Gaps = 7/157 (4%)

Query: 13  IGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNR--ELRILKMYRKNKRF-IATFSGIDN 69
           I TTHG+ GEV +  + + P  L ++     D R  + R+++  R +K   I  F G++N
Sbjct: 26  IVTTHGVRGEVRVQPWCDTPGFLTQFACLYLDARGSQARVVERARVHKNIVIVKFEGVEN 85

Query: 70  IHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQ-GKYWGQVCGVYNFGAG 128
           +  A+ LR   +Y  R D    ELEE E F  DL      D   G  +GQV  V   GA 
Sbjct: 86  VEDAAGLRGKTVYIDRADV---ELEEGECFVQDLIGCTVRDADTGADYGQVYDVRATGAN 142

Query: 129 SILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPI 165
            +  +++   +  L+P     VL  +L    I I P+
Sbjct: 143 DVYYLRDAAGRERLVPAIADVVLAKDLDAGIITIRPL 179


>gi|291542203|emb|CBL15313.1| 16S rRNA processing protein RimM [Ruminococcus bromii L2-63]
          Length = 171

 Score = 67.0 bits (162), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 49/153 (32%), Positives = 76/153 (49%), Gaps = 6/153 (3%)

Query: 16  THGLNGEVYIDSYANNPIDLNRYV-LYSNDNRELRILKMYRKNKRF-IATFSGIDNIHSA 73
           THG+ GEV ID + ++P  L  +  L+ ++N    I    R +K   +A   G+D I +A
Sbjct: 14  THGIKGEVRIDPWCDSPEFLCAFKKLWLDENGTEFIEVKSRPHKNIALAKIKGVDTIEAA 73

Query: 74  SELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDR-QGKYWGQVCGVYNFGAGSILE 132
            + R   +Y  R D     L E   F  DL  +E  D   G+ +G++  V   GA  + E
Sbjct: 74  EKYRGKVVYINRDDI---NLAEGVHFVQDLIGLEVKDAGNGRVYGKISDVLRTGANDVYE 130

Query: 133 IKNTMEKTFLIPFTKFAVLEVNLQENKILIDPI 165
           IK+   KT+L P     V E+N+ +  +LI P+
Sbjct: 131 IKDADGKTYLAPVIDDVVKEINVNDGYVLIVPM 163


>gi|70726676|ref|YP_253590.1| 16S rRNA-processing protein RimM [Staphylococcus haemolyticus
           JCSC1435]
 gi|109893054|sp|Q4L5U1|RIMM_STAHJ RecName: Full=Ribosome maturation factor rimM
 gi|68447400|dbj|BAE04984.1| probable 16S rRNA processing protein [Staphylococcus haemolyticus
           JCSC1435]
          Length = 167

 Score = 67.0 bits (162), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 52/171 (30%), Positives = 87/171 (50%), Gaps = 14/171 (8%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY-------VLYSNDNRELRILKMYRKNKRF 60
           V +  I  THG+ GEV + S  N+     R+       V + N   +L +L  YR +K F
Sbjct: 3   VEVGQIVNTHGIKGEVKVKS--NSDFTDTRFQPGEVLTVNHQNHEEQLTVLS-YRVHKGF 59

Query: 61  -IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +  F GI+NI+   + +   LY +R D +D EL E+E++ +D+     FD   +  G+V
Sbjct: 60  HMLKFEGINNINDVEQYKGDYLYQER-DHEDIELAENEYYYSDIIGSTVFDNDNQPIGRV 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
             ++  GA  +  +K   EK +LIP+    V E++++   I I P+   L+
Sbjct: 119 INIFETGANDVWVVKG--EKEYLIPYIADVVKEIDIENKTIRITPMEGLLD 167


>gi|268609627|ref|ZP_06143354.1| putative 16S rRNA processing protein [Ruminococcus flavefaciens
           FD-1]
          Length = 167

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 51/156 (32%), Positives = 78/156 (50%), Gaps = 7/156 (4%)

Query: 13  IGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNK-RFIATFSGIDNI 70
           I TTHG+ GEV I  Y ++P  L  +  L+   NR+  I+   R  K   IA   G+D  
Sbjct: 11  IVTTHGIRGEVKIMPYTDSPELLAEFDRLFIGKNRDEVIITRSRVFKNTVIAKIEGVDTP 70

Query: 71  HSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQ-GKYWGQVCGVYNFGAGS 129
            +A +LR+  LY  R D    EL++D +F  DL  +E  D    K +G++  V   GA  
Sbjct: 71  EAAEKLRNKVLYMHRDDL---ELDDDTYFIQDLIGLEVRDADTDKVYGKIADVLETGAND 127

Query: 130 ILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPI 165
           +  IK   ++ +LIP     V+  ++  N + I P+
Sbjct: 128 VYVIKGE-DREYLIPAIADVVVSTDIDNNLMTIRPL 162


>gi|56417251|ref|YP_154325.1| 16S rRNA processing protein [Anaplasma marginale str. St. Maries]
 gi|222475615|ref|YP_002564032.1| 16S rRNA processing protein (rimM) [Anaplasma marginale str.
           Florida]
 gi|56388483|gb|AAV87070.1| 16S rRNA processing protein [Anaplasma marginale str. St. Maries]
 gi|222419753|gb|ACM49776.1| 16S rRNA processing protein (rimM) [Anaplasma marginale str.
           Florida]
          Length = 190

 Score = 66.6 bits (161), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/156 (25%), Positives = 78/156 (50%), Gaps = 6/156 (3%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNK-R 59
           MV+ D +VL+  +   HG+ G V + ++  +P  ++ Y   ++ +    +  +       
Sbjct: 20  MVRGD-MVLLGVVRAPHGVMGLVKVRTFTEDPSHISAYGPLTDGHNCFNVTVVSVLGADS 78

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            IA F G+ +   + +LR  +LY  R       L+EDEF+  +L  M+     G  +G +
Sbjct: 79  VIAKFDGLSSRTESEKLRGKRLYVSRSSLP--RLQEDEFYENELIGMDAKLEDGTAYGVI 136

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTK--FAVLEV 153
             + NFG+  I+E+  +  K  ++PF++  F V++V
Sbjct: 137 SAILNFGSCDIIELSTSTGKVVMVPFSRSTFPVVDV 172


>gi|127511997|ref|YP_001093194.1| 16S rRNA-processing protein [Shewanella loihica PV-4]
 gi|171855242|sp|A3QBT7|RIMM_SHELP RecName: Full=Ribosome maturation factor rimM
 gi|126637292|gb|ABO22935.1| 16S rRNA processing protein RimM [Shewanella loihica PV-4]
          Length = 176

 Score = 66.6 bits (161), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 82/166 (49%), Gaps = 12/166 (7%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRKNKRFIAT 63
           V++  +G +HG+ G + I SY ++  D+  Y  +      + RE+++ +   + K  IA 
Sbjct: 8   VVLGKLGASHGIKGWLKITSYTDSVEDIFDYSPWLIKEQGEWREVKVAQWRYQGKAIIAA 67

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
             G+     A  L + ++    +  K   L EDEF+  DL   E  + +G   G+V  + 
Sbjct: 68  LEGVTTRDQAQMLTNCEIAIPAEAMK--ALPEDEFYWRDLIGCEVVNTKGYKMGKVDQIV 125

Query: 124 NFGAGSILEIKNTMEKTF-----LIPF-TKFAVLEVNLQENKILID 163
             G+  +L +K   +  F     +IPF T+  +LEVNL E +IL+D
Sbjct: 126 ETGSNDVLLVKANAKDGFGKTERMIPFVTEQFILEVNLAEKQILVD 171


>gi|153810633|ref|ZP_01963301.1| hypothetical protein RUMOBE_01017 [Ruminococcus obeum ATCC 29174]
 gi|149833029|gb|EDM88111.1| hypothetical protein RUMOBE_01017 [Ruminococcus obeum ATCC 29174]
          Length = 168

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 51/167 (30%), Positives = 85/167 (50%), Gaps = 14/167 (8%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNP---IDLNRYVLYSNDNRELRILKMYRKNKRF 60
           ++ L+ +  I TTHG+ GEV +    + P   +DL  YVL     +ELR L +  KN RF
Sbjct: 1   MEDLLKVGVITTTHGVRGEVKVYPTTDEPERFLDL-EYVLLDT-GKELRRLDI--KNVRF 56

Query: 61  -----IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
                I  F GIDNI+   + +   L+  R++   +EL+EDE++  DL  M+     G  
Sbjct: 57  FKNLVILKFDGIDNINDIEKYKGRDLWIPREEA--QELDEDEYYIADLLGMKVLLEDGSE 114

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
           +G +  V   GA  +  + +      L+P  K  +L+V+++ N + +
Sbjct: 115 FGTLKNVMETGANDVYIVDSVEHGEVLLPAIKECILDVDIETNTMTV 161


>gi|269958359|ref|YP_003328146.1| 16S rRNA processing protein [Anaplasma centrale str. Israel]
 gi|67461308|sp|Q5P9G0|RIMM_ANAMM RecName: Full=Ribosome maturation factor rimM
 gi|269848188|gb|ACZ48832.1| 16S rRNA processing protein [Anaplasma centrale str. Israel]
          Length = 171

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/156 (25%), Positives = 78/156 (50%), Gaps = 6/156 (3%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNK-R 59
           MV+ D +VL+  +   HG+ G V + ++  +P  ++ Y   ++ +    +  +       
Sbjct: 1   MVRGD-MVLLGVVRAPHGVMGLVKVRTFTEDPSHISAYGPLTDGHNCFNVTVVSVLGADS 59

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            IA F G+ +   + +LR  +LY  R       L+EDEF+  +L  M+     G  +G +
Sbjct: 60  VIAKFDGLSSRTESEKLRGKRLYVSRSSLP--RLQEDEFYENELIGMDAKLEDGTAYGVI 117

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTK--FAVLEV 153
             + NFG+  I+E+  +  K  ++PF++  F V++V
Sbjct: 118 SAILNFGSCDIIELSTSTGKVVMVPFSRSTFPVVDV 153


>gi|258542791|ref|YP_003188224.1| ribosomal RNA small subunit 16S rRNA processing protein RimM
           [Acetobacter pasteurianus IFO 3283-01]
 gi|256633869|dbj|BAH99844.1| ribosomal RNA small subunit 16S rRNA processing protein RimM
           [Acetobacter pasteurianus IFO 3283-01]
 gi|256636928|dbj|BAI02897.1| ribosomal RNA small subunit 16S rRNA processing protein RimM
           [Acetobacter pasteurianus IFO 3283-03]
 gi|256639981|dbj|BAI05943.1| ribosomal RNA small subunit 16S rRNA processing protein RimM
           [Acetobacter pasteurianus IFO 3283-07]
 gi|256643037|dbj|BAI08992.1| ribosomal RNA small subunit 16S rRNA processing protein RimM
           [Acetobacter pasteurianus IFO 3283-22]
 gi|256646092|dbj|BAI12040.1| ribosomal RNA small subunit 16S rRNA processing protein RimM
           [Acetobacter pasteurianus IFO 3283-26]
 gi|256649145|dbj|BAI15086.1| ribosomal RNA small subunit 16S rRNA processing protein RimM
           [Acetobacter pasteurianus IFO 3283-32]
 gi|256652132|dbj|BAI18066.1| ribosomal RNA small subunit 16S rRNA processing protein RimM
           [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256655189|dbj|BAI21116.1| ribosomal RNA small subunit 16S rRNA processing protein RimM
           [Acetobacter pasteurianus IFO 3283-12]
          Length = 180

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 84/170 (49%), Gaps = 32/170 (18%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIATFSG 66
           L+LM  +G  HG+ G V + +YA NP  L +     +D           + +++  ++ G
Sbjct: 5   LILMGVVGKPHGVRGLVRVRAYAENPQTLEQCGALQDD-----------QGRKWFLSWRG 53

Query: 67  IDNIH--------------SASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQ 112
            D++               +A  L + +LY  R    +   EE+EF++ DL  ME F+  
Sbjct: 54  ADSVAELRDANGAPLADRDAAQALVNTRLYVPRAALPEP--EEEEFYHADLIGMEAFE-N 110

Query: 113 GKYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
           G   G+V  V+++GAG+ LE+ +      L+PFT+  V EV+L++  I +
Sbjct: 111 GLSLGRVVMVHDYGAGASLELSDGS----LVPFTQACVPEVHLKQRTITV 156


>gi|219682748|ref|YP_002469131.1| 16S rRNA processing protein RimM [Bifidobacterium animalis subsp.
           lactis AD011]
 gi|219620398|gb|ACL28555.1| 16S rRNA processing protein RimM [Bifidobacterium animalis subsp.
           lactis AD011]
          Length = 217

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 53/185 (28%), Positives = 89/185 (48%), Gaps = 34/185 (18%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDN-----RELRILKMYRK 56
           +L+ +  IG   GL GEV ++ Y ++P    R+    VLY+ ++     R   +      
Sbjct: 14  ELLRVCRIGKAQGLKGEVSVELYTDDP--HARFAPGEVLYARESAADALRPYTVAAARTF 71

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETF------- 109
             R+   F G+D+ ++A  LR+  LY + Q     EL++DEF+  DL  +E +       
Sbjct: 72  KNRWYVRFEGVDDRNAAEALRNTVLYGEPQ-----ELDDDEFYPKDLLGLEVYLESEVSA 126

Query: 110 -----DRQGKYW-----GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENK 159
                  +G  +     G+V  V   GA  +L+I+    + FL+PF +  V EVNL+E  
Sbjct: 127 ANADDAPEGAEFEFTDLGKVVDVIE-GAQWLLKIRMPNREAFLLPFVEALVPEVNLEEGY 185

Query: 160 ILIDP 164
           + +DP
Sbjct: 186 LTVDP 190


>gi|220931576|ref|YP_002508484.1| 16S rRNA processing protein RimM [Halothermothrix orenii H 168]
 gi|254797752|sp|B8CW20|RIMM_HALOH RecName: Full=Ribosome maturation factor rimM
 gi|219992886|gb|ACL69489.1| 16S rRNA processing protein RimM [Halothermothrix orenii H 168]
          Length = 170

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 83/170 (48%), Gaps = 7/170 (4%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNP--IDLNRYVLYSNDNR--ELRILKMYRKNKRF 60
           DK++ +  + T  G  GEV +    + P   +L   V    DNR  E R+ ++    K  
Sbjct: 3   DKMITIGKVTTHQGNKGEVRVLPLTDYPERFELLEQVFLVRDNRVIEKRVEQIRFHKKFV 62

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           I  F GID+I +A   +D  +   R++  D  L E  +F  +L   E +  +G + G+V 
Sbjct: 63  IIKFEGIDDIGAALAYKDYFIKIPREETLD--LPEGHYFIFELLGFEVYTDEGIFLGKVV 120

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
            +   G   I+++K   +K +++P  +  V+ +N  E KI+I PI   L+
Sbjct: 121 DIITTGGTDIIKVKGD-KKDYMVPAAREIVVNINPDEEKIIIKPIPGLLD 169


>gi|218283555|ref|ZP_03489545.1| hypothetical protein EUBIFOR_02135 [Eubacterium biforme DSM 3989]
 gi|218215823|gb|EEC89361.1| hypothetical protein EUBIFOR_02135 [Eubacterium biforme DSM 3989]
          Length = 162

 Score = 65.9 bits (159), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 86/161 (53%), Gaps = 11/161 (6%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNRELRILKMYRKNKRF-I 61
           ++ +A I  THGL GE  +    ++P   +R+    VL+  D R L +++ YR+ K F  
Sbjct: 1   MIKVAQIINTHGLKGECKLYLVTDDP--QHRFEKGRVLHLEDGRTLTVVR-YREQKGFGY 57

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
             F GID+I  A +L+   L+  + D    ELEE +++  +L     ++ + +  G+V  
Sbjct: 58  CYFEGIDSIEKAEQLKTKNLFIAQDDLP--ELEEGQYYYHELMNCTVYNEKKENLGEVVD 115

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
           +   GA  +L +K +   +FL+PF    +++VN   ++I+I
Sbjct: 116 ILETGANLVLRVK-SKNTSFLLPFVPAFIVDVNKDTHEIII 155


>gi|183601833|ref|ZP_02963202.1| probable 16S rRNA-processing protein rimM [Bifidobacterium animalis
           subsp. lactis HN019]
 gi|241190324|ref|YP_002967718.1| 16S rRNA-processing protein rimM [Bifidobacterium animalis subsp.
           lactis Bl-04]
 gi|241195730|ref|YP_002969285.1| 16S rRNA-processing protein rimM [Bifidobacterium animalis subsp.
           lactis DSM 10140]
 gi|183218718|gb|EDT89360.1| probable 16S rRNA-processing protein rimM [Bifidobacterium animalis
           subsp. lactis HN019]
 gi|240248716|gb|ACS45656.1| 16S rRNA-processing protein rimM [Bifidobacterium animalis subsp.
           lactis Bl-04]
 gi|240250284|gb|ACS47223.1| 16S rRNA-processing protein rimM [Bifidobacterium animalis subsp.
           lactis DSM 10140]
 gi|289178045|gb|ADC85291.1| RimM [Bifidobacterium animalis subsp. lactis BB-12]
 gi|295793311|gb|ADG32846.1| 16S rRNA-processing protein rimM [Bifidobacterium animalis subsp.
           lactis V9]
          Length = 219

 Score = 65.9 bits (159), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 53/185 (28%), Positives = 89/185 (48%), Gaps = 34/185 (18%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDN-----RELRILKMYRK 56
           +L+ +  IG   GL GEV ++ Y ++P    R+    VLY+ ++     R   +      
Sbjct: 16  ELLRVCRIGKAQGLKGEVSVELYTDDP--HARFAPGEVLYARESAADALRPYTVAAARTF 73

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETF------- 109
             R+   F G+D+ ++A  LR+  LY + Q     EL++DEF+  DL  +E +       
Sbjct: 74  KNRWYVRFEGVDDRNAAEALRNTVLYGEPQ-----ELDDDEFYPKDLLGLEVYLESEVSA 128

Query: 110 -----DRQGKYW-----GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENK 159
                  +G  +     G+V  V   GA  +L+I+    + FL+PF +  V EVNL+E  
Sbjct: 129 ANADDAPEGAEFEFTDLGKVVDVIE-GAQWLLKIRMPNREAFLLPFVEALVPEVNLEEGY 187

Query: 160 ILIDP 164
           + +DP
Sbjct: 188 LTVDP 192


>gi|145296016|ref|YP_001138837.1| 16S rRNA-processing protein RimM [Corynebacterium glutamicum R]
 gi|166226437|sp|A4QFB9|RIMM_CORGB RecName: Full=Ribosome maturation factor rimM
 gi|140845936|dbj|BAF54935.1| hypothetical protein [Corynebacterium glutamicum R]
          Length = 171

 Score = 65.9 bits (159), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 46/156 (29%), Positives = 78/156 (50%), Gaps = 13/156 (8%)

Query: 16  THGLNGEVYIDSYANNPIDLNRYVL-------YSNDNRELRILKMYRKNKRFIATFSGID 68
           +HG+ GEV ++   ++P D+ R+ +        +     L I        R +  F+ + 
Sbjct: 15  SHGIRGEVVVELSTDDP-DI-RFAIGEVLNGKQAGKEHSLTIDAARMHQGRLLVKFAEVP 72

Query: 69  NIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFGAG 128
           +  +A  LR  + +A     +DE+ +ED F++ +LE +     +G+  G+V GV +  AG
Sbjct: 73  DRTAADSLRGTRFFAA--PLEDED-DEDGFYDHELESLRVI-HEGEDIGEVTGVMHGPAG 128

Query: 129 SILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
            ILE++ T  K  LIPF    V EV+L+E    I P
Sbjct: 129 EILEVRLTSGKETLIPFVHAIVPEVDLEEGTATITP 164


>gi|170725616|ref|YP_001759642.1| 16S rRNA-processing protein RimM [Shewanella woodyi ATCC 51908]
 gi|238688673|sp|B1KI69|RIMM_SHEWM RecName: Full=Ribosome maturation factor rimM
 gi|169810963|gb|ACA85547.1| 16S rRNA processing protein RimM [Shewanella woodyi ATCC 51908]
          Length = 176

 Score = 65.9 bits (159), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 46/166 (27%), Positives = 84/166 (50%), Gaps = 12/166 (7%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRKNKRFIAT 63
           V++  IG++HG+ G + I +Y  +   +  Y  +      + RE+++ +   + K  +A+
Sbjct: 8   VVLGKIGSSHGIKGWLKITTYTESVEGIFDYSPWLIKEQGEWREVKVTQWRFQGKAVVAS 67

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
             G++    A  L + ++    +    +EL EDEF+  DL   E  + +G   G+V  + 
Sbjct: 68  LEGVETRDQAQMLTNCEIAVSAEQM--QELPEDEFYWRDLIGCEVTNTKGYNMGKVQEIV 125

Query: 124 NFGAGSILEIKNTMEKTF-----LIPF-TKFAVLEVNLQENKILID 163
             G+  +L +K   +  F     +IPF T+  VLEVNL E +IL+D
Sbjct: 126 ETGSNDVLLVKANAKDGFGKAERMIPFVTEQFVLEVNLTEKQILVD 171


>gi|172057908|ref|YP_001814368.1| 16S rRNA processing protein RimM [Exiguobacterium sibiricum 255-15]
 gi|229564322|sp|B1YIM5|RIMM_EXIS2 RecName: Full=Ribosome maturation factor rimM
 gi|171990429|gb|ACB61351.1| 16S rRNA processing protein RimM [Exiguobacterium sibiricum 255-15]
          Length = 169

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 48/163 (29%), Positives = 80/163 (49%), Gaps = 8/163 (4%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDL----NRYVLYSNDNRELRILKMYRKNKRFI-ATF 64
           +A I  THGL GE+ + +  + P       N   L SN      ++  YRK+K+FI  TF
Sbjct: 6   VAKIANTHGLKGELKLLASTDFPEQRFKVGNEVFLESNGIYTPFMISSYRKHKQFIMVTF 65

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
            G+ +I+   + + LKLY   +    +EL E EF+  ++     FD + +  G V  +  
Sbjct: 66  KGMQHINDVEKYKGLKLYVHPEAL--QELGEHEFYYHEIIGCTVFDGEDEI-GVVSEILE 122

Query: 125 FGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAA 167
            GA  +  IK   +K  LIP+ +  V  ++++  +I I P+  
Sbjct: 123 TGANDVWTIKRPGKKDVLIPYIEQVVASIDVEAKRIQITPLPG 165


>gi|326388658|ref|ZP_08210251.1| 16S rRNA processing protein RimM [Novosphingobium nitrogenifigens
           DSM 19370]
 gi|326206909|gb|EGD57733.1| 16S rRNA processing protein RimM [Novosphingobium nitrogenifigens
           DSM 19370]
          Length = 163

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 42/151 (27%), Positives = 69/151 (45%), Gaps = 3/151 (1%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFI 61
           + +D+ V +A +   HG+ G+V +  +      L RY  ++        L+   K    +
Sbjct: 1   MSIDRPVTLAAVIGAHGVTGDVRLKLFGEGVAALKRYKAFNGGTLTPVSLRDDGKGGA-L 59

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
           A F+   +  +A +LR   L   R       L E E+++ DL  +     +G+  G    
Sbjct: 60  ARFAEAGDRTAAEKLRGTALTVPRSALP--PLAEGEYYHADLIGLAVVSGEGEALGTCVA 117

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLE 152
           V NFGAG +LEI+    K F++P    AVLE
Sbjct: 118 VDNFGAGDVLEIRRPDGKAFMVPMRPEAVLE 148


>gi|19553253|ref|NP_601255.1| 16S rRNA-processing protein RimM [Corynebacterium glutamicum ATCC
           13032]
 gi|62390889|ref|YP_226291.1| 16S rRNA-processing protein RimM [Corynebacterium glutamicum ATCC
           13032]
 gi|24418639|sp|Q8NNX5|RIMM_CORGL RecName: Full=Ribosome maturation factor rimM
 gi|21324822|dbj|BAB99445.1| RimM protein, required for 16S rRNA processing [Corynebacterium
           glutamicum ATCC 13032]
 gi|41326228|emb|CAF20390.1| RIMM PROTEIN (16S RRNA PROCESSING PROTEIN) [Corynebacterium
           glutamicum ATCC 13032]
          Length = 171

 Score = 65.1 bits (157), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 46/156 (29%), Positives = 78/156 (50%), Gaps = 13/156 (8%)

Query: 16  THGLNGEVYIDSYANNPIDLNRYVL-------YSNDNRELRILKMYRKNKRFIATFSGID 68
           +HG+ GEV ++   ++P D+ R+ +        +     L I        R +  F+ + 
Sbjct: 15  SHGIRGEVVVELSTDDP-DI-RFAIGEVLNGKQAGKEHSLTIDAARMHQGRLLVKFAEVP 72

Query: 69  NIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFGAG 128
           +  +A  LR  + +A     +DE+ +ED F++ +LE +     +G+  G+V GV +  AG
Sbjct: 73  DRTAADSLRGTRFFAA--PLEDED-DEDGFYDHELEGLRVI-HEGEDIGEVTGVMHGPAG 128

Query: 129 SILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
            ILE++ T  K  LIPF    V EV+L+E    I P
Sbjct: 129 EILEVRLTSGKETLIPFVHAIVPEVDLEEGTATITP 164


>gi|255003608|ref|ZP_05278572.1| 16S rRNA processing protein (rimM) [Anaplasma marginale str. Puerto
           Rico]
 gi|255004737|ref|ZP_05279538.1| 16S rRNA processing protein (rimM) [Anaplasma marginale str.
           Virginia]
          Length = 166

 Score = 65.1 bits (157), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 74/150 (49%), Gaps = 5/150 (3%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNK-RFIATFS 65
           +VL+  +   HG+ G V + ++  +P  ++ Y   ++ +    +  +        IA F 
Sbjct: 1   MVLLGVVRAPHGVMGLVKVRTFTEDPSHISAYGPLTDGHNCFNVTVVSVLGADSVIAKFD 60

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNF 125
           G+ +   + +LR  +LY  R       L+EDEF+  +L  M+     G  +G +  + NF
Sbjct: 61  GLSSRTESEKLRGKRLYVSRSSLP--RLQEDEFYENELIGMDAKLEDGTAYGVISAILNF 118

Query: 126 GAGSILEIKNTMEKTFLIPFTK--FAVLEV 153
           G+  I+E+  +  K  ++PF++  F V++V
Sbjct: 119 GSCDIIELSTSTGKVVMVPFSRSTFPVVDV 148


>gi|305681419|ref|ZP_07404226.1| 16S rRNA processing protein RimM [Corynebacterium matruchotii ATCC
           14266]
 gi|305659624|gb|EFM49124.1| 16S rRNA processing protein RimM [Corynebacterium matruchotii ATCC
           14266]
          Length = 169

 Score = 65.1 bits (157), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 46/155 (29%), Positives = 74/155 (47%), Gaps = 13/155 (8%)

Query: 17  HGLNGEVYIDSYANNPIDLNRY----VLYSNDNRE---LRILKMYRKNKRFIATFSGIDN 69
           HG+ GEV +D   + P D+ RY    VL+    +    L +        R + TF  + +
Sbjct: 14  HGIRGEVVVDPTTDEP-DI-RYAPGTVLHGKQGKREHTLTVAHARPHQGRLLVTFDEVPD 71

Query: 70  IHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFGAGS 129
             +A  LR  + +A++ D  D+E   + F++ DL  +     +G   G V GV +  AG+
Sbjct: 72  RTAAESLRGTQFWAEQLDIDDDE---EGFYDHDLTGLRVI-HEGAEIGTVTGVMSGPAGT 127

Query: 130 ILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           ILE++    K  L+PF    V EV+L+     I P
Sbjct: 128 ILEVELAGGKQALVPFVFDIVPEVDLEAGTCTITP 162


>gi|23335825|ref|ZP_00121057.1| COG0806: RimM protein, required for 16S rRNA processing
           [Bifidobacterium longum DJO10A]
 gi|189439917|ref|YP_001954998.1| RimM protein for 16S rRNA processing [Bifidobacterium longum
           DJO10A]
 gi|189428352|gb|ACD98500.1| RimM protein for 16S rRNA processing [Bifidobacterium longum
           DJO10A]
 gi|291517401|emb|CBK71017.1| 16S rRNA processing protein RimM [Bifidobacterium longum subsp.
           longum F8]
          Length = 204

 Score = 65.1 bits (157), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 92/186 (49%), Gaps = 30/186 (16%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNRELRILKMYRKNK-RF 60
           +L+ +A IG   GL GEV +  Y ++P    R+    VLYS D     I++  R  K R+
Sbjct: 14  ELLRVARIGRAQGLKGEVTVRLYTDDP--EWRFEPDSVLYSQDGETEYIVEGSRTFKDRW 71

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           I    G+D+ ++A  L  ++LY +  D +D  LE DE++  DL  +E    +G   G   
Sbjct: 72  ILKLEGVDDRNAAEALNGVELYGEADDAEDM-LEADEWYPKDLIGLEARLVEGNGLGLPA 130

Query: 121 G--------VYNFGAGSILEIK--------------NTMEKTFLIPFTKFAVLEVNLQEN 158
           G        V +  A S+L+I+              + +EKT L+PF +  V +++L+E 
Sbjct: 131 GQVVGKVVDVVDSPAQSLLKIRLTEPVVTGQNSKGEDVVEKTALVPFVEALVPDIDLEEQ 190

Query: 159 KILIDP 164
            + +DP
Sbjct: 191 YLTLDP 196


>gi|209573748|sp|B3DTN1|RIMM_BIFLD RecName: Full=Ribosome maturation factor rimM
          Length = 199

 Score = 65.1 bits (157), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 92/186 (49%), Gaps = 30/186 (16%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNRELRILKMYRKNK-RF 60
           +L+ +A IG   GL GEV +  Y ++P    R+    VLYS D     I++  R  K R+
Sbjct: 9   ELLRVARIGRAQGLKGEVTVRLYTDDP--EWRFEPDSVLYSQDGETEYIVEGSRTFKDRW 66

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           I    G+D+ ++A  L  ++LY +  D +D  LE DE++  DL  +E    +G   G   
Sbjct: 67  ILKLEGVDDRNAAEALNGVELYGEADDAEDM-LEADEWYPKDLIGLEARLVEGNGLGLPA 125

Query: 121 G--------VYNFGAGSILEIK--------------NTMEKTFLIPFTKFAVLEVNLQEN 158
           G        V +  A S+L+I+              + +EKT L+PF +  V +++L+E 
Sbjct: 126 GQVVGKVVDVVDSPAQSLLKIRLTEPVVTGQNSKGEDVVEKTALVPFVEALVPDIDLEEQ 185

Query: 159 KILIDP 164
            + +DP
Sbjct: 186 YLTLDP 191


>gi|213691294|ref|YP_002321880.1| 16S rRNA processing protein RimM [Bifidobacterium longum subsp.
           infantis ATCC 15697]
 gi|213522755|gb|ACJ51502.1| 16S rRNA processing protein RimM [Bifidobacterium longum subsp.
           infantis ATCC 15697]
 gi|320457361|dbj|BAJ67982.1| putative 16S rRNA-processing protein [Bifidobacterium longum subsp.
           infantis ATCC 15697]
          Length = 204

 Score = 64.7 bits (156), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 92/186 (49%), Gaps = 30/186 (16%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNRELRILKMYRKNK-RF 60
           +L+ +A IG   GL GEV +  Y ++P    R+    VLYS D     I++  R  K R+
Sbjct: 14  ELLRVARIGRAQGLKGEVTVRLYTDDP--EWRFEPDSVLYSQDGEAEYIVEGSRTFKDRW 71

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           I    G+D+ ++A  L  ++LY +  D +D  LE DE++  DL  +E    +G   G   
Sbjct: 72  ILKLEGVDDRNAAEALNGVELYGEVDDAEDM-LEADEWYPKDLIGLEARLVEGNGLGLPA 130

Query: 121 G--------VYNFGAGSILEIK--------------NTMEKTFLIPFTKFAVLEVNLQEN 158
           G        V +  A S+L+I+              + +EKT L+PF +  V +++L+E 
Sbjct: 131 GQVVGKVVNVVDSPAQSLLKIRLTEPVVTGQNSKGEDVVEKTALVPFVEELVPDIDLEEQ 190

Query: 159 KILIDP 164
            + +DP
Sbjct: 191 YLTLDP 196


>gi|48474469|sp|Q8G7F9|RIMM_BIFLO RecName: Full=Ribosome maturation factor rimM
          Length = 202

 Score = 64.7 bits (156), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 57/196 (29%), Positives = 94/196 (47%), Gaps = 30/196 (15%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNRELRILKMYRKNK-RF 60
           +L+ +A IG   GL GEV +  Y ++P    R+    VLYS D     I++  R  K R+
Sbjct: 9   ELLRVARIGRAQGLKGEVTVRLYTDDP--EWRFEPDSVLYSQDGETEYIVEGSRTFKDRW 66

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           I    G+D+ ++A  L  ++LY +  D +D  LE DE++  DL  +E    +G   G   
Sbjct: 67  ILKLEGVDDRNAAEALNGVELYGEVDDAEDM-LEADEWYPKDLIGLEARLVEGNGLGLPA 125

Query: 121 G--------VYNFGAGSILEIK--------------NTMEKTFLIPFTKFAVLEVNLQEN 158
           G        V +  A S+L+I+              + +EKT L+PF +  V +++L+E 
Sbjct: 126 GQVVGKVVDVVDSPAQSLLKIRLTEPVVTGQNSKGEDVVEKTALVPFVEALVPDIDLEEQ 185

Query: 159 KILIDPIAAGLNNTTM 174
            + +DP    +    M
Sbjct: 186 YLTLDPPGGLIPGCGM 201


>gi|226939294|ref|YP_002794365.1| 16S rRNA-processing protein RimM [Laribacter hongkongensis HLHK9]
 gi|226714218|gb|ACO73356.1| RimM [Laribacter hongkongensis HLHK9]
          Length = 168

 Score = 64.7 bits (156), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 45/166 (27%), Positives = 82/166 (49%), Gaps = 7/166 (4%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDS---YANNPIDLNRYVLYSNDN-RELRILKMYRKN 57
           +K   LV+M  +    G+ G V I +   YA+   D   + +   D+ +E R+++   + 
Sbjct: 1   MKTQDLVVMGYVSGAFGVRGWVRIQADTEYADGLFDYPTWWIGREDSWQEYRVVEGKAQP 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
           K  +A   G+D+   A  LR  ++   R      E  ++EF+  DL  M   +  G  +G
Sbjct: 61  KGVVAQLEGVDDRDVACALRGCEVAIPRSALP--ETGDNEFYWADLIGMAVSNPAGTAFG 118

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
            V  +   GA  +L +++  ++T LIPF K  +L+V+LQ  ++ +D
Sbjct: 119 VVDSLMQTGANDVLVVRDGKQQT-LIPFVKAFILDVDLQARRLTVD 163


>gi|23464908|ref|NP_695511.1| Rim-like protein involved in efficient processing of 16S rRNA
           [Bifidobacterium longum NCC2705]
 gi|23325500|gb|AAN24147.1| possible Rim-like protein involved in efficient processing of 16S
           rRNA [Bifidobacterium longum NCC2705]
          Length = 207

 Score = 64.7 bits (156), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 57/196 (29%), Positives = 94/196 (47%), Gaps = 30/196 (15%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNRELRILKMYRKNK-RF 60
           +L+ +A IG   GL GEV +  Y ++P    R+    VLYS D     I++  R  K R+
Sbjct: 14  ELLRVARIGRAQGLKGEVTVRLYTDDP--EWRFEPDSVLYSQDGETEYIVEGSRTFKDRW 71

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           I    G+D+ ++A  L  ++LY +  D +D  LE DE++  DL  +E    +G   G   
Sbjct: 72  ILKLEGVDDRNAAEALNGVELYGEVDDAEDM-LEADEWYPKDLIGLEARLVEGNGLGLPA 130

Query: 121 G--------VYNFGAGSILEIK--------------NTMEKTFLIPFTKFAVLEVNLQEN 158
           G        V +  A S+L+I+              + +EKT L+PF +  V +++L+E 
Sbjct: 131 GQVVGKVVDVVDSPAQSLLKIRLTEPVVTGQNSKGEDVVEKTALVPFVEALVPDIDLEEQ 190

Query: 159 KILIDPIAAGLNNTTM 174
            + +DP    +    M
Sbjct: 191 YLTLDPPGGLIPGCGM 206


>gi|84498357|ref|ZP_00997154.1| 16S rRNA-processing protein [Janibacter sp. HTCC2649]
 gi|84381857|gb|EAP97740.1| 16S rRNA-processing protein [Janibacter sp. HTCC2649]
          Length = 183

 Score = 64.7 bits (156), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 86/180 (47%), Gaps = 14/180 (7%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYV---LYSND-------NRELRI 50
           M +    +L+A IG  HGL GEV + ++ ++P    RYV   ++  +        R L +
Sbjct: 1   MPRSSNALLVARIGKPHGLRGEVTVQTHTDDP--EARYVPGTVFDTEAQPGTGVPRTLTV 58

Query: 51  LKMYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDE-FFNTDLEEMETF 109
                  + ++  F+ I +   A  LR  +L+    +  + E +ED+ F+  DL  +   
Sbjct: 59  STARLHRQIWLLGFAEIPDRTGAESLRGTQLFLDPDEADEVESDEDDGFYEHDLVGLAVQ 118

Query: 110 DRQGKYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           D  G   G+V G+       +LE++ T  +  L+PF +  V E++++   +++D   AGL
Sbjct: 119 DPSGAVLGEVTGLVLGAVQDLLEVRLTNRRDVLVPFVEAIVTEIDIEAGHVVVD-APAGL 177


>gi|148555570|ref|YP_001263152.1| 16S rRNA processing protein RimM [Sphingomonas wittichii RW1]
 gi|209573622|sp|A5V9P8|RIMM_SPHWW RecName: Full=Ribosome maturation factor rimM
 gi|148500760|gb|ABQ69014.1| 16S rRNA processing protein RimM [Sphingomonas wittichii RW1]
          Length = 157

 Score = 64.3 bits (155), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 43/160 (26%), Positives = 72/160 (45%), Gaps = 10/160 (6%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIATF 64
           D+ +++A I   HGL GEV +  +     D+  Y       R   +  +       +A F
Sbjct: 4   DRPIVLAAIIGAHGLQGEVRLKLFTE---DMGAYRTLDGAGRSFTLKTIRPGPNGAVARF 60

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
           + I + ++A  LR  +L   R       L   E+++ DL  +      G   G    V +
Sbjct: 61  AEIGDRNAAEALRGTELSVPRSALP--PLAPGEYYHVDLIGLPCL-VDGAPVGVAAMVED 117

Query: 125 FGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           FGAG +LEI+    K F++P  K     V ++ +++LIDP
Sbjct: 118 FGAGDVLEIEKPDGKRFMVPVAK----AVTIEPDRLLIDP 153


>gi|222100125|ref|YP_002534693.1| 16S rRNA-processing protein rimM [Thermotoga neapolitana DSM 4359]
 gi|254797769|sp|B9K8P4|RIMM_THENN RecName: Full=Ribosome maturation factor rimM
 gi|221572515|gb|ACM23327.1| 16S rRNA-processing protein rimM [Thermotoga neapolitana DSM 4359]
          Length = 176

 Score = 64.3 bits (155), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 85/165 (51%), Gaps = 9/165 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNP---IDLNRYVLYSNDNR---ELRILKMYRKN 57
           +++ + +  +  THGL GEV    Y N+     +L+  VLY+ + +    L +  + R N
Sbjct: 9   INERIAVGKVVNTHGLKGEVKFFPYTNSEEIVKNLSSVVLYNREKKVFYNLSVESVRRMN 68

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
           K F+  F  ID + +A +++  +++ K ++     L+ DE++  ++   E +   G+  G
Sbjct: 69  KLFLIKFETIDTVEAAEKIKGCEVFIKYEELPP--LQNDEYYFYEILGCEVYYESGECVG 126

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
           +V  +   G+  +L +K    +T LIP  K  V+E+   E KI++
Sbjct: 127 KVVDIIETGSNDVLVVKKKNRET-LIPMIKDCVVEIKKPEKKIVV 170


>gi|163750614|ref|ZP_02157851.1| 16S rRNA-processing protein [Shewanella benthica KT99]
 gi|161329609|gb|EDQ00600.1| 16S rRNA-processing protein [Shewanella benthica KT99]
          Length = 176

 Score = 64.3 bits (155), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 44/166 (26%), Positives = 84/166 (50%), Gaps = 12/166 (7%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRKNKRFIAT 63
           V++  +G++HG+ G + I +Y ++   +  Y  +      + RE+++L+   + K  +A+
Sbjct: 8   VVLGKLGSSHGIKGWLKITTYTDSVEGIFDYSPWLIKEQGEWREVKVLQWRFQGKAVVAS 67

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
             G++    A  L + ++    Q  K   L EDEF+  DL   E  + +G   G+V  + 
Sbjct: 68  LEGVETRDQAQILTNCEIAVTPQQMKT--LPEDEFYWRDLIGCEVVNTKGYNMGKVQEIV 125

Query: 124 NFGAGSILEIKNTMEKTF-----LIPF-TKFAVLEVNLQENKILID 163
             G+  +L +K   +  F     +IPF T+  ++EVNL E +I +D
Sbjct: 126 ETGSNDVLLVKANAKDGFGKAERMIPFVTEQFIIEVNLAEKQITVD 171


>gi|242373531|ref|ZP_04819105.1| 16S rRNA processing protein [Staphylococcus epidermidis M23864:W1]
 gi|242348894|gb|EES40496.1| 16S rRNA processing protein [Staphylococcus epidermidis M23864:W1]
          Length = 167

 Score = 64.3 bits (155), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 49/170 (28%), Positives = 86/170 (50%), Gaps = 12/170 (7%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY------VLYSNDNRELRILKMYRKNKRF- 60
           V +  I  THG+ GEV + S  N+     R+      ++  N+N     +  YR +K F 
Sbjct: 3   VEVGQIVNTHGIKGEVKVKS--NSDFTATRFQPGENLIVKHNNNDIQYTIASYRIHKGFH 60

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +  F GI+NI+    L+   LY +R D +D EL+E E++ +D+     FD      G+V 
Sbjct: 61  MLKFEGINNINDIEHLKGDYLYQER-DHEDIELDEHEYYYSDIIGCTVFDDNNTPIGRVI 119

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
            ++  GA  +  +K   +K +LIP+ +  V +++++   I I P+   L+
Sbjct: 120 NIFETGANDVWVVKG--DKEYLIPYIEDVVKDIDVEGKSIRITPMEGLLD 167


>gi|296453527|ref|YP_003660670.1| 16S rRNA processing protein RimM [Bifidobacterium longum subsp.
           longum JDM301]
 gi|296182958|gb|ADG99839.1| 16S rRNA processing protein RimM [Bifidobacterium longum subsp.
           longum JDM301]
          Length = 204

 Score = 63.9 bits (154), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 93/186 (50%), Gaps = 30/186 (16%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNRELRILKMYRKNK-RF 60
           +L+ +A IG   GL GEV +  Y ++P    R+    VLYS+D     I++  R  K R+
Sbjct: 14  ELLRVARIGRAQGLKGEVTVRLYTDDP--EWRFEPDSVLYSHDGETEYIVEGSRTFKDRW 71

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           I    G+D+ ++A  L  ++LY +  D +D  LE DE++  DL  +E    +G   G   
Sbjct: 72  ILKLEGVDDRNAAEALNGVELYGEVDDAEDM-LEADEWYPKDLIGLEARLVEGNGLGLPA 130

Query: 121 G--------VYNFGAGSILEIK--------------NTMEKTFLIPFTKFAVLEVNLQEN 158
           G        V +  A S+L+I+              + +EKT L+PF +  V +++L+E 
Sbjct: 131 GQVVGKVVDVVDSPAQSLLKIRLTEPVVTGQNSKGEDVVEKTALVPFVEELVPDIDLEEQ 190

Query: 159 KILIDP 164
            + +DP
Sbjct: 191 YLTLDP 196


>gi|54026126|ref|YP_120368.1| 16S rRNA-processing protein RimM [Nocardia farcinica IFM 10152]
 gi|59798616|sp|Q5YS37|RIMM_NOCFA RecName: Full=Ribosome maturation factor rimM
 gi|54017634|dbj|BAD59004.1| putative 16S rRNA processing protein [Nocardia farcinica IFM 10152]
          Length = 174

 Score = 63.9 bits (154), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 76/165 (46%), Gaps = 9/165 (5%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNP-------IDLNRYVLYSNDNRELRILKMYRKNKRF 60
           +++  +  +HG+ GE+ ++   ++P         L   +  S + RE  +      + R 
Sbjct: 3   LVVGRVAKSHGVRGELVVEVRTDDPDARFAEGTVLRGRLPRSTEVREFTVESAREHSGRL 62

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           + + +G+D+  +A  LR         +    + + DEF++ +LE +   D  G   G V 
Sbjct: 63  LVSLAGVDDRSAADALRGTLFVVDSAELPPSD-DPDEFYDHELEGLSVRDTAGAVLGTVT 121

Query: 121 GVYNFGAGSILEIKNTME-KTFLIPFTKFAVLEVNLQENKILIDP 164
            V +  AG +L ++   + +  LIPF    V  V++ E  ++IDP
Sbjct: 122 EVLHSAAGELLSMRAAEDGREILIPFVTAIVPTVSVAEGYVVIDP 166


>gi|294139728|ref|YP_003555706.1| 16S rRNA processing protein RimM [Shewanella violacea DSS12]
 gi|293326197|dbj|BAJ00928.1| 16S rRNA processing protein RimM [Shewanella violacea DSS12]
          Length = 177

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 44/166 (26%), Positives = 84/166 (50%), Gaps = 12/166 (7%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRKNKRFIAT 63
           V++  +G++HG+ G + I +Y ++   +  Y  +      + RE+++L+   + K  +A+
Sbjct: 9   VVLGKLGSSHGIKGWLKITTYTDSVEGIFDYSPWLIKEQGEWREVKVLQWRFQGKAVVAS 68

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
             G++    A  L + ++    Q    E L EDEF+  DL   E  + +G   G+V  + 
Sbjct: 69  LEGVETRDQAQMLTNCEIAVTLQQM--ETLPEDEFYWRDLIGCEVVNTKGYNMGKVQEIV 126

Query: 124 NFGAGSILEIKNTMEKTF-----LIPF-TKFAVLEVNLQENKILID 163
             G+  +L +K   +  F     +IPF T+  ++EVNL E +I +D
Sbjct: 127 ETGSNDVLLVKANAKDGFGKAERMIPFVTEQFIIEVNLTEKQITVD 172


>gi|311739730|ref|ZP_07713565.1| 16S rRNA processing protein RimM [Corynebacterium pseudogenitalium
           ATCC 33035]
 gi|311305546|gb|EFQ81614.1| 16S rRNA processing protein RimM [Corynebacterium pseudogenitalium
           ATCC 33035]
          Length = 165

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 79/164 (48%), Gaps = 15/164 (9%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNRELRIL--KMYRKNK-RF 60
           +++  +  +HG+ GEV +++  + P    R+    VL+    ++   L  K  R +K R 
Sbjct: 3   LMIGRVIKSHGVKGEVVVEATTDEP--EVRFAVGEVLHGTQGKKEHTLTIKAVRSHKGRL 60

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           + TF  I +   A  LR  K +A   D  D     D F++ +LE +     +G+  G+V 
Sbjct: 61  LVTFEEIKDRTVADSLRGTKFFAAPLDSDD-----DGFYDHELEGLRVL-LEGEEIGEVT 114

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
            V + G+  +LEIK    K  LIPF    V EVNL+     IDP
Sbjct: 115 SVIHGGSQDLLEIKLDNNKEALIPFVHAIVPEVNLEAGTCTIDP 158


>gi|269219639|ref|ZP_06163493.1| 16S rRNA processing protein RimM [Actinomyces sp. oral taxon 848
           str. F0332]
 gi|269210881|gb|EEZ77221.1| 16S rRNA processing protein RimM [Actinomyces sp. oral taxon 848
           str. F0332]
          Length = 192

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 75/157 (47%), Gaps = 6/157 (3%)

Query: 10  MATIGTTHGLNGEVYIDSYANNP-IDLNRYVLYSNDNRELRILKMYRKNK---RFIATFS 65
           +A IG  HGL GE+ +D   + P   L    +   D +E   L + R  +      A FS
Sbjct: 5   VAVIGAPHGLKGELRLDVRTDQPERRLGIGAMLETDPQEAGPLTVARTREYKGAIYAMFS 64

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNF 125
              +   A  LR +KL  +    +D+ +EED F+  +L  +E  D +G   G++ G+  F
Sbjct: 65  ECTDRTMAERLRGVKLTVETD--EDDYVEEDAFYEHELVGLEVLDPEGYELGRIIGLETF 122

Query: 126 GAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
            A  +L ++        +PF +  V EV+L +N +++
Sbjct: 123 PAQDMLVVREPDGDVARVPFVREIVTEVDLDDNCVVV 159


>gi|146281576|ref|YP_001171729.1| 16S rRNA-processing protein RimM [Pseudomonas stutzeri A1501]
 gi|166226469|sp|A4VIT6|RIMM_PSEU5 RecName: Full=Ribosome maturation factor rimM
 gi|145569781|gb|ABP78887.1| 16S rRNA processing protein [Pseudomonas stutzeri A1501]
          Length = 178

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 86/167 (51%), Gaps = 10/167 (5%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYAN---NPIDLNRYVLYSNDN-RELRILKMYRKNKRF 60
           D+LV++  I + HG+ G+V + S+ +   N +D  R+ L   D  +++ ++K   + K  
Sbjct: 9   DELVVIGKIVSVHGVRGDVKVYSFTDPIDNLLDYRRWTLRRGDEVKQVELVKGRLQGKIL 68

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +A+  G+ +   A    D ++   R +     L++ E++   L+ ++  ++ G+  GQV 
Sbjct: 69  VASLKGLTDREVARTYADFEICVPRSELP--ALDDGEYYWYQLQGLKVLNQAGQLLGQVD 126

Query: 121 GVYNFGAGSILEIKNTM----EKTFLIPFTKFAVLEVNLQENKILID 163
            +   GA  +L +K       ++  L+P+T   VL+V+L   ++ +D
Sbjct: 127 HLLETGANDVLVVKPCAGSLDDRERLLPYTDHCVLKVDLDSGEMQVD 173


>gi|162148861|ref|YP_001603322.1| 16S rRNA-processing protein rimM [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|189040842|sp|A9HS64|RIMM_GLUDA RecName: Full=Ribosome maturation factor rimM
 gi|161787438|emb|CAP57033.1| putative 16S rRNA-processing protein rimM [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 188

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 76/157 (48%), Gaps = 7/157 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIATFSG- 66
           +LM  +G  HG+ G V + SYA  P DL  Y   ++++ ++  L+        +   +G 
Sbjct: 6   ILMGVVGRPHGVRGLVRVHSYAAVPEDLTAYGALTDEHGQVWSLRWRGDGIAELRDAAGQ 65

Query: 67  -IDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQG--KYWGQVCGVY 123
            +    +A  + + +LY  R      E ++DEF+ TDL  M+    QG     G+V  V+
Sbjct: 66  PLSGRDAAQAMVNRRLYVARTSLP--EPDQDEFYFTDLIGMDV-RAQGTDAPLGRVLVVH 122

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKI 160
           ++GAG  LE+        ++PFT+     V++   +I
Sbjct: 123 DYGAGVSLELGGQGHAPLILPFTRACFPVVDVAAGRI 159


>gi|291456064|ref|ZP_06595454.1| 16S rRNA processing protein RimM [Bifidobacterium breve DSM 20213]
 gi|291382473|gb|EFE89991.1| 16S rRNA processing protein RimM [Bifidobacterium breve DSM 20213]
          Length = 204

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 57/186 (30%), Positives = 89/186 (47%), Gaps = 30/186 (16%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNRELRILKMYRKNK-RF 60
           +L+ +A IG   GL GEV +  Y ++P    R+    VLYS D     I++  R  K R+
Sbjct: 14  ELLRVARIGRAQGLKGEVTVRLYTDDP--EWRFEPDSVLYSQDGETEYIVENSRTFKDRW 71

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           I    G D+  +A  L  ++LY +  D  +E LE DE++  DL  +E    +G   G   
Sbjct: 72  ILKLEGTDDRTAAEALNGVELYGEADD-AEEMLEADEWYPKDLIGLEARLSEGNGLGLPA 130

Query: 121 G--------VYNFGAGSILEIK--------------NTMEKTFLIPFTKFAVLEVNLQEN 158
           G        V +  A S+L+I+              + +EKT L+PF +  V E++L E 
Sbjct: 131 GQVVGKVVDVVDSPAQSLLKIRLVEPVVTGQDSKGEDVIEKTALVPFVEALVPEIDLDEQ 190

Query: 159 KILIDP 164
            + +DP
Sbjct: 191 YLTLDP 196


>gi|257068183|ref|YP_003154438.1| 16S rRNA processing protein RimM [Brachybacterium faecium DSM 4810]
 gi|256559001|gb|ACU84848.1| 16S rRNA processing protein RimM [Brachybacterium faecium DSM 4810]
          Length = 194

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 87/195 (44%), Gaps = 8/195 (4%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-----VLYSNDNRELRILKMYR 55
           M  LD  V++ATIG  HGL GEV +    + P +  +      V  +   R L +     
Sbjct: 1   MSTLD--VIVATIGRAHGLRGEVALTLRTDQPEERLQPGTAFEVEVAGQVRALTVQSTRM 58

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
           +  R+   F  +D+   A+ LR + L       ++ E + D ++   L+ +      G+ 
Sbjct: 59  QQDRWYVRFEEVDDRTGAASLRGIDLVLSLDAEQEAEEDPDAWYPAQLKGLSVRHVDGRE 118

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMK 175
            G V GV ++ A  +L ++    +   +P  +  V EV+L++  ++ DP   GL +   +
Sbjct: 119 LGTVAGVDHYPAQDLLVVRTPDRRRVQLPLVEELVPEVDLEQGVVIADP-PGGLFDALPE 177

Query: 176 NPQYDCPLDSAGKKS 190
           + Q   P  SA  + 
Sbjct: 178 DEQGPEPETSAPPRG 192


>gi|304320474|ref|YP_003854117.1| putative 16S rRNA processing protein [Parvularcula bermudensis
           HTCC2503]
 gi|303299376|gb|ADM08975.1| putative 16S rRNA processing protein [Parvularcula bermudensis
           HTCC2503]
          Length = 187

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 78/164 (47%), Gaps = 7/164 (4%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKR--FI 61
           D++V++      HG+ GE  + S+     D+  Y  LY+ + R L    + R+ K   F+
Sbjct: 7   DRMVVVGQFAGPHGVRGEFKLRSFTERAEDIVAYGPLYTEEGRIL-TASLLREVKPGLFL 65

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
           A    +     A+  +  KL   R+     +  EDE++  DL  +      G+  G+V  
Sbjct: 66  ARAPEVKTPEEAAAFKGAKLSVPRRALPAPD--EDEYYIEDLIGLTALTPSGEVVGRVRQ 123

Query: 122 VYNFGAGSILEIKNTMEK-TFLIPFTKFAVLEVNLQENKILIDP 164
           V ++GAG I+E+     K   L+PF +  V  V+   +++++DP
Sbjct: 124 VADYGAGPIIELAPVSGKGALLLPFDRTHVPTVDFGASRLIVDP 167


>gi|225022024|ref|ZP_03711216.1| hypothetical protein CORMATOL_02056 [Corynebacterium matruchotii
           ATCC 33806]
 gi|224945221|gb|EEG26430.1| hypothetical protein CORMATOL_02056 [Corynebacterium matruchotii
           ATCC 33806]
          Length = 169

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 45/155 (29%), Positives = 74/155 (47%), Gaps = 13/155 (8%)

Query: 17  HGLNGEVYIDSYANNPIDLNRY----VLYSNDNRE---LRILKMYRKNKRFIATFSGIDN 69
           HG+ GEV +D   + P D+ RY    VL+    +    L +        R + TF  + +
Sbjct: 14  HGIRGEVVVDPTTDEP-DI-RYAPGTVLHGKQGKREYTLTVAHARPHQGRLLVTFDEVPD 71

Query: 70  IHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFGAGS 129
             +A  LR  + +A++ D  D+E   + F++ DL  +     +G   G V GV +  AG+
Sbjct: 72  RTAAESLRGTQFWAEQLDIDDDE---EGFYDHDLTGLRVI-HEGAEIGTVTGVMSGPAGT 127

Query: 130 ILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           ILE++    K  L+PF    V +V+L+     I P
Sbjct: 128 ILEVELAGGKQALVPFVFDIVPDVDLEAGTCTITP 162


>gi|126724933|ref|ZP_01740776.1| 16S rRNA processing protein RimM [Rhodobacterales bacterium
           HTCC2150]
 gi|126706097|gb|EBA05187.1| 16S rRNA processing protein RimM [Rhodobacterales bacterium
           HTCC2150]
          Length = 102

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 54/94 (57%), Gaps = 3/94 (3%)

Query: 72  SASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFGAGSIL 131
            A  L+ ++LYA R+   D  L ++E+++ DL  M   D  GK  G+V  V N GA  +L
Sbjct: 6   QADALKGVRLYAPREALPD--LPDEEYYHADLIGMIVLDTGGKELGKVSDVMNHGADDLL 63

Query: 132 EIKNT-MEKTFLIPFTKFAVLEVNLQENKILIDP 164
           E++   ++   LIPFT+  V  V++   +I+IDP
Sbjct: 64  EVRGKGIKDGALIPFTREIVPTVDMASGRIIIDP 97


>gi|145224752|ref|YP_001135430.1| 16S rRNA-processing protein [Mycobacterium gilvum PYR-GCK]
 gi|315445082|ref|YP_004077961.1| 16S rRNA processing protein RimM [Mycobacterium sp. Spyr1]
 gi|189040844|sp|A4TE78|RIMM_MYCGI RecName: Full=Ribosome maturation factor rimM
 gi|145217238|gb|ABP46642.1| 16S rRNA processing protein RimM [Mycobacterium gilvum PYR-GCK]
 gi|315263385|gb|ADU00127.1| 16S rRNA processing protein RimM [Mycobacterium sp. Spyr1]
          Length = 173

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 41/166 (24%), Positives = 71/166 (42%), Gaps = 12/166 (7%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS---------NDNRELRILKMYRKNK 58
           +++  +   HG+ GE+ ++   ++P    R+V  +            RE  I  +     
Sbjct: 3   LVVGRVAKAHGVTGELTVEVRTDDP--QGRFVRGAVLRGRPPRGGAEREYVIESVRTHGD 60

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
           R +  F G+ +  +A  LR         D    E + DEF++  LE +      G   G+
Sbjct: 61  RLLVRFDGVADRDAADALRGTVFLVDSADLPPIE-DPDEFYDHQLEGLTVITTSGGEVGK 119

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           V  V +  AG +L ++   +   L+PF    VL V+L +  I IDP
Sbjct: 120 VAEVLHTAAGELLAVRTADDTEVLVPFVSAIVLSVSLDDQLITIDP 165


>gi|313904184|ref|ZP_07837563.1| 16S rRNA processing protein RimM [Eubacterium cellulosolvens 6]
 gi|313470986|gb|EFR66309.1| 16S rRNA processing protein RimM [Eubacterium cellulosolvens 6]
          Length = 170

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 41/165 (24%), Positives = 86/165 (52%), Gaps = 10/165 (6%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNP---IDLNRYVLYSN---DNRELRILKMYRKN 57
           +++ + +  I TTHG+ GEV +    ++    +DL+  +L  N   +N E+  +K ++  
Sbjct: 1   MEQYLKIGVITTTHGVRGEVKVFPTTDDAGRFLDLDEVMLCKNGKTENHEIENVKFFKN- 59

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
            + I   SGI +++ A   R+ +++  R++  D  LE+DE++  DL  +  ++  G  +G
Sbjct: 60  -QVILKLSGITSMNDAELYRNWEIFIPREEGVD--LEDDEYYQADLIGLTVYNEDGSEFG 116

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
            +  +   GA  +  +K       LIP  K  +++VN++E  + +
Sbjct: 117 VLKEIIETGANDVYVVKTQTHGEVLIPAIKDCIIDVNIEEGHMTV 161


>gi|30249636|ref|NP_841706.1| hypothetical protein NE1672 [Nitrosomonas europaea ATCC 19718]
 gi|48474816|sp|Q82U37|RIMM_NITEU RecName: Full=Ribosome maturation factor rimM
 gi|30138999|emb|CAD85583.1| RimM [Nitrosomonas europaea ATCC 19718]
          Length = 169

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 80/164 (48%), Gaps = 7/164 (4%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY--SNDNRELRILK---MYRKNKRFI 61
           +V++  I   HG+ G++ +  +      L  Y ++  S D +  +I++    +  +   I
Sbjct: 1   MVVLGRIAGPHGIRGQIKVIPFTEYVDGLMEYPVWCLSRDEKNWQIVRPATFFIHDNLLI 60

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELE-EDEFFNTDLEEMETFDRQGKYWGQVC 120
            T +G  +  SASEL+ L +   R        + ED ++ TDL  +   + QG+  G V 
Sbjct: 61  VTLTGYSDRTSASELKGLLVAVPRSQLPPLSKDGEDGYYWTDLIGISVVNMQGEPLGTVA 120

Query: 121 GVYNFGAGSILEIK-NTMEKTFLIPFTKFAVLEVNLQENKILID 163
           G++  GA  +L ++ +   K  LIPF    + +V+L+  +I +D
Sbjct: 121 GLFETGANDVLRVRLSGSSKDELIPFVDQVIRQVDLESRQITVD 164


>gi|210622536|ref|ZP_03293229.1| hypothetical protein CLOHIR_01177 [Clostridium hiranonis DSM 13275]
 gi|210154171|gb|EEA85177.1| hypothetical protein CLOHIR_01177 [Clostridium hiranonis DSM 13275]
          Length = 172

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 79/168 (47%), Gaps = 11/168 (6%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNRE--LRILKMYRKNKRFIAT 63
           +  I  T GL G+V +    +   D+ R+      Y   +RE    +  +  K    I  
Sbjct: 10  VGKIVKTQGLKGDVRVYPTTD---DIYRFDYLEEFYVGKDRENPWEVEDVRYKGNLVIMK 66

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
             GID +  A +L    +Y  R +    ELEE EFF  D+  M+ +   G+  G +  V 
Sbjct: 67  IKGIDRVEEAEKLVGKDIYVSRDE--SFELEEGEFFIADMIGMDVYTVSGEKVGVLKEVL 124

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN 171
            + A  +  IKN   K +LIP     V E++++E+K++IDPI   L++
Sbjct: 125 QYSANDVYVIKNEEGKEYLIPAVMKFVPEIDIEEDKMIIDPIKGMLDD 172


>gi|237748992|ref|ZP_04579472.1| ribosome maturation factor rimM [Oxalobacter formigenes OXCC13]
 gi|229380354|gb|EEO30445.1| ribosome maturation factor rimM [Oxalobacter formigenes OXCC13]
          Length = 180

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 77/164 (46%), Gaps = 9/164 (5%)

Query: 7   LVLMATIGTTHGLNGEVYIDSY---ANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIAT 63
           L+ +  I   +G+ G   I  Y   A   + +  + L   D   +++++  R+    +A 
Sbjct: 14  LIEVGHISGAYGIRGWAKIVPYSAEAEAMLRVKDWWLDLPDMHNVKVMQARRQGDEIVAH 73

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           FSGIDN  +A  LR   +   R  F   EL EDE++  DL  +  F+ +G   G V G+ 
Sbjct: 74  FSGIDNREAAEALRGSVICISRSRFP--ELPEDEYYWVDLIGLSVFNLRGDALGTVRGLI 131

Query: 124 NFGAGSILEI----KNTMEKTFLIPFTKFAVLEVNLQENKILID 163
           + GA  +L++         +  LIPF    + +V+ +  KI +D
Sbjct: 132 DNGAHPVLQVAVEDSENKVRELLIPFVDQFIDDVDREGGKITVD 175


>gi|167749744|ref|ZP_02421871.1| hypothetical protein EUBSIR_00711 [Eubacterium siraeum DSM 15702]
 gi|167657227|gb|EDS01357.1| hypothetical protein EUBSIR_00711 [Eubacterium siraeum DSM 15702]
 gi|291529953|emb|CBK95538.1| 16S rRNA processing protein RimM [Eubacterium siraeum 70/3]
 gi|291556360|emb|CBL33477.1| 16S rRNA processing protein RimM [Eubacterium siraeum V10Sc8a]
          Length = 170

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/159 (28%), Positives = 70/159 (44%), Gaps = 6/159 (3%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNRY--VLYSNDNRELRILKMYRKNKRFIATFSGI 67
           +  I  T GL GEV +  Y ++   +  +  +    D +EL + K        +    GI
Sbjct: 8   IGKIVATQGLGGEVRVQYYCDSADVICSFDRLFLGKDKQELEVEKARPHKTLAVLKLGGI 67

Query: 68  DNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQ-GKYWGQVCGVYNFG 126
           DN+  A  +    LY  R D    EL E   F  DL  +E  D   GK +G+V  +Y  G
Sbjct: 68  DNVDEAKTIVGKMLYMDRDDV---ELPEGVNFIQDLIGLEVRDADTGKVYGKVTDIYQHG 124

Query: 127 AGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPI 165
           A  + E+K    K  + P     +LE N+ +  ++I P+
Sbjct: 125 AADVYELKTPDGKELMFPAIPEVLLEKNIDDGYLVIRPL 163


>gi|315638649|ref|ZP_07893823.1| 16S rRNA processing protein RimM [Campylobacter upsaliensis JV21]
 gi|315481273|gb|EFU71903.1| 16S rRNA processing protein RimM [Campylobacter upsaliensis JV21]
          Length = 176

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/167 (29%), Positives = 88/167 (52%), Gaps = 12/167 (7%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-YVLYSNDNRELRILKMYRKNKRFIA 62
           + K VL+A IG + GL G + + + ++ P    +    ++ D REL I K Y KN++ + 
Sbjct: 1   MSKFVLVAKIGRSVGLRGYLKLHNLSDFPSQFQKNLTFFTKDKRELAI-KDYDKNRQSV- 58

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDE-ELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
            F   +++  A EL +L+LY   +  ++  +L++DEFF  D+   E  D Q    GQV  
Sbjct: 59  LFYTYESLEKAKELVNLELYQSIEKTRELCKLKKDEFFYFDIIGCEVRDEQ-IILGQVQD 117

Query: 122 VYNFGAGSILEIKNT-------MEKTFLIPFTKFAVLEVNLQENKIL 161
           +   G G + EIK+          K F IP+    +L++++++ +IL
Sbjct: 118 ILESGGGYLFEIKSDEKLTAQGFSKIFFIPYIDKYILQIDIEKKQIL 164


>gi|223044254|ref|ZP_03614291.1| 16S rRNA processing protein RimM [Staphylococcus capitis SK14]
 gi|222442404|gb|EEE48512.1| 16S rRNA processing protein RimM [Staphylococcus capitis SK14]
          Length = 167

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 89/170 (52%), Gaps = 12/170 (7%)

Query: 8   VLMATIGTTHGLNGEVYIDSYAN------NPIDLNRYVLYSNDNRELRILKMYRKNKRF- 60
           V +  I  THG+ GE+ + S ++       P + N  V ++N++ E  +   YR +K F 
Sbjct: 3   VEVGQIVNTHGIKGEIKVKSNSDFTETRFQPGE-NLIVKHNNEDIEYTV-SSYRIHKGFH 60

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +  F GI+NI+    L+   LY +R D +D EL+E EF+ +D+     FD      G+V 
Sbjct: 61  MLKFEGINNINDIEHLKGDYLYQER-DHEDIELDEHEFYYSDIIGCTVFDDTDTPIGRVI 119

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
            ++  GA  +  +K   +K +LIP+ +  V +++++   I I P+   L+
Sbjct: 120 NIFETGANDVWVVKG--DKEYLIPYIEDVVKDIDVEGRSIKITPMKGLLD 167


>gi|262038555|ref|ZP_06011924.1| 16S rRNA processing protein RimM [Leptotrichia goodfellowii F0264]
 gi|261747424|gb|EEY34894.1| 16S rRNA processing protein RimM [Leptotrichia goodfellowii F0264]
          Length = 169

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 55/169 (32%), Positives = 87/169 (51%), Gaps = 8/169 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDS-YANNPIDLNRYVLYSNDNRE--LRILKMYRKN-KR 59
           ++ LV + TI  TH L G V I+S +    + +   VL   ++++  L + K+ R N K+
Sbjct: 1   MENLVNIGTITGTHHLTGNVKINSIFQETDLIIGEKVLLEKEDKKKILTVKKIKRLNEKK 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            IA F  IDNI SA EL   ++  +R      E  E+EF+  DL  +E F+  GK  G V
Sbjct: 61  VIAEFEEIDNIDSAKELNGFQIKIRRDLLP--EKNENEFYLKDLLGVEVFEGNGKI-GDV 117

Query: 120 CGVYNFGAGSILEIKNTM-EKTFLIPFTKFAVLEVNLQENKILIDPIAA 167
             V    A +IL I++T+ +K  ++P     V  ++   NKI ++ I  
Sbjct: 118 IDVMETAAHNILIIEDTVNKKEIMVPLVDEFVKNIDFANNKIEVELIEG 166


>gi|332185778|ref|ZP_08387525.1| 16S rRNA processing protein RimM [Sphingomonas sp. S17]
 gi|332014136|gb|EGI56194.1| 16S rRNA processing protein RimM [Sphingomonas sp. S17]
          Length = 164

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 43/145 (29%), Positives = 70/145 (48%), Gaps = 7/145 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIATFSGI 67
           V +A I   HG+ GEV +  +A    D++ Y  + ND   L +      +   IA F+ +
Sbjct: 13  VTLAVIIGAHGITGEVRLKVFAE---DVSAYRAF-NDG-ALTLKSAREGSNGVIARFAEV 67

Query: 68  DNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFGA 127
            + ++A  LR  +L   R       LEE E+++ D+  +      G+  G V  + NFGA
Sbjct: 68  TDRNAAEALRGTELTVPRSALPP--LEEGEYYHADIIGLPAIASDGEELGHVALIENFGA 125

Query: 128 GSILEIKNTMEKTFLIPFTKFAVLE 152
           G +LEI+    + F++P    AV E
Sbjct: 126 GDVLEIERPDGRRFMVPMKVEAVPE 150


>gi|237667792|ref|ZP_04527776.1| 16S rRNA processing protein RimM [Clostridium butyricum E4 str.
           BoNT E BL5262]
 gi|237656140|gb|EEP53696.1| 16S rRNA processing protein RimM [Clostridium butyricum E4 str.
           BoNT E BL5262]
          Length = 166

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/161 (28%), Positives = 74/161 (45%), Gaps = 4/161 (2%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIATFS 65
           KL  +  I  THG+ GEV +     +     R         E+ IL +  +  R I    
Sbjct: 4   KLFKIGQIINTHGIKGEVKVYPLTEDVNKFKRLKTVLVGGVEMNILGVKFQKDRVILKIE 63

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNF 125
           GID ++ A   +   +   R+  K+ EL ED ++ +DL+E   +D  GK  G++  V + 
Sbjct: 64  GIDTMNDAETYKQKYIEIPRE--KEPELPEDTYYVSDLKECIVYDTDGKELGKIFDVIST 121

Query: 126 GAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIA 166
               +  IK    K  LIP  +  VL +++ E KI+I P+ 
Sbjct: 122 RNNDVYWIKEP--KELLIPVLRDIVLSIDINEKKIVIRPVG 160


>gi|57239611|ref|YP_180747.1| 16S rRNA-processing protein RimM [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58579600|ref|YP_197812.1| putative 16S rRNA processing protein rimM [Ehrlichia ruminantium
           str. Welgevonden]
 gi|58617654|ref|YP_196853.1| putative 16S rRNA processing protein rimM [Ehrlichia ruminantium
           str. Gardel]
 gi|75356891|sp|Q5FGP6|RIMM_EHRRG RecName: Full=Ribosome maturation factor rimM
 gi|81352715|sp|Q5H9Z8|RIMM_EHRRW RecName: Full=Ribosome maturation factor rimM
 gi|57161690|emb|CAH58620.1| putative 16S rRNA processing protein [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58417266|emb|CAI28379.1| Probable 16S rRNA processing protein rimM [Ehrlichia ruminantium
           str. Gardel]
 gi|58418226|emb|CAI27430.1| Probable 16S rRNA processing protein rimM [Ehrlichia ruminantium
           str. Welgevonden]
          Length = 172

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 83/159 (52%), Gaps = 6/159 (3%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSN--DNRELRILKMYRKNKRFIATF 64
            + +  I + HG+ G V I ++  NP +   Y   ++     E+ I+++  KN   IA  
Sbjct: 5   FICLGIITSPHGIKGHVKIKTFTENPQNFTSYGKLTDGITTYEINIIQVVSKN-TIIAKI 63

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
           + I +  +A  LR+ KL+ ++    +  L E+EF+++DL  ++        +G +  +YN
Sbjct: 64  NNITSRTNAELLRNKKLFIEKTKLPN--LIENEFYHSDLVGLQVILEDNNIFGTIKKIYN 121

Query: 125 FGAGSILEI-KNTMEKTFLIPFTKFAVLEVNLQENKILI 162
           FG+  I+EI     +K+ ++PF+K     +N +E  +++
Sbjct: 122 FGSCDIIEILLYNSKKSTMLPFSKDIFTHINTKERYVIL 160


>gi|314933417|ref|ZP_07840782.1| 16S rRNA processing protein RimM [Staphylococcus caprae C87]
 gi|313653567|gb|EFS17324.1| 16S rRNA processing protein RimM [Staphylococcus caprae C87]
          Length = 167

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 46/168 (27%), Positives = 86/168 (51%), Gaps = 8/168 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDS---YANNPIDLNRYVLYSNDNRELR-ILKMYRKNKRF-IA 62
           V +  I  THG+ GE+ + S   +          ++  ++N +L+  +  YR +K F + 
Sbjct: 3   VEVGQIVNTHGIKGEIKVKSNSDFTETRFQPGENLIVKHNNEDLQYTVSSYRIHKGFHML 62

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F GI+NI+    L+   LY +R D +D EL+E E++ +D+     FD      G+V  +
Sbjct: 63  KFEGINNINDIEHLKGDYLYQER-DHEDIELDEHEYYYSDIIGCTVFDDTDTPIGRVINI 121

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           +  GA  +  +K   +K +LIP+ +  V +++++   I I P+   L+
Sbjct: 122 FETGANDVWVVKG--DKEYLIPYIEDVVKDIDVEGKSIKITPMEGLLD 167


>gi|269120660|ref|YP_003308837.1| 16S rRNA processing protein RimM [Sebaldella termitidis ATCC 33386]
 gi|268614538|gb|ACZ08906.1| 16S rRNA processing protein RimM [Sebaldella termitidis ATCC 33386]
          Length = 167

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 49/164 (29%), Positives = 86/164 (52%), Gaps = 7/164 (4%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNP--IDLNRYVLYSNDNRELRILKMYRK--NKRFI 61
           +LV + TI  TH LNG V + S   +   I   + +L  N++++L  +K  ++  NK+ I
Sbjct: 2   ELVNIGTITGTHHLNGAVKVTSIFQDTDVIISEKVLLEKNNDKKLCTVKSVKRINNKKLI 61

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
             FS I NI+ A  L   ++  +R D   E+ EED ++N DL  M+ F+++ +Y G +  
Sbjct: 62  VEFSEISNINDAKSLNGYQVKIRR-DLLPEKTEEDFYYN-DLLGMKVFEKE-EYLGDILD 118

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPI 165
                A  IL + N+  +  L+P     V +++ +  KI ++ I
Sbjct: 119 TMETAAHDILVVVNSDGREILVPMVDIFVKKIDFEAGKIEVELI 162


>gi|255325256|ref|ZP_05366362.1| 16S rRNA processing protein RimM [Corynebacterium
           tuberculostearicum SK141]
 gi|255297821|gb|EET77132.1| 16S rRNA processing protein RimM [Corynebacterium
           tuberculostearicum SK141]
          Length = 165

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 48/164 (29%), Positives = 79/164 (48%), Gaps = 15/164 (9%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNRELRIL--KMYRKNK-RF 60
           +++  +  +HG+ GEV +++  + P    R+    VL+    ++   L  K  R +K R 
Sbjct: 3   LMIGRVIKSHGVKGEVVVEATTDEP--EVRFAVGEVLHGTQGKKEHTLTIKAVRSHKGRL 60

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           + TF  I +   A  LR  K +A   D  D     D F++ +LE +     +G+  G+V 
Sbjct: 61  LVTFEEIKDRTVADSLRGTKFFAAPLDSDD-----DGFYDHELEGLRVL-LEGEEIGEVT 114

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
            V + G+  +LE++    K  LIPF    V EVNL+     IDP
Sbjct: 115 SVIHGGSQDLLEVELDNSKEALIPFVHAIVPEVNLEAGTCTIDP 158


>gi|160901806|ref|YP_001567387.1| 16S rRNA processing protein RimM [Petrotoga mobilis SJ95]
 gi|209573586|sp|A9BF00|RIMM_PETMO RecName: Full=Ribosome maturation factor rimM
 gi|160359450|gb|ABX31064.1| 16S rRNA processing protein RimM [Petrotoga mobilis SJ95]
          Length = 185

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 45/176 (25%), Positives = 88/176 (50%), Gaps = 9/176 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNP---IDLNRYVLYSNDNREL---RILKMYRKN 57
           LD  + +A I  +HG++GEV I  + N      +L   +LY+   R     ++L++   N
Sbjct: 8   LDNKISVAKIVNSHGVHGEVKIVPFTNVKDVITNLEEVLLYNTSTRNFFFSKVLQVKPLN 67

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
           K F+    GI ++  A ++   +++  ++D     L  +E++  ++ + E +   G+Y G
Sbjct: 68  KFFVLNLRGIKDMDEAKKMIGYEVFIDKKDLPS--LNSEEYYWYEILDSEVYYEDGEYVG 125

Query: 118 QVCGVYNFGAGSILEIKNTM-EKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNT 172
           +V  +   GA  ++ IKN   +K  LIP T   ++E+  ++  I++  I    N T
Sbjct: 126 KVEEIIQTGANDVISIKNLEDDKEVLIPMTDHYIIELKKEDKSIIVKKIEWYENGT 181


>gi|291545205|emb|CBL18314.1| 16S rRNA processing protein RimM [Ruminococcus sp. 18P13]
          Length = 170

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 42/151 (27%), Positives = 68/151 (45%), Gaps = 5/151 (3%)

Query: 17  HGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKRFIATFSGIDNIHSASE 75
           HGL G+V I  + ++   L  +  LY  D   + ++         +  F+GID    A  
Sbjct: 15  HGLRGDVKIQPWCDSAGFLCEFDTLYRADGTPMSVVSARAHKGMAVVRFAGIDTPEQAEA 74

Query: 76  LRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQ-GKYWGQVCGVYNFGAGSILEIK 134
           LR+  LY  R D    EL+ D +F  DL  ++  D   G  +G++  V   GA  +  I+
Sbjct: 75  LRNTVLYMNRADV---ELDADTYFIRDLIGLQVLDADTGAVYGRLEEVLETGANDVYTIR 131

Query: 135 NTMEKTFLIPFTKFAVLEVNLQENKILIDPI 165
               K  L P     V+E +L++  + I P+
Sbjct: 132 TPEGKQLLFPAIGDVVVETDLEQGIMRIRPL 162


>gi|209545390|ref|YP_002277619.1| 16S rRNA processing protein RimM [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209533067|gb|ACI53004.1| 16S rRNA processing protein RimM [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 188

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 75/157 (47%), Gaps = 7/157 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIATFSG- 66
           +LM  +G  HG+ G V + SYA  P DL  Y    +++ ++  L+        +   +G 
Sbjct: 6   ILMGVVGRPHGVRGLVRVHSYAAVPEDLTAYGALIDEHGQVWSLRWRGDGIAELRDAAGQ 65

Query: 67  -IDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQG--KYWGQVCGVY 123
            +    +A  + + +LY  R      E ++DEF+ TDL  M+    QG     G+V  V+
Sbjct: 66  ALSGRDAAQAMVNRRLYVARTSLP--EPDQDEFYFTDLIGMDV-RAQGTDAPLGRVLVVH 122

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKI 160
           ++GAG  LE+        ++PFT+     V++   +I
Sbjct: 123 DYGAGVSLELGGQGHAPLILPFTRACFPVVDVAAGRI 159


>gi|260437021|ref|ZP_05790837.1| 16S rRNA processing protein RimM [Butyrivibrio crossotus DSM 2876]
 gi|292810330|gb|EFF69535.1| 16S rRNA processing protein RimM [Butyrivibrio crossotus DSM 2876]
          Length = 170

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 50/173 (28%), Positives = 86/173 (49%), Gaps = 13/173 (7%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPI---DLNRYVLYSNDNRELRILKM----YRK 56
           ++ L+ +  I + HG+ GEV +    ++P+   +L   +L S+  RE+  L +    ++K
Sbjct: 1   MEDLLRVGVITSPHGIAGEVKVYPTTDDPMRFKNLKECILKSS--REMLNLHVAGVKFQK 58

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           N   I  F   +NI+   + R  +LY  R++    +LEE E+F  DL  ++  D  GK  
Sbjct: 59  N-LVILKFKEFNNINEVEKYRQAELYVTREN--AVKLEEGEYFICDLIGLKVIDEFGKTI 115

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           G++  V   GA  + E+     K +L P  K  +L V+L E  + +  I  GL
Sbjct: 116 GELTDVIQTGANDVYEVTTPERKKYLFPVIKECILNVDLDEGIVTVH-IMKGL 167


>gi|295109863|emb|CBL23816.1| 16S rRNA processing protein RimM [Ruminococcus obeum A2-162]
          Length = 168

 Score = 62.0 bits (149), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 51/167 (30%), Positives = 85/167 (50%), Gaps = 14/167 (8%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNP---IDLNRYVLYSNDNRELRILKMYRKNKRF 60
           ++ L+ +  I TTHG+ GEV +    ++    ++L  YVL     RELR L +  KN RF
Sbjct: 1   MEDLLKVGVITTTHGVRGEVKVFPTTDDAERFLEL-EYVLLDT-GRELRRLDI--KNVRF 56

Query: 61  -----IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
                I  F GIDNI+   + +   L+  R++   +EL EDE++  DL+ +      G  
Sbjct: 57  FKNLVILKFDGIDNINDIEKYKGKDLWIPREEA--QELGEDEYYIADLQGLNVVLEDGTE 114

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
           +G +  V   GA  +  I +      L+P  K  +L+V+L++N + +
Sbjct: 115 FGTLRDVMETGANDVYIIDSNEHGEVLLPAIKECILDVDLEKNTMTV 161


>gi|323489561|ref|ZP_08094788.1| 16S rRNA-processing protein [Planococcus donghaensis MPA1U2]
 gi|323396692|gb|EGA89511.1| 16S rRNA-processing protein [Planococcus donghaensis MPA1U2]
          Length = 171

 Score = 62.0 bits (149), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 85/168 (50%), Gaps = 9/168 (5%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDL----NRYVLYSNDNRELRILKM--YRKNKRF-IA 62
           +  I  THG+ GEV + S  + P +      +  L++ D ++  ++K+  +R++K F + 
Sbjct: 6   VGKIVNTHGIRGEVRVLSRTDFPEERFAVGTKLGLFTPDAKKPIMVKIASHRQHKNFELL 65

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
           TF G  NI+     ++  L     D    ELEE+ F++ ++     +  +G+  G++  +
Sbjct: 66  TFEGYPNINDVEPFKESYLRIAEHDLT--ELEENAFYHHEILGCAVYSTEGQELGKITEI 123

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
              GA  + E+     K   IP+T+  V EV++ E K++I+ I   L+
Sbjct: 124 LETGANDVWEVTPEKGKKHYIPYTEEIVKEVDIDEKKVIIEVIEGLLS 171


>gi|300361926|ref|ZP_07058103.1| 16S rRNA processing protein RimM [Lactobacillus gasseri JV-V03]
 gi|300354545|gb|EFJ70416.1| 16S rRNA processing protein RimM [Lactobacillus gasseri JV-V03]
          Length = 173

 Score = 62.0 bits (149), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 45/159 (28%), Positives = 81/159 (50%), Gaps = 8/159 (5%)

Query: 10  MATIGTTHGLNGEVYIDSYANNP----IDLNRYVLYSNDNRELRILKMYRKNKRF-IATF 64
           +  I + HGL GEV +++  + P     + +R  + ++D  +  I++  R++K+F +  F
Sbjct: 7   VGKILSPHGLTGEVKVNATTDFPEERLANGSRLFIKNSDQYQELIVEATRRHKQFYLVKF 66

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFD-RQGKYWGQVCGVY 123
            GID+I  A ++R  +LY    D   +EL E  ++  D+     +D + G+  G +  + 
Sbjct: 67  EGIDDIDQAEKVRGKELYVAETD--QQELPEGSYYFKDILNCPVYDAKTGEKLGVLANIE 124

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
             GA  I EIK    K+F IP  +  V  V+L   +I +
Sbjct: 125 TPGANDIWEIKPEHGKSFWIPNIESVVNNVDLANKRIEV 163


>gi|120403181|ref|YP_953010.1| 16S rRNA-processing protein RimM [Mycobacterium vanbaalenii PYR-1]
 gi|166226458|sp|A1T754|RIMM_MYCVP RecName: Full=Ribosome maturation factor rimM
 gi|119955999|gb|ABM13004.1| 16S rRNA processing protein RimM [Mycobacterium vanbaalenii PYR-1]
          Length = 172

 Score = 62.0 bits (149), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 67/158 (42%), Gaps = 12/158 (7%)

Query: 16  THGLNGEVYIDSYANNPIDLNRYVLYS---------NDNRELRILKMYRKNKRFIATFSG 66
            HG+ GE+ +D   ++P    R+V  +            RE  I  +     R +    G
Sbjct: 11  AHGVTGELAVDVRTDDP--EGRFVAGAVLRGRPARGGAEREFVIESVRSHGDRMLIRLQG 68

Query: 67  IDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFG 126
           + +  +A  LR         +    E + DEF++  LE M      G+  G V  V +  
Sbjct: 69  VGDRDAADALRGTLFLVDSAELPPIE-DPDEFYDHQLEGMAVSTTGGQPVGTVAEVLHTA 127

Query: 127 AGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           AG +L +++      L+PF    V+ V+L +N I IDP
Sbjct: 128 AGELLAVRDPDGAEVLVPFVSAIVVSVSLADNAIEIDP 165


>gi|317057389|ref|YP_004105856.1| 16S rRNA processing protein RimM [Ruminococcus albus 7]
 gi|315449658|gb|ADU23222.1| 16S rRNA processing protein RimM [Ruminococcus albus 7]
          Length = 172

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 76/164 (46%), Gaps = 5/164 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKRFIA 62
           ++KL+    I +  GL GEV +  + + P  L  +  LY      + + +   +    + 
Sbjct: 1   MNKLLEAGKIVSVFGLKGEVKVQPWCDTPDFLCEFDTLYYKSGTPVEVERARVQKNIVVM 60

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFD-RQGKYWGQVCG 121
              G+D++  A ++R+  LY  R+D    EL ED +F  DL  ++  D   GK +G +  
Sbjct: 61  KIKGVDSVEEAQKIRNRVLYLDREDV---ELGEDTYFVQDLIGLKVIDLNSGKEYGVLTE 117

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPI 165
           V   GA  +  IK+   K + IP     + E +++   + I P+
Sbjct: 118 VSETGANDVYHIKSESGKMYYIPAIPSVIAETDVEGGVMKITPL 161


>gi|317129230|ref|YP_004095512.1| 16S rRNA processing protein RimM [Bacillus cellulosilyticus DSM
           2522]
 gi|315474178|gb|ADU30781.1| 16S rRNA processing protein RimM [Bacillus cellulosilyticus DSM
           2522]
          Length = 174

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 83/169 (49%), Gaps = 9/169 (5%)

Query: 10  MATIGTTHGLNGEVYIDSYANNP-----IDLNRYVLYSNDNRELRILKMYRKNKRF-IAT 63
           +  I  THG+ GEV + S  + P     I    YV    D R    +  +RK+K+F + T
Sbjct: 7   VGKIVNTHGVRGEVRVISRTDFPEERYAIGNTLYVTSDTDVRTPVEITSWRKHKQFDLLT 66

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F G+DN++   + +   L   + D  D EL E EF+  ++     + + G+  G V  + 
Sbjct: 67  FKGLDNLNEVEKFKGSLLQIHQNDASD-ELSEGEFYYHEIIGSTVYLQSGEVLGHVKEIL 125

Query: 124 NFGAGSILEIKNTM--EKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           + GA  +  +++    +K  LIP+    V +V+++  K++I P+   L+
Sbjct: 126 SPGANDVWVVQSNTKGKKDMLIPYIDDVVKQVDVKSKKVVIHPMEGLLD 174


>gi|254292891|ref|YP_003058914.1| 16S rRNA processing protein RimM [Hirschia baltica ATCC 49814]
 gi|254041422|gb|ACT58217.1| 16S rRNA processing protein RimM [Hirschia baltica ATCC 49814]
          Length = 193

 Score = 61.6 bits (148), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 45/161 (27%), Positives = 79/161 (49%), Gaps = 6/161 (3%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRE-LRILKMYRKNKRFIATFS 65
           LV++A IG  HG+ G V + S+     D   Y    ++N + +   K Y++NK     + 
Sbjct: 12  LVVVAQIGGAHGVRGHVRVRSFTVVAEDCFAYGPLLDENGDVIFTAKSYQENKDGFVVWP 71

Query: 66  GIDNIHSAS--ELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
            ++N        ++ + L+  R      E EEDEF+  DL   +     G+  GQV  V+
Sbjct: 72  -VENRQREEWMAMKGVLLHVPRNALP--EPEEDEFYFEDLIGSKVVHEDGRELGQVLNVH 128

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           NFGA  +LE+K+     +++PFT   + +V+++   +   P
Sbjct: 129 NFGADDLLELKSPHGTDYMLPFTLEIIPKVDVKAQLLTAKP 169


>gi|300858744|ref|YP_003783727.1| ribosome maturation factor [Corynebacterium pseudotuberculosis
           FRC41]
 gi|300686198|gb|ADK29120.1| ribosome maturation factor [Corynebacterium pseudotuberculosis
           FRC41]
 gi|302206451|gb|ADL10793.1| Ribosome maturation factor rimM [Corynebacterium pseudotuberculosis
           C231]
 gi|302331007|gb|ADL21201.1| 16S rRNA-processing protein [Corynebacterium pseudotuberculosis
           1002]
 gi|308276693|gb|ADO26592.1| 16S rRNA-processing protein [Corynebacterium pseudotuberculosis
           I19]
          Length = 167

 Score = 61.6 bits (148), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 46/162 (28%), Positives = 83/162 (51%), Gaps = 9/162 (5%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNP---IDLNRYVLYSNDNRELRI-LKMYRKNK-RFIA 62
           +++  +  +HG+ GEV ++   ++P     +   +      +E R+ +   R ++ R + 
Sbjct: 3   LMIGRVVKSHGIKGEVAVEVTTDDPDIRFAVGEVLNGKQGKKEHRLTISTGRVHQGRLLI 62

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F  I +  +A  LR  + +A     K+++ +E  F++ +LE +    ++G+  G+V GV
Sbjct: 63  KFEEIPDRTAADSLRGTQFFAA--PLKNDDGDEG-FYDHELEGLGVI-QEGEKIGEVTGV 118

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
            +  AG ILE+K T  K  LIPF    V EVNL+E    I P
Sbjct: 119 MHGPAGEILEVKLTEGKQVLIPFVHAIVPEVNLEEGTCTITP 160


>gi|327441076|dbj|BAK17441.1| RimM protein required for 16S rRNA processing [Solibacillus
           silvestris StLB046]
          Length = 173

 Score = 61.6 bits (148), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 43/162 (26%), Positives = 83/162 (51%), Gaps = 11/162 (6%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS-------NDNRELRI-LKMYRKNKRFI 61
           +  I  THG+ GE+ I S  +   +  R+ + S       +D +   + +   R++K FI
Sbjct: 6   VGRIVNTHGIRGELRILSTTD--FEEERFAVGSKLAAFKKDDKKPTWVTISSSRRHKNFI 63

Query: 62  -ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
             TF G++NI+     ++  L        ++ELE++E+++ ++++ E F  +G+  G V 
Sbjct: 64  LVTFEGMENINLVEPFKEGLLKVSMDQLAEDELEDNEYYHFEIKDCEVFSEEGELIGVVT 123

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
            +   GA  + E+K    K   IP+ +  V ++N+ E KI+I
Sbjct: 124 DILETGANDVWEVKAQNGKKHYIPYIEDIVKDINVDEKKIII 165


>gi|189425509|ref|YP_001952686.1| 16S rRNA processing protein RimM [Geobacter lovleyi SZ]
 gi|209573557|sp|B3E5S5|RIMM_GEOLS RecName: Full=Ribosome maturation factor rimM
 gi|189421768|gb|ACD96166.1| 16S rRNA processing protein RimM [Geobacter lovleyi SZ]
          Length = 176

 Score = 61.6 bits (148), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 39/167 (23%), Positives = 78/167 (46%), Gaps = 8/167 (4%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANN--PIDLNRYVLY---SNDNRELRILKMYRKNKR 59
           D L+ +  I  THG+ G++ + SY+ N   +   + VL    +   R++++ K    + +
Sbjct: 6   DNLIAVGRISGTHGIRGQLRLHSYSGNLESLQAAKNVLIRFPAGGTRQIQLKKAAYHSGK 65

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
           F+ T  G D I  A EL   +L  +R+       + DE++  DL  +     +G+  G +
Sbjct: 66  FLLTLEGFDTIEKAQELAGAELLLQREQLPPP--DADEYYWHDLLGLSVVTNEGQALGII 123

Query: 120 CGVYNFGAGSILEIK-NTMEKTFLIPFTKFAVLEVNLQENKILIDPI 165
             +   GA  +  ++ +  ++ +LIP     +  VN+    + I P+
Sbjct: 124 KDILETGANDVYLVRDDATKREYLIPAIASVISSVNIHTGTMTITPL 170


>gi|160880538|ref|YP_001559506.1| 16S rRNA processing protein RimM [Clostridium phytofermentans ISDg]
 gi|189040130|sp|A9KLM3|RIMM_CLOPH RecName: Full=Ribosome maturation factor rimM
 gi|160429204|gb|ABX42767.1| 16S rRNA processing protein RimM [Clostridium phytofermentans ISDg]
          Length = 169

 Score = 61.6 bits (148), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 80/171 (46%), Gaps = 12/171 (7%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-------VLYSNDNRELRILKMYRK 56
           ++ L+ +  I +THG+ GEV +    +   D+NR+       +    + +EL I  +   
Sbjct: 1   MEDLLRVGVISSTHGIKGEVKVFPTTD---DMNRFKKLKMVTLDTGKEQKELEIENVKFF 57

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
            +  I  F GIDNI+   + +   L   R++  D  L E EFF  DL  ++  +  G   
Sbjct: 58  KQFVILKFKGIDNINDIEKYKGKDLLISRENAVD--LAEGEFFIFDLIGLQAEEEDGNSL 115

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAA 167
           G++  V   GA  +  IK    K  LIP+    V +++L E K+++  I  
Sbjct: 116 GELTEVLQTGANDVFVIKTKQGKEILIPYIDDCVKKIDLNEKKLVVHLIPG 166


>gi|269127627|ref|YP_003300997.1| 16S rRNA processing protein RimM [Thermomonospora curvata DSM
           43183]
 gi|268312585|gb|ACY98959.1| 16S rRNA processing protein RimM [Thermomonospora curvata DSM
           43183]
          Length = 172

 Score = 61.6 bits (148), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 46/172 (26%), Positives = 76/172 (44%), Gaps = 6/172 (3%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNP-IDLNRYVLYSNDNRELRILKMYRKN---KRF 60
           D  V++  IG  HG+ GEV +D   ++P        +   D   L  L + R      R 
Sbjct: 3   DDQVVVGRIGRPHGVRGEVTVDVRTDDPDARFAPGAVLDTDPPHLGPLTVERARWHVGRL 62

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +  F+G+D+  +A +LR   L     D    E + DEF + +L  +      G   G V 
Sbjct: 63  LLRFTGVDDRTAAEKLRGTWLVVDTGDLPPLE-DPDEFHDHELIGLTAVTTDGTPVGTVR 121

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNT 172
            + ++ A  +L I+       L+PF    V EV++   +I+IDP    L+ +
Sbjct: 122 DILHY-AQDLLVIRRETGGEALVPFVAALVPEVDVAGGRIVIDPPPGLLDES 172


>gi|327479754|gb|AEA83064.1| 16S rRNA-processing protein RimM [Pseudomonas stutzeri DSM 4166]
          Length = 175

 Score = 61.6 bits (148), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 39/167 (23%), Positives = 85/167 (50%), Gaps = 10/167 (5%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYAN---NPIDLNRYVLYSNDN-RELRILKMYRKNKRF 60
           D+LV++  I + HG+ G+V + S+ +   N +D  R+ L   D  +++ ++K   +    
Sbjct: 6   DELVVIGKIVSVHGVRGDVKVYSFTDPIDNLLDYRRWTLRRGDEVKQVELVKGRLQGNIL 65

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +A+  G+ +   A    D ++   R +     L++ E++   L+ ++  ++ G+  GQV 
Sbjct: 66  VASLKGLTDREVARTYADFEICVPRSELP--ALDDGEYYWYQLQGLKVLNQAGQLLGQVD 123

Query: 121 GVYNFGAGSILEIKNTM----EKTFLIPFTKFAVLEVNLQENKILID 163
            +   GA  +L +K       ++  L+P+T   VL+V+L   ++ +D
Sbjct: 124 HLLETGANDVLVVKPCAGSLDDRERLLPYTDHCVLKVDLDSGEMQVD 170


>gi|229918607|ref|YP_002887253.1| 16S rRNA processing protein RimM [Exiguobacterium sp. AT1b]
 gi|259585644|sp|C4L602|RIMM_EXISA RecName: Full=Ribosome maturation factor rimM
 gi|229470036|gb|ACQ71808.1| 16S rRNA processing protein RimM [Exiguobacterium sp. AT1b]
          Length = 172

 Score = 61.2 bits (147), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 47/168 (27%), Positives = 82/168 (48%), Gaps = 9/168 (5%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDL----NRYVLYSNDNRELRILKMYRKNKRF-IATF 64
           +  I  THGL GEV I +  + P +     N   L  +  ++   +  YR +K+F + TF
Sbjct: 6   VGKIANTHGLKGEVKILAATDFPEERFKKGNTLFLDVDGTKQEMTITTYRPHKQFHLVTF 65

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
            G DNI+   + + LKLY   +   D  L+E EF+  ++   E     G+  G V  ++ 
Sbjct: 66  KGFDNINLIEKYKGLKLYVHAEHVHD--LDEHEFYYHEIIGCEAV-VDGEVIGVVDDIFE 122

Query: 125 F-GAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN 171
             GA  +  IK   +   LIP+ +  V E+++   +++I PI   +++
Sbjct: 123 TNGANDVWVIKRPGKSDALIPYIESVVQEIDVDAKRVVITPIPGMIDD 170


>gi|157374299|ref|YP_001472899.1| 16S rRNA-processing protein [Shewanella sediminis HAW-EB3]
 gi|189040855|sp|A8FSE8|RIMM_SHESH RecName: Full=Ribosome maturation factor rimM
 gi|157316673|gb|ABV35771.1| 16S rRNA processing protein RimM [Shewanella sediminis HAW-EB3]
          Length = 176

 Score = 61.2 bits (147), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 83/166 (50%), Gaps = 12/166 (7%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRKNKRFIAT 63
           V++  +G++HG+ G + I +Y ++   +  Y  +      + RE+++L+   + K  +A 
Sbjct: 8   VVLGKLGSSHGIKGWLKITTYTDSVEGIFDYSPWLIKEQGEWREVKVLQWRFQGKAVVAC 67

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
             G++    A  L + ++    +    + L EDEF+  DL   E  + +G   G+V  + 
Sbjct: 68  LEGVETREHAQMLTNCEIAVTPEQM--DTLPEDEFYWRDLIGCEVMNTKGYNMGKVQEIV 125

Query: 124 NFGAGSILEIKNTMEKTF-----LIPF-TKFAVLEVNLQENKILID 163
             G+  +L +K   +  F     +IPF T+  ++EVNL E +I +D
Sbjct: 126 ETGSNDVLLVKANAKDGFGKAERMIPFVTEQFIIEVNLTEKQITVD 171


>gi|182680253|ref|YP_001834399.1| 16S rRNA-processing protein RimM [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|209573543|sp|B2IDX8|RIMM_BEII9 RecName: Full=Ribosome maturation factor rimM
 gi|182636136|gb|ACB96910.1| 16S rRNA processing protein RimM [Beijerinckia indica subsp. indica
           ATCC 9039]
          Length = 173

 Score = 61.2 bits (147), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 49/158 (31%), Positives = 79/158 (50%), Gaps = 18/158 (11%)

Query: 19  LNGEVYIDSYANNPIDLNRYVLYSNDN-------RELRILKMYRKNKRFIATFSGIDNIH 71
           + GEV + S+   P  ++ Y   S+ +         LR++K    N  F+A   G+    
Sbjct: 1   MRGEVRLQSFTEVPQAISAYGPLSDASGKKSFSIASLRLVK----NAVFVARIEGVTTRE 56

Query: 72  SASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETF--DRQGK--YWGQVCGVYNFGA 127
           +A  L +L LY  R+       EE+EF+  DL  ++ F  D  GK   +G++  V NFG 
Sbjct: 57  AAEALTNLSLYVSREALP--PPEEEEFYLADLIGLDAFVADADGKEVLFGRIADVLNFGG 114

Query: 128 GSILEIKNT-MEKTFLIPFTKFAVLEVNLQENKILIDP 164
           G ILEI  +   +T L+PFT+  V  ++L   ++L+ P
Sbjct: 115 GDILEIAPSDGGETRLLPFTRQVVPRIDLTARRVLVVP 152


>gi|258653300|ref|YP_003202456.1| 16S rRNA processing protein RimM [Nakamurella multipartita DSM
           44233]
 gi|258556525|gb|ACV79467.1| 16S rRNA processing protein RimM [Nakamurella multipartita DSM
           44233]
          Length = 167

 Score = 61.2 bits (147), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 78/162 (48%), Gaps = 8/162 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNR-ELRILKMYRKNKRFIA 62
           V++  IG  HGL G+V I    ++P    R+    VL ++ +R  L ++   R     + 
Sbjct: 3   VVVGRIGRPHGLRGDVTIAVNTDDPD--ARFAAGSVLGTDPDRGPLTVVTRRRSGGVLLL 60

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F GI++  +A  LR   L    +   + + + DEF++  L  +   D  G+  G+V  V
Sbjct: 61  RFEGIEDRDAAEALRGTSLTVPAETLPESD-DPDEFYDHQLIGLAVRDPSGQDLGKVVEV 119

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           ++  A  +L ++        +PF +  V  V+L ++ +++DP
Sbjct: 120 WHPPASPVLLVRRPDGSDEAVPFVRALVPTVDLAQSYLVVDP 161


>gi|225571998|ref|ZP_03780862.1| hypothetical protein RUMHYD_00292 [Blautia hydrogenotrophica DSM
           10507]
 gi|225040531|gb|EEG50777.1| hypothetical protein RUMHYD_00292 [Blautia hydrogenotrophica DSM
           10507]
          Length = 168

 Score = 61.2 bits (147), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 44/165 (26%), Positives = 82/165 (49%), Gaps = 10/165 (6%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNP---IDLNRYVLYSNDNR---ELRILKMYRKN 57
           ++  + +  I +THG+ GEV +    N     +DL+  +L +   R   E+  +K +++ 
Sbjct: 1   MEAFLQVGVISSTHGVRGEVKVFPTTNEKERFLDLDSVILDTGKERLTLEIEGVKFFKQF 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              I  F G DNI+   + +   L+  R+  +   L EDE++  DL  M+     GKY+G
Sbjct: 61  A--ILKFKGFDNINDIEKYKGKSLWIPRE--QAVPLSEDEYYIADLLGMDVVLEDGKYFG 116

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
           ++  V   GA  +  ++    +  L+P  K  VL+V ++ N++ I
Sbjct: 117 RLEDVIETGANDVYVVRTEEGQEVLLPAIKECVLQVEVERNQMRI 161


>gi|329766863|ref|ZP_08258391.1| 16S rRNA processing protein RimM [Gemella haemolysans M341]
 gi|328837588|gb|EGF87213.1| 16S rRNA processing protein RimM [Gemella haemolysans M341]
          Length = 169

 Score = 61.2 bits (147), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 85/166 (51%), Gaps = 9/166 (5%)

Query: 10  MATIGTTHGLNGEVYIDS---YANNPIDLNRYVLYSNDNRELR--ILKMYRKNKR-FIAT 63
           +  I  TH L GEV + S   +     +    +L +  N+ ++   ++ YR +K   +  
Sbjct: 5   VGKIVNTHSLKGEVKVISSTDFEEQRFEKGTELLITRGNQVVKEVTVESYRTHKNNLLVK 64

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F GID+I  A +L++L++     +    ELEE+EF+  ++   E FD  GK  G++  + 
Sbjct: 65  FVGIDSIEEAEKLKNLQIKIDSDNIG--ELEENEFYFHEIIGCEVFDENGKSLGEISEIL 122

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
             GA  +  IK+   K  LIP+ +  V +++++  KI I+ +  GL
Sbjct: 123 TPGANDVWVIKSQNGKEILIPYIEDIVKKIDVENKKIDIE-VMEGL 167


>gi|224824769|ref|ZP_03697876.1| 16S rRNA processing protein RimM [Lutiella nitroferrum 2002]
 gi|224603262|gb|EEG09438.1| 16S rRNA processing protein RimM [Lutiella nitroferrum 2002]
          Length = 168

 Score = 61.2 bits (147), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 80/163 (49%), Gaps = 7/163 (4%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY--SNDNR--ELRILKMYRKNKRF 60
           D LVLM  +    G+ G V I +   +   L  Y ++    D +    R      + K  
Sbjct: 4   DDLVLMGYVRGAFGVRGWVKIHADTGSADSLFDYPVWWLGRDGQWSSYRFEDGLVQPKAL 63

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
            A   G+ +  +A  +R +++   R +F   E  +DE++ +DL  ++  ++ G+ +GQV 
Sbjct: 64  AAKLEGVGSREAAEAMRGMQIAIPRSEFP--ETADDEYYWSDLIGLDVVNKDGQRFGQVA 121

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
            +   GA  +L ++   ++ +LIPF    VL+VNL + +I +D
Sbjct: 122 ELMETGANDVLVVREG-KREWLIPFVGQFVLDVNLTDKRITVD 163


>gi|85374321|ref|YP_458383.1| 16S rRNA processing protein [Erythrobacter litoralis HTCC2594]
 gi|122544281|sp|Q2N9Q5|RIMM_ERYLH RecName: Full=Ribosome maturation factor rimM
 gi|84787404|gb|ABC63586.1| 16S rRNA processing protein [Erythrobacter litoralis HTCC2594]
          Length = 169

 Score = 61.2 bits (147), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 75/161 (46%), Gaps = 12/161 (7%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKR--FIATFSGI 67
           +A I   HG+ G+V +         L     +S+ N     LK  R + +   IA F+ +
Sbjct: 9   LAAITGAHGVRGDVRLKLLGEG---LEALKAHSSFNEGTLTLKSVRSDNKGGAIARFAEV 65

Query: 68  DNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFGA 127
                A +LR   L   R+      LEE E++  DL  ++     GK  G+V  V+N+GA
Sbjct: 66  QGREQAEKLRGTTLTVPREALP--PLEEGEYYFADLIGLDAVTDAGKRVGKVIDVHNYGA 123

Query: 128 GSILEI-KNTME----KTFLIPFTKFAVLEVNLQENKILID 163
             I+EI K+ +     KTF++P T  AV+E N +   I  D
Sbjct: 124 TDIVEIAKDPVPEKGMKTFMVPMTTHAVVEWNGERIVIATD 164


>gi|219849545|ref|YP_002463978.1| 16S rRNA processing protein RimM [Chloroflexus aggregans DSM 9485]
 gi|219543804|gb|ACL25542.1| 16S rRNA processing protein RimM [Chloroflexus aggregans DSM 9485]
          Length = 169

 Score = 60.8 bits (146), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 76/166 (45%), Gaps = 6/166 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY---VLYSNDNRELRILKMY-RKNKR 59
           +D L+ +  +G   G+ G++ + S +++P  L R+   V         ++ +++  K   
Sbjct: 1   MDDLLYIGVLGAPFGVRGQIKLHSISSHPEHLIRHLRTVFIGPKRIPHQVTRLFLHKPGL 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I     + +  +AS+LR  ++Y    D     L EDEFF  DL  +      G   G+V
Sbjct: 61  LIIQLQSVTDRDAASDLRGAEVYIAAADAA--PLGEDEFFYHDLIGLAAVTDTGDLIGEV 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPI 165
             V   GAG I  I        L+P  +  ++ ++L E +++I PI
Sbjct: 119 RDVLETGAGEIAVIARRGRADALVPMVRDFIVAIDLVERRLVIRPI 164


>gi|315604547|ref|ZP_07879610.1| 16S rRNA processing protein RimM [Actinomyces sp. oral taxon 180
           str. F0310]
 gi|315313559|gb|EFU61613.1| 16S rRNA processing protein RimM [Actinomyces sp. oral taxon 180
           str. F0310]
          Length = 169

 Score = 60.8 bits (146), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 41/156 (26%), Positives = 69/156 (44%), Gaps = 9/156 (5%)

Query: 11  ATIGTTHGLNGEVYIDSYANNP--IDLNRYVLYSNDNRELRILKMYRKNKRFIATFSGID 68
           A IG  HGL GEV +D  +++P  +     +     +R L +  +    +R +A+F   +
Sbjct: 6   AIIGPAHGLRGEVILDVRSDDPSVVAPGMRLDVEGASRVLTVRSVRVHKERVLASFEECE 65

Query: 69  NIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFGAG 128
           +   A  LR  +L  +      E  EED ++   L  +      G   G V G+   GA 
Sbjct: 66  SREDAERLRGARLLVE------EHPEEDAWYPHQLTGLTARTPAGDVLGTVSGL-RLGAA 118

Query: 129 SILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
             L + +T   T ++PF    V  V++    ++IDP
Sbjct: 119 QDLLLVDTPAATVMVPFVSALVPTVDVDRGVVVIDP 154


>gi|153813991|ref|ZP_01966659.1| hypothetical protein RUMTOR_00198 [Ruminococcus torques ATCC 27756]
 gi|317501514|ref|ZP_07959712.1| 16S rRNA-processing protein [Lachnospiraceae bacterium 8_1_57FAA]
 gi|331088011|ref|ZP_08336933.1| 16S rRNA processing protein RimM [Lachnospiraceae bacterium
           3_1_46FAA]
 gi|145848387|gb|EDK25305.1| hypothetical protein RUMTOR_00198 [Ruminococcus torques ATCC 27756]
 gi|316897143|gb|EFV19216.1| 16S rRNA-processing protein [Lachnospiraceae bacterium 8_1_57FAA]
 gi|330409159|gb|EGG88614.1| 16S rRNA processing protein RimM [Lachnospiraceae bacterium
           3_1_46FAA]
          Length = 168

 Score = 60.8 bits (146), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 44/163 (26%), Positives = 83/163 (50%), Gaps = 7/163 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY--VLYSNDNRELRI-LKMYRKNKRF 60
           +++ + +  I +THG+ GEV +    ++P    +   V+     R++ + ++  R  K+F
Sbjct: 1   MEQFLQVGAITSTHGIRGEVKVFPTTDDPARFKKLKKVILDTGKRQIDMEIQSVRFFKQF 60

Query: 61  -IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F GIDNI+   + +   L+  R++     LEE+E++  DL  ME F  +G ++G V
Sbjct: 61  VIVKFKGIDNINDVEQYKGSSLFVSRENAVS--LEENEYYIADLIGMEVFTEEG-HFGIV 117

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
             V   GA  +  I + +    L+P  K  +  V+++  K+ I
Sbjct: 118 KDVMETGANEVYIIDSDVHGEVLVPAIKQCIENVDVENGKMQI 160


>gi|325681250|ref|ZP_08160780.1| 16S rRNA processing protein RimM [Ruminococcus albus 8]
 gi|324107172|gb|EGC01458.1| 16S rRNA processing protein RimM [Ruminococcus albus 8]
          Length = 172

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 75/164 (45%), Gaps = 5/164 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKRFIA 62
           + KL+    I +  GL GEV + ++ + P  L  +  LY      + I +   +    + 
Sbjct: 1   MQKLLEAGKIVSVFGLKGEVKVQAWCDTPDFLCEFDTLYYKSGTPVEIERSRVQKNIVVM 60

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFD-RQGKYWGQVCG 121
              GID +  A ++R+  LY  R D    EL+E+ +F  DL  ++  D   G+ +G +  
Sbjct: 61  KIKGIDTVEEAQKIRNRVLYIDRDDV---ELDENTYFVQDLVGLKVVDLDSGREYGTLTE 117

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPI 165
           V   GA  +  IK+   K + IP     V E +++   + I P+
Sbjct: 118 VSETGANDVYHIKSADGKMYYIPAIPSVVAETDIEGGVMKITPL 161


>gi|297584016|ref|YP_003699796.1| 16S rRNA processing protein RimM [Bacillus selenitireducens MLS10]
 gi|297142473|gb|ADH99230.1| 16S rRNA processing protein RimM [Bacillus selenitireducens MLS10]
          Length = 174

 Score = 60.5 bits (145), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 50/175 (28%), Positives = 86/175 (49%), Gaps = 13/175 (7%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYV------LYS--NDNRELRILKMYR 55
           + K + +  I  THG++GEV + S  +      RY       LY+   D+R    +  +R
Sbjct: 1   MSKWLNVGKIVNTHGIHGEVRVISRTD--FKEERYAKGRELFLYNPEKDHRTSVTVVSWR 58

Query: 56  KNKRF-IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGK 114
           ++K+F + TF G  N++     RD  L     D  D+ +EEDEF+  ++  +   D QG 
Sbjct: 59  QHKQFDLLTFEGYTNVNDVEGFRDHLLQVDGDDL-DDPMEEDEFYYHEIIGLSVVDEQGI 117

Query: 115 YWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
             G+V  + + GA  +  ++   +K  LIP+    VL V+L++  + +  I  GL
Sbjct: 118 EIGRVKEILSPGANDVWVVQRQGKKDALIPYIDDVVLSVDLEDGVVHV-RIPEGL 171


>gi|296133546|ref|YP_003640793.1| 16S rRNA processing protein RimM [Thermincola sp. JR]
 gi|296032124|gb|ADG82892.1| 16S rRNA processing protein RimM [Thermincola potens JR]
          Length = 174

 Score = 60.5 bits (145), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 86/170 (50%), Gaps = 9/170 (5%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNR----YVLYSNDNRELRILKMYRKNKRF- 60
           KL+ +  I  THG  GEV +    ++P  +      Y +     REL I K  R +K F 
Sbjct: 7   KLIAIGKIINTHGHKGEVKVFPLTDDPRRMEELEKVYFILGESTRELTI-KQVRYHKNFV 65

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           I +F  I ++++A  L++ ++   + + +   L E  ++  D+  +  F  +G+Y G++ 
Sbjct: 66  ILSFEEIKDMNAAELLKNGEICITKDELRS--LPEGSYYIFDIIGLNVFTNEGRYLGEIT 123

Query: 121 GVYNFGAGSILEIKNTME-KTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
            V   GA  + E++++   K +LIP  K  V  ++ ++ +++I P+   L
Sbjct: 124 DVIQTGANDVYEVRDSKSGKHYLIPALKQIVKSIDTEKKEMIICPMEGLL 173


>gi|27467832|ref|NP_764469.1| rimM protein [Staphylococcus epidermidis ATCC 12228]
 gi|251810669|ref|ZP_04825142.1| 16S rRNA processing protein [Staphylococcus epidermidis
           BCM-HMP0060]
 gi|282876329|ref|ZP_06285196.1| 16S rRNA processing protein RimM [Staphylococcus epidermidis SK135]
 gi|293366796|ref|ZP_06613472.1| 16S rRNA processing protein RimM [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|33301521|sp|Q8CPH7|RIMM_STAES RecName: Full=Ribosome maturation factor rimM
 gi|27315377|gb|AAO04511.1|AE016747_8 rimM protein [Staphylococcus epidermidis ATCC 12228]
 gi|251805829|gb|EES58486.1| 16S rRNA processing protein [Staphylococcus epidermidis
           BCM-HMP0060]
 gi|281295354|gb|EFA87881.1| 16S rRNA processing protein RimM [Staphylococcus epidermidis SK135]
 gi|291319097|gb|EFE59467.1| 16S rRNA processing protein RimM [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|329724354|gb|EGG60866.1| 16S rRNA processing protein RimM [Staphylococcus epidermidis
           VCU144]
 gi|329736333|gb|EGG72605.1| 16S rRNA processing protein RimM [Staphylococcus epidermidis
           VCU028]
 gi|329736626|gb|EGG72892.1| 16S rRNA processing protein RimM [Staphylococcus epidermidis
           VCU045]
          Length = 167

 Score = 60.5 bits (145), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/168 (27%), Positives = 83/168 (49%), Gaps = 8/168 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDS---YANNPIDLNRYVLYSNDNREL-RILKMYRKNKRF-IA 62
           V +  I  THG+ GEV + S   +          +L  ++N E+   +  YR +K F + 
Sbjct: 3   VEVGQIVNTHGIKGEVKVKSNSDFTETRFQPGEQLLVKHNNTEIVYTVASYRIHKGFHML 62

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F GI+NI+    L+   +Y +R D +D EL E E++ +D+     F       G+V  +
Sbjct: 63  RFEGINNINEIEHLKGDYIYQER-DHQDIELGEHEYYYSDIIGCTVFKDDDTPIGRVINI 121

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           +  GA  +  +K   EK +LIP+ +  V +++++   I I P+   L+
Sbjct: 122 FETGANDVWVVKG--EKEYLIPYIEDVVKDIDIETKTIKITPMEGLLD 167


>gi|226224396|ref|YP_002758503.1| 16S rRNA processing protein RimM [Listeria monocytogenes Clip81459]
 gi|259585647|sp|C1KW92|RIMM_LISMC RecName: Full=Ribosome maturation factor rimM
 gi|225876858|emb|CAS05567.1| Putative 16S rRNA processing protein RimM [Listeria monocytogenes
           serotype 4b str. CLIP 80459]
          Length = 172

 Score = 60.5 bits (145), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 83/174 (47%), Gaps = 9/174 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNP-----IDLNRYVLYSNDNR-ELRILKMYRKN 57
           ++K+  +  I  THGL GE+ + +  + P     +    Y+   N  + E  I++ +RK+
Sbjct: 1   MEKMYNVGKIVNTHGLIGEIRVIATTDFPEERFQVGNTVYLFEKNSKKPEKLIIRSHRKH 60

Query: 58  KRF-IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           K F +  F G   IH    +++  L  K     D  LEE+EF+  ++         GK  
Sbjct: 61  KNFDLLMFEGFTGIHQVERMKEGVLKIKEAQLTD--LEENEFYFHEIIGCIVVTTDGKEL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           G++  +   GA  +  +K + +K  LIP+    V E+N+ + KI I+ +   L+
Sbjct: 119 GEITEILTPGANDVWVVKGSDKKEKLIPYIADVVKEININDKKITIEVMEGLLD 172


>gi|172060005|ref|YP_001807657.1| 16S rRNA-processing protein RimM [Burkholderia ambifaria MC40-6]
 gi|209573545|sp|B1YV58|RIMM_BURA4 RecName: Full=Ribosome maturation factor rimM
 gi|171992522|gb|ACB63441.1| 16S rRNA processing protein RimM [Burkholderia ambifaria MC40-6]
          Length = 225

 Score = 60.5 bits (145), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 79/174 (45%), Gaps = 17/174 (9%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNP------IDLNRYVLYSNDNR-ELRILKMYRKN 57
           D  V +  +   +GL G + + ++A+        +D  R+ L     R   RIL+     
Sbjct: 49  DDAVEVGAVVDAYGLKGWIKVATHADAGRGGDALLDARRWWLERGGERLSARILQSKTHG 108

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              +A  +G+ +  +A  LR  +++ +R+DF   EL  DEF+  DL  +E  + Q    G
Sbjct: 109 DTVVAHAAGVSDRDAALALRGFRVFVRREDFP--ELAADEFYWVDLIGLEVVNEQSVALG 166

Query: 118 QVCGVYNFGAGSILEI------KNTMEKT--FLIPFTKFAVLEVNLQENKILID 163
            V G+ + G  SI+ +      K+    T   LIPF    V  V+    +I++D
Sbjct: 167 TVSGMIDNGVHSIMRVEYPAVGKDGQPTTDERLIPFVGVYVKTVDQAARRIVVD 220


>gi|319401470|gb|EFV89680.1| 16S rRNA processing protein RimM [Staphylococcus epidermidis
           FRI909]
          Length = 167

 Score = 60.5 bits (145), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/168 (27%), Positives = 83/168 (49%), Gaps = 8/168 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDS---YANNPIDLNRYVLYSNDNREL-RILKMYRKNKRF-IA 62
           V +  I  THG+ GEV + S   +          +L  ++N E+   +  YR +K F + 
Sbjct: 3   VEVGQIVNTHGIKGEVKVKSNSDFTETRFQPGEQLLVKHNNTEIVYTVDSYRIHKGFHML 62

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F GI+NI+    L+   +Y +R D +D EL E E++ +D+     F       G+V  +
Sbjct: 63  RFEGINNINEIEHLKGDYIYQER-DHQDIELGEHEYYYSDIIGCTVFKDDDTPIGRVINI 121

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           +  GA  +  +K   EK +LIP+ +  V +++++   I I P+   L+
Sbjct: 122 FETGANDVWVVKG--EKEYLIPYIEDVVKDIDIENKTIKITPMEGLLD 167


>gi|111225150|ref|YP_715944.1| 16S rRNA-processing protein RimM [Frankia alni ACN14a]
 gi|122953795|sp|Q0RDP3|RIMM_FRAAA RecName: Full=Ribosome maturation factor rimM
 gi|111152682|emb|CAJ64423.1| 16S rRNA processing protein rimM [Frankia alni ACN14a]
          Length = 180

 Score = 60.5 bits (145), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 77/170 (45%), Gaps = 15/170 (8%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRE-----LRILKMYRKNKRFIA 62
           +++  IG  HG+ G+V I+   + P    R+ L +   RE     L + +    + R + 
Sbjct: 5   IVVGRIGRPHGVRGDVTIEVRTDLP--QRRFALGAVLGREGGGAPLTVAEARWHSGRLLL 62

Query: 63  TFSGIDNIHSASELRDLKLY-------AKRQDFKDEELEE-DEFFNTDLEEMETFDRQGK 114
            F G+++  +A  LRD+ L            D +D E E  D +++ DL  +E     G 
Sbjct: 63  RFQGVEDRGAAEALRDVLLTIDSAEAGPPVDDDEDAEGEGGDIWWDRDLVGLEAVTTAGA 122

Query: 115 YWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
             G+V  V +  AG +L +        L+PF +  V  V+    +I++DP
Sbjct: 123 TLGRVTDVIHAPAGDLLAVGRPGGGEHLVPFVREIVPTVDPAAGRIVVDP 172


>gi|317495378|ref|ZP_07953747.1| 16S rRNA processing protein RimM [Gemella moribillum M424]
 gi|316914437|gb|EFV35914.1| 16S rRNA processing protein RimM [Gemella moribillum M424]
          Length = 169

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/166 (28%), Positives = 83/166 (50%), Gaps = 9/166 (5%)

Query: 10  MATIGTTHGLNGEVYIDS---YANNPIDLNRYVLYSNDNRELR--ILKMYRKNKRFI-AT 63
           +  I  TH L GEV + S   +          +L +  N+ +R  +++ YR +K F+   
Sbjct: 5   VGKIVNTHSLKGEVKVISSTDFEEERFKKGSKLLITRGNQLIREVVVQSYRNHKNFLLVK 64

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F GID++  A +L++L++  K    K  ELEE+EF+   +   E FD   K  G++  + 
Sbjct: 65  FEGIDSVEEAEKLKNLQI--KIDSDKVGELEENEFYFHQIIGCEVFDENDKNLGEIIDIL 122

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
             GA  +  IK    K  LIP+ +  V ++++   K+ I+ +  GL
Sbjct: 123 TPGANDVWVIKGENGKEILIPYIEDVVKKIDITNKKVNIE-VMEGL 167


>gi|134102488|ref|YP_001108149.1| 16S rRNA processing protein [Saccharopolyspora erythraea NRRL 2338]
 gi|291004121|ref|ZP_06562094.1| 16S rRNA processing protein [Saccharopolyspora erythraea NRRL 2338]
 gi|166226476|sp|A4FME9|RIMM_SACEN RecName: Full=Ribosome maturation factor rimM
 gi|133915111|emb|CAM05224.1| 16S rRNA processing protein [Saccharopolyspora erythraea NRRL 2338]
          Length = 180

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 77/172 (44%), Gaps = 15/172 (8%)

Query: 5   DKLVLMATIGT---THGLNGEVYIDSYANNP---------IDLNRYVLYSNDNRELRILK 52
           DK  L   +G     HG+ GE+ ++   ++P         + + R   ++++N    +  
Sbjct: 3   DKQPLTLAVGRIVRPHGVRGELVVEVRTDSPELRFAPGSVLGMRRRGAHASEN--FTVAA 60

Query: 53  MYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQ 112
                 R +    G++   +A ELR   L     + +  + + DEF +  LE +      
Sbjct: 61  ARPHAGRLLVRAEGVEGREAAEELRGALLTVTADELESTD-DPDEFHDHQLEGLRVVFPA 119

Query: 113 GKYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           G+  G V  V +  AG +L ++   ++  L+PF    V E++L+  +I++DP
Sbjct: 120 GEEAGVVAEVVHTPAGELLAVRTPDDREVLVPFVSEMVPEIDLEAGRIVVDP 171


>gi|313888498|ref|ZP_07822165.1| 16S rRNA processing protein RimM [Peptoniphilus harei
           ACS-146-V-Sch2b]
 gi|312845527|gb|EFR32921.1| 16S rRNA processing protein RimM [Peptoniphilus harei
           ACS-146-V-Sch2b]
          Length = 167

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/145 (29%), Positives = 70/145 (48%), Gaps = 5/145 (3%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY--VLYSNDNRELRILKMYRKNKRFIA 62
           D +  +  I  THG+ GE+ +D Y  +    ++   V    D +E  I K+ R N     
Sbjct: 6   DSITCIGKIINTHGIKGELKVDPYTFDKKRFSKLESVFVGEDLKEFFIKKV-RVNDFVYL 64

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
           +F G +NI+    L+   +Y K +D    ELEED+++ +DL   E +D  G Y G +  V
Sbjct: 65  SFEGYENINDVLNLKGFNIYIKDED--RLELEEDQYYVSDLIGKEVYDTDGNYIGVLKEV 122

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTK 147
             + A  I  I+   + T+ +P  K
Sbjct: 123 LEYPANDIFVIEGKDKGTYQVPGVK 147


>gi|57866698|ref|YP_188388.1| 16S rRNA-processing protein RimM [Staphylococcus epidermidis RP62A]
 gi|242242522|ref|ZP_04796967.1| 16S rRNA processing protein RimM [Staphylococcus epidermidis
           W23144]
 gi|67461258|sp|Q5HPV2|RIMM_STAEQ RecName: Full=Ribosome maturation factor rimM
 gi|57637356|gb|AAW54144.1| 16S rRNA processing protein RimM [Staphylococcus epidermidis RP62A]
 gi|242234030|gb|EES36342.1| 16S rRNA processing protein RimM [Staphylococcus epidermidis
           W23144]
          Length = 167

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/168 (27%), Positives = 83/168 (49%), Gaps = 8/168 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDS---YANNPIDLNRYVLYSNDNREL-RILKMYRKNKRF-IA 62
           V +  I  THG+ GEV + S   +          +L  ++N E+   +  YR +K F + 
Sbjct: 3   VEVGQIVNTHGIKGEVKVKSNSDFTETRFQPGEQLLVKHNNTEIVYTVDSYRIHKGFHML 62

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F GI+NI+    L+   +Y +R D +D EL E E++ +D+     F       G+V  +
Sbjct: 63  RFEGINNINDIEHLKGDYIYQER-DHQDIELGEHEYYYSDIIGCTVFKDDDTPIGRVINI 121

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           +  GA  +  +K   EK +LIP+ +  V +++++   I I P+   L+
Sbjct: 122 FETGANDVWIVKG--EKEYLIPYIEDVVKDIDIENKTIKITPMEGLLD 167


>gi|85708913|ref|ZP_01039979.1| 16S rRNA processing protein [Erythrobacter sp. NAP1]
 gi|85690447|gb|EAQ30450.1| 16S rRNA processing protein [Erythrobacter sp. NAP1]
          Length = 175

 Score = 59.7 bits (143), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/155 (29%), Positives = 70/155 (45%), Gaps = 8/155 (5%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIATFSG 66
           LV +A I   HG+ GEV +         L ++  ++     L+ ++   K    IA F+ 
Sbjct: 13  LVELAAITGAHGVAGEVRLKLLGEGLDALRQHKSFNGGALTLKKVRSDNKGG-AIARFAE 71

Query: 67  IDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFG 126
           +     A  LR   L  +R+     ELEE E+++ DL  +      G   G+V  V NFG
Sbjct: 72  VQGRGEAERLRGTVLTVQREALP--ELEEGEYYHADLIGLAVETDAGNAIGKVTAVQNFG 129

Query: 127 AGSILEIK-----NTMEKTFLIPFTKFAVLEVNLQ 156
           A  I+EI          K  ++P TK AV+E + Q
Sbjct: 130 ATDIIEIALDPPPEKGLKAIMVPMTKAAVIEWDAQ 164


>gi|108760176|ref|YP_631740.1| 16S rRNA processing protein RimM [Myxococcus xanthus DK 1622]
 gi|122388855|sp|Q1D6I3|RIMM_MYXXD RecName: Full=Ribosome maturation factor rimM
 gi|108464056|gb|ABF89241.1| 16S rRNA processing protein RimM [Myxococcus xanthus DK 1622]
          Length = 188

 Score = 59.7 bits (143), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 75/157 (47%), Gaps = 7/157 (4%)

Query: 13  IGTTHGLNGEVYIDSY--ANNPID-LNRYVLYSNDN--RELRILKMYRKNKRFIATFSGI 67
           +   HGL GEV I +   A+  +D ++R  + +     RE+R+  +    K  I    G+
Sbjct: 13  VARAHGLRGEVAIRALDPASETLDTVDRIWVRTRAGVEREMRLEALRPTPKEDIVVLEGV 72

Query: 68  DNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFGA 127
           ++ + A  L   K++  R+D   E   E EFF  DL  ++  D  G   G+V  ++  G 
Sbjct: 73  ESRNDAEALVGAKVFVFREDL--EPPAEGEFFQGDLVGLDAVDANGNALGRVEEIWTTGE 130

Query: 128 GSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
              L I+ +  +  ++PF    V  V+L+  +I+I P
Sbjct: 131 VPNLVIRASGREELVVPFADEFVPTVDLEARRIVIHP 167


>gi|217964055|ref|YP_002349733.1| 16S rRNA processing protein RimM [Listeria monocytogenes HCC23]
 gi|254797753|sp|B8DDW0|RIMM_LISMH RecName: Full=Ribosome maturation factor rimM
 gi|217333325|gb|ACK39119.1| 16S rRNA processing protein RimM [Listeria monocytogenes HCC23]
          Length = 172

 Score = 59.7 bits (143), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 83/174 (47%), Gaps = 9/174 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNP-----IDLNRYVLYSNDNR-ELRILKMYRKN 57
           ++K+  +  I  THGL GE+ + +  + P     +    Y+   N  + E  I++ +RK+
Sbjct: 1   MEKMYNVGKIVNTHGLIGEIRVIATTDFPEERFQVGNTVYLFEKNSKKPEKLIIRSHRKH 60

Query: 58  KRF-IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           K F +  F G   IH    +++  L  K     D  LEE+EF+  ++         G+  
Sbjct: 61  KNFDLLMFEGFTGIHQVERMKEGVLKIKEAQLTD--LEENEFYFHEIIGCTVVTTDGEEL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           G++  +   GA  +  +K + +K  LIP+    V E+N+ + KI I+ +   L+
Sbjct: 119 GEITEILTPGANDVWVVKGSDKKEKLIPYIADVVKEININDKKITIEVMEGLLD 172


>gi|308235877|ref|ZP_07666614.1| 16S rRNA processing protein RimM [Gardnerella vaginalis ATCC 14018]
          Length = 194

 Score = 59.7 bits (143), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 53/172 (30%), Positives = 84/172 (48%), Gaps = 16/172 (9%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRY--VLYSNDN-RELRILKMYRKNKRFIAT 63
           L+ +  IG   GL GEV +  + + P +  +   VLY+ D  RE  I        R+I  
Sbjct: 17  LLRVCRIGKAQGLKGEVTVQIFTDEPYERFKAGNVLYTQDGEREFTIESARTFKSRWILL 76

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLE-------EMETFDRQGKYW 116
           F    N + A  L  L+LY K Q  ++ E +E+ ++  DL        E  +     +  
Sbjct: 77  FEQSLNRNDAEALNGLELYTKAQSAQELE-QENAWYIKDLVGLSARICENNSLGVAPREI 135

Query: 117 GQVCGVYNFGAGSILEIKNTM----EKTFLIPFTKFAVLEVNLQENKILIDP 164
           G+V  V + GA S+L+I+ +     +KT L+PF +  V EVNL+E  + +DP
Sbjct: 136 GKVVDVID-GAQSLLKIRLSTPVGDDKTALVPFVQALVPEVNLKEKYLTLDP 186


>gi|313139561|ref|ZP_07801754.1| conserved hypothetical protein [Bifidobacterium bifidum NCIMB
           41171]
 gi|313132071|gb|EFR49688.1| conserved hypothetical protein [Bifidobacterium bifidum NCIMB
           41171]
          Length = 200

 Score = 59.7 bits (143), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 88/182 (48%), Gaps = 26/182 (14%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNRELRILKMYRKNK-RF 60
           +L+ +  IG   GL GEV +  + + P    R+    VLY+ D  +  +++  R  K R+
Sbjct: 14  ELLRVCRIGRAQGLKGEVTVQIFTDEP--EYRFAPDSVLYTRDGSQEYVVEYARTFKNRW 71

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG--- 117
           I  F GID+  ++     ++LY +  D +D  LEED ++  DL  +E    +G   G   
Sbjct: 72  IVKFEGIDDRDASEAANGIELYGEADDPEDM-LEEDAWYPKDLVGLEARLAEGNGLGLPA 130

Query: 118 -QVCG-VYNF--GAGSILEIK-----------NTMEKTFLIPFTKFAVLEVNLQENKILI 162
            QV G V +    A ++L+I+              E T L+PF    V +++L+E  + I
Sbjct: 131 GQVIGKVVDVLDSAQTLLKIRLVSPVRDTVTGEVTESTALVPFVDELVPDIDLEEGYLTI 190

Query: 163 DP 164
           DP
Sbjct: 191 DP 192


>gi|311115027|ref|YP_003986248.1| 16S rRNA processing protein RimM [Gardnerella vaginalis ATCC 14019]
 gi|310946521|gb|ADP39225.1| 16S rRNA processing protein RimM [Gardnerella vaginalis ATCC 14019]
          Length = 198

 Score = 59.7 bits (143), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 53/172 (30%), Positives = 84/172 (48%), Gaps = 16/172 (9%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRY--VLYSNDN-RELRILKMYRKNKRFIAT 63
           L+ +  IG   GL GEV +  + + P +  +   VLY+ D  RE  I        R+I  
Sbjct: 21  LLRVCRIGKAQGLKGEVTVQIFTDEPYERFKAGNVLYTQDGEREFTIESARTFKSRWILL 80

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLE-------EMETFDRQGKYW 116
           F    N + A  L  L+LY K Q  ++ E +E+ ++  DL        E  +     +  
Sbjct: 81  FEQSLNRNDAEALNGLELYTKAQSAQELE-QENAWYIKDLVGLSARICENNSLGVAPREI 139

Query: 117 GQVCGVYNFGAGSILEIKNTM----EKTFLIPFTKFAVLEVNLQENKILIDP 164
           G+V  V + GA S+L+I+ +     +KT L+PF +  V EVNL+E  + +DP
Sbjct: 140 GKVVDVID-GAQSLLKIRLSTPVGDDKTALVPFVQALVPEVNLKEKYLTLDP 190


>gi|311063761|ref|YP_003970486.1| 16S rrNA processing protein [Bifidobacterium bifidum PRL2010]
 gi|310866080|gb|ADP35449.1| RimM 16S rRNA processing protein [Bifidobacterium bifidum PRL2010]
          Length = 200

 Score = 59.7 bits (143), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 88/182 (48%), Gaps = 26/182 (14%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNRELRILKMYRKNK-RF 60
           +L+ +  IG   GL GEV +  + + P    R+    VLY+ D  +  +++  R  K R+
Sbjct: 14  ELLRVCRIGRAQGLKGEVTVQIFTDEP--EYRFAPDSVLYTRDGSQEYVVEYARTFKNRW 71

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG--- 117
           I  F GID+  ++     ++LY +  D +D  LEED ++  DL  +E    +G   G   
Sbjct: 72  IVKFEGIDDRDASEAANGIELYGEADDPEDM-LEEDAWYPKDLVGLEARLAEGNGLGLPA 130

Query: 118 -QVCG-VYNF--GAGSILEIK-----------NTMEKTFLIPFTKFAVLEVNLQENKILI 162
            QV G V +    A ++L+I+              E T L+PF    V +++L+E  + I
Sbjct: 131 GQVIGKVVDVLDSAQTLLKIRLVSPVRDSVTGEVTESTALVPFVDELVPDIDLEEGYLTI 190

Query: 163 DP 164
           DP
Sbjct: 191 DP 192


>gi|154503293|ref|ZP_02040353.1| hypothetical protein RUMGNA_01117 [Ruminococcus gnavus ATCC 29149]
 gi|153795960|gb|EDN78380.1| hypothetical protein RUMGNA_01117 [Ruminococcus gnavus ATCC 29149]
          Length = 172

 Score = 59.7 bits (143), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 84/167 (50%), Gaps = 12/167 (7%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNP---IDLNRYVLYSNDNR---ELRILKMYRKN 57
           +++ + +  I +THG+ GEV +    ++P     L + +L +   +   E++ +K +++ 
Sbjct: 1   MEQFLQVGVISSTHGIRGEVKVFPTTDDPNRFKKLKKVILETKKEKLSLEVQGVKFFKQ- 59

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQG--KY 115
              I  F GIDNI+   + +   L+  R+D     LEEDE+F  DL  ME +  +   + 
Sbjct: 60  -FVIVKFKGIDNINDIEQYKGCSLFVSRED--AVALEEDEYFIADLIGMEVYTDENPEEL 116

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
           +G +  V   GA  +  +++      LIP  +  +L V+++  K+ +
Sbjct: 117 FGTLKDVIETGANEVYLVESKTHGEVLIPAIRQCILSVDVKAQKMQV 163


>gi|310286860|ref|YP_003938118.1| 16S rRNA processing protein rimM [Bifidobacterium bifidum S17]
 gi|309250796|gb|ADO52544.1| 16S rRNA processing protein rimM [Bifidobacterium bifidum S17]
          Length = 204

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 88/182 (48%), Gaps = 26/182 (14%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNRELRILKMYRKNK-RF 60
           +L+ +  IG   GL GEV +  + + P    R+    VLY+ D  +  +++  R  K R+
Sbjct: 18  ELLRVCRIGRAQGLKGEVTVQIFTDEP--EYRFAPDSVLYTRDGSQEYVVEYARTFKNRW 75

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGK----YW 116
           I  F GID+  ++     ++LY +  D +D  LEED ++  DL  +E    +G       
Sbjct: 76  IVKFEGIDDRDASEAANGIELYGEADDPEDM-LEEDAWYPKDLVGLEARLAEGNGLGLPA 134

Query: 117 GQVCG-VYNF--GAGSILEIK-----------NTMEKTFLIPFTKFAVLEVNLQENKILI 162
           GQV G V +    A ++L+I+              E T L+PF    V +++L+E  + I
Sbjct: 135 GQVIGKVVDVLDSAQTLLKIRLVSPVRDTVTGEVTESTALVPFVDELVPDIDLEEGYLTI 194

Query: 163 DP 164
           DP
Sbjct: 195 DP 196


>gi|134295101|ref|YP_001118836.1| 16S rRNA-processing protein RimM [Burkholderia vietnamiensis G4]
 gi|209573556|sp|A4JCJ8|RIMM_BURVG RecName: Full=Ribosome maturation factor rimM
 gi|134138258|gb|ABO54001.1| 16S rRNA processing protein RimM [Burkholderia vietnamiensis G4]
          Length = 225

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 80/174 (45%), Gaps = 17/174 (9%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNP------IDLNRYVLYSNDNR-ELRILKMYRKN 57
           D  V +  +   +GL G + + ++A+        +   R+ L     R  +RIL+     
Sbjct: 49  DDAVEVGAVVDAYGLKGWIKVAAHADAGRGGDALLSARRWWLERGAERLSVRILQSKTHG 108

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              +A  +G+D+  +A  +R  +++ +R+DF    L  DEF+  DL  +E  + Q    G
Sbjct: 109 DTVVAQPAGVDDRDAALAMRGFRVFVRREDFP--ALAADEFYWVDLIGLEVVNEQSVSLG 166

Query: 118 QVCGVYNFGAGSILEI------KNTMEKT--FLIPFTKFAVLEVNLQENKILID 163
           +V G+ + G  SIL +      K+    T   LIPF    V  V+    +I++D
Sbjct: 167 KVSGMIDNGVHSILRVEYPTVGKDGAPATDERLIPFVGVYVKTVDQAARRIVVD 220


>gi|302344584|ref|YP_003809113.1| 16S rRNA processing protein RimM [Desulfarculus baarsii DSM 2075]
 gi|301641197|gb|ADK86519.1| 16S rRNA processing protein RimM [Desulfarculus baarsii DSM 2075]
          Length = 179

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 73/164 (44%), Gaps = 7/164 (4%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLY----SNDNRELRILKMYRKNKRF 60
           +LV M     + GL GEV I S+A +     R  V+Y        +  R+L       R 
Sbjct: 5   RLVTMGRSAGSFGLRGEVKISSFAEDHEVFARAGVVYLGAEPGVAKPYRLLGARWHGGRL 64

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           + T  G+     A+ L    LY +R+D     L +DEF+  +L        QG+  G V 
Sbjct: 65  LMTLEGVTTREDAAALGGAWLYLRREDLP--PLADDEFYWFELIGARARTAQGQDLGHVF 122

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
            + + GA   L ++    K  +IP  +  ++E++L    +++DP
Sbjct: 123 ALTDNGAHDNLVLRGPGGKEAMIPLVEGVLVEMDLAAGLVVVDP 166


>gi|153854840|ref|ZP_01996063.1| hypothetical protein DORLON_02068 [Dorea longicatena DSM 13814]
 gi|149752542|gb|EDM62473.1| hypothetical protein DORLON_02068 [Dorea longicatena DSM 13814]
          Length = 187

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/168 (28%), Positives = 84/168 (50%), Gaps = 12/168 (7%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYV----LYSNDNRELRILKM--YR 55
           V +++L+ +  I +THG+ GEV +    ++P   NR+     +  +  RE + L++   +
Sbjct: 18  VFMEELLQVGVITSTHGVRGEVKVFPTTDDP---NRFKSLKHVLLDTGREKKSLEVQGVK 74

Query: 56  KNKRF-IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGK 114
             K+F I  F GIDNI+     +   L  +R+D    ELEEDE+F  D+  +E      K
Sbjct: 75  FFKQFVILKFKGIDNINDIERYKRCPLLVERKDAV--ELEEDEYFIADMIGIEVVTEDDK 132

Query: 115 YWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
            +G +  V   GA  +  I        L+P  +  +L+V+++  K+ I
Sbjct: 133 PFGTLKDVMETGANDVYVIDTDEHGEVLVPAIRECILDVDIENQKMKI 180


>gi|25028513|ref|NP_738567.1| 16S rRNA-processing protein [Corynebacterium efficiens YS-314]
 gi|259507567|ref|ZP_05750467.1| 16S rRNA processing protein RimM [Corynebacterium efficiens YS-314]
 gi|46397692|sp|Q8FP33|RIMM_COREF RecName: Full=Ribosome maturation factor rimM
 gi|23493798|dbj|BAC18767.1| putative 16S rRNA processing protein [Corynebacterium efficiens
           YS-314]
 gi|259164841|gb|EEW49395.1| 16S rRNA processing protein RimM [Corynebacterium efficiens YS-314]
          Length = 169

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/156 (31%), Positives = 75/156 (48%), Gaps = 13/156 (8%)

Query: 16  THGLNGEVYIDSYANNPIDLNRY----VLYSND-NRE--LRILKMYRKNKRFIATFSGID 68
           +HG+ GEV ++   ++P D+ RY    VL+     RE  L I        R +  F  I 
Sbjct: 13  SHGIRGEVVVEVTTDDP-DI-RYAPGEVLHGRQTGREHTLTIDTARAHQGRLLIKFEEIP 70

Query: 69  NIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFGAG 128
           +  +A  LR  + +A   + +D+E   + F++ +LE +      G   G V GV +  AG
Sbjct: 71  DRTAADSLRGTRFFAPPLEREDDE---EGFYDHELEGLRII-HDGADIGVVTGVMHGPAG 126

Query: 129 SILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
            ILE++ T  K  LIPF    V EV+L+     I P
Sbjct: 127 EILEVELTSGKEVLIPFVHAIVPEVDLEAGTATITP 162


>gi|254901179|ref|ZP_05261103.1| 16S rRNA-processing protein RimM [Listeria monocytogenes J0161]
 gi|254914088|ref|ZP_05264100.1| conserved hypothetical protein [Listeria monocytogenes J2818]
 gi|293592110|gb|EFG00445.1| conserved hypothetical protein [Listeria monocytogenes J2818]
          Length = 172

 Score = 59.3 bits (142), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 82/174 (47%), Gaps = 9/174 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNP-----IDLNRYVLYSNDNR-ELRILKMYRKN 57
           ++K+  +  I  THGL GE+ + +  + P     +    Y+   N  + E  I++ +RK+
Sbjct: 1   MEKMYNVGKIVNTHGLIGEIRVIATTDFPEERFQVGNTVYLFEKNSKKPEKLIIRSHRKH 60

Query: 58  KRF-IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           K F +  F G   IH    +++  L  K     D  LEE+EF+  ++         G+  
Sbjct: 61  KNFDLLMFEGFTGIHQVERMKEGVLKIKETQLTD--LEENEFYFHEIIGCTVVTTDGEEL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           G++  +   GA  +  +K   +K  LIP+    V E+N+ + KI I+ +   L+
Sbjct: 119 GEITEILTPGANDVWVVKGADKKEKLIPYIADVVKEINIDDQKITIEVMEGLLD 172


>gi|331085166|ref|ZP_08334252.1| 16S rRNA processing protein RimM [Lachnospiraceae bacterium
           9_1_43BFAA]
 gi|330407949|gb|EGG87439.1| 16S rRNA processing protein RimM [Lachnospiraceae bacterium
           9_1_43BFAA]
          Length = 189

 Score = 59.3 bits (142), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 45/157 (28%), Positives = 77/157 (49%), Gaps = 6/157 (3%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNR--YVLYSNDNRELRI-LKMYRKNKRF-IATFS 65
           +  I +THG+ GEV +    ++     +  +VL      +L + ++  +  K+F I  F 
Sbjct: 28  VGVISSTHGVRGEVKVFPTTDDVKRFKKLKHVLLDTGKEQLPLEVEQVKFFKQFAILKFK 87

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNF 125
           GIDNI+   + +   L   R+D    +L++DE+F  D+  M  F   G  +G +  V   
Sbjct: 88  GIDNINDIEKYKGKSLLVDRKDAV--KLKKDEYFIADMIGMHVFTEDGAEFGTLRDVLET 145

Query: 126 GAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
           GA  +  I  T  K  L+P  K  +L V+++E K+ I
Sbjct: 146 GANDVYIIDTTDGKEVLVPAIKQCILNVDIEEQKMTI 182


>gi|313623297|gb|EFR93533.1| 16S rRNA processing protein RimM [Listeria innocua FSL J1-023]
          Length = 172

 Score = 59.3 bits (142), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 83/174 (47%), Gaps = 9/174 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNP-----IDLNRYVLYSNDNR-ELRILKMYRKN 57
           ++K+  +  I  THGL GE+ + +  + P     +    Y+   N  + E  I++ +RK+
Sbjct: 1   MEKMYNVGKIVNTHGLIGEIRVIATTDFPEERFQVGNTVYLFEKNSKKPEKLIIRSHRKH 60

Query: 58  KRF-IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           K F +  F G+  IH    +++  L  K     D  LEE+EF+  ++         G+  
Sbjct: 61  KNFDLLMFEGLTGIHQVERMKEGVLKIKEAQLTD--LEENEFYFHEIIGCTVVTTDGEEL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           G++  +   GA  +  +K T +K  LIP+    V ++N  + KI I+ +   L+
Sbjct: 119 GEITEILTPGANDVWVVKGTDKKEKLIPYIADVVKDINTNDKKITIEVMEGLLD 172


>gi|160872661|ref|ZP_02062793.1| 16S rRNA processing protein RimM [Rickettsiella grylli]
 gi|159121460|gb|EDP46798.1| 16S rRNA processing protein RimM [Rickettsiella grylli]
          Length = 170

 Score = 59.3 bits (142), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 73/147 (49%), Gaps = 11/147 (7%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYA---NNPIDLNRYVLYSNDNRELRILKMYRK----NK 58
           K +L+ +IG  +G+NG V I+SY     N ID   + L +   R   IL   +K     +
Sbjct: 4   KKILVGSIGKPYGINGWVKINSYTEPFTNLIDYRPWYLEAPGKRSSPILVGVKKCCLHGQ 63

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
           + +A F       SA    + K+Y +R  F    L   E++  DLE ++ ++R+  Y G 
Sbjct: 64  QLLALFENSTTPESARFYTNYKIYVERDQF--FPLHAGEYYWADLEGLKVYNRENIYLGI 121

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPF 145
           +  ++  GA  +L I +  +K +L+PF
Sbjct: 122 IQIIFATGANDVLVISD--KKRYLVPF 146


>gi|225018484|ref|ZP_03707676.1| hypothetical protein CLOSTMETH_02431 [Clostridium methylpentosum
           DSM 5476]
 gi|224948755|gb|EEG29964.1| hypothetical protein CLOSTMETH_02431 [Clostridium methylpentosum
           DSM 5476]
          Length = 174

 Score = 59.3 bits (142), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 42/158 (26%), Positives = 72/158 (45%), Gaps = 8/158 (5%)

Query: 13  IGTTHGLNGEVYIDSYANNPIDLNRY--VLYSNDNRELRILKMYRKNKRFIAT-FSGIDN 69
           I  THG+ GEV I  + +    L  +  + +    +  R ++  R +K  +   F G+D+
Sbjct: 12  IVATHGIAGEVRIQPWCDEAEFLTEFDALYFDAAGKTQRTVERARVHKNVVVVKFKGVDS 71

Query: 70  IHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGK--YWGQVCGVYNFGA 127
           +  A  LR+  +Y  R++    EL E  +F  DL  +E  D       +G +C V   GA
Sbjct: 72  VEEAQSLRNQIVYIDREEL---ELPEGTYFIQDLIGLEVLDADDPQTVYGTLCEVSQPGA 128

Query: 128 GSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPI 165
             +  I+       LIP     V++ +L  N++ I P+
Sbjct: 129 NDVYHIRRPDGTENLIPAIPDVVVQTDLDGNRMFIRPL 166


>gi|57242690|ref|ZP_00370627.1| 16S rRNA processing protein RimM, putative [Campylobacter
           upsaliensis RM3195]
 gi|57016619|gb|EAL53403.1| 16S rRNA processing protein RimM, putative [Campylobacter
           upsaliensis RM3195]
          Length = 176

 Score = 58.9 bits (141), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 47/167 (28%), Positives = 87/167 (52%), Gaps = 12/167 (7%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-YVLYSNDNRELRILKMYRKNKRFIA 62
           + K VL+A IG + GL G + + + ++ P    +    ++ D REL ++K Y KN++ + 
Sbjct: 1   MSKFVLVAKIGRSVGLRGYLKLHNLSDFPSQFQKNLTFFTKDKREL-VIKDYDKNRQSVL 59

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDE-ELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
            F   +++     L +L+LY   +  ++  +L++DEFF  D+   E  D Q    GQV  
Sbjct: 60  -FYTYESLEKTKNLVNLELYQSIEKTRELCKLKKDEFFYFDIIGCEVRDEQ-IILGQVQD 117

Query: 122 VYNFGAGSILEIKNT-------MEKTFLIPFTKFAVLEVNLQENKIL 161
           +   G G + EIK+          K F IP+    +L++++++ +IL
Sbjct: 118 ILESGGGYLFEIKSDEKLTVQGFSKIFFIPYIDKYILQIDIEKKQIL 164


>gi|258612038|ref|ZP_05243865.2| ribosome maturation factor rimM [Listeria monocytogenes FSL R2-503]
 gi|300766440|ref|ZP_07076395.1| 16S rRNA processing protein RimM [Listeria monocytogenes FSL
           N1-017]
 gi|258607916|gb|EEW20524.1| ribosome maturation factor rimM [Listeria monocytogenes FSL R2-503]
 gi|300512864|gb|EFK39956.1| 16S rRNA processing protein RimM [Listeria monocytogenes FSL
           N1-017]
          Length = 169

 Score = 58.9 bits (141), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 79/168 (47%), Gaps = 9/168 (5%)

Query: 10  MATIGTTHGLNGEVYIDSYANNP-----IDLNRYVLYSNDNR-ELRILKMYRKNKRF-IA 62
           +  I  THGL GE+ + +  + P     +    Y+   N  + E  I++ +RK+K F + 
Sbjct: 4   VGKIVNTHGLIGEIRVIATTDFPEERFQVGNTVYLFEKNSKKPEKLIIRSHRKHKNFDLL 63

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F G   IH    +++  L  K     D  LEE+EF+  ++         GK  G++  +
Sbjct: 64  MFEGFTGIHQVERMKEGVLKIKEAQLTD--LEENEFYFHEIIGCIVVTTDGKELGEITEI 121

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
              GA  +  +K + +K  LIP+    V E+N+ + KI I+ +   L+
Sbjct: 122 LTPGANDVWVVKGSDKKEKLIPYIADVVKEININDKKITIEVMEGLLD 169


>gi|291563272|emb|CBL42088.1| 16S rRNA processing protein RimM [butyrate-producing bacterium
           SS3/4]
          Length = 171

 Score = 58.9 bits (141), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 44/172 (25%), Positives = 82/172 (47%), Gaps = 7/172 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPI---DLNRYVL--YSNDNRELRILKMYRKNK 58
           ++K + +  I + HG+ GEV +    ++ +    L++ +L     + REL+I ++     
Sbjct: 1   MEKYLRVGVITSPHGVRGEVKVYPTTDDVMRFKKLDKVILDLGRGETRELKIRQVKFFKN 60

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
             I  F G+D ++     R   L   R   +   LEEDEFF TDL  +     +G+  G 
Sbjct: 61  MVILKFDGVDTMNEVEGWRQKDLLITRD--QAIPLEEDEFFITDLIGLNVVTDEGETLGT 118

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           +  V   GA  +  +K    K  L+P  +  +L+V+L + ++L+  +   L+
Sbjct: 119 LTDVMETGANDVYCVKTPEGKELLLPAIRDCILDVDLDKEEMLVHVLPGLLD 170


>gi|15836713|ref|NP_297401.1| 16S rRNA-processing protein RimM [Xylella fastidiosa 9a5c]
 gi|71899241|ref|ZP_00681403.1| RimM protein:PRC-barrel [Xylella fastidiosa Ann-1]
 gi|14423900|sp|Q9PH38|RIMM_XYLFA RecName: Full=Ribosome maturation factor rimM
 gi|9104888|gb|AAF82921.1|AE003864_9 16S rRNA processing protein [Xylella fastidiosa 9a5c]
 gi|71730974|gb|EAO33043.1| RimM protein:PRC-barrel [Xylella fastidiosa Ann-1]
          Length = 170

 Score = 58.9 bits (141), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 44/165 (26%), Positives = 79/165 (47%), Gaps = 10/165 (6%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY---VLYSNDNRE--LRILKMYRKNKR 59
           ++ +L+  +    GL GE+ I+S+      + RY   +L S    E  L   + Y   KR
Sbjct: 5   ERRILLGRVVGGFGLRGEIKIESWTEPRDAIFRYQPWLLRSPTGTESMLNGARGYETGKR 64

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            IATF GI++ ++   +   ++Y  R          DE++  DLE ++    +G   G V
Sbjct: 65  LIATFPGINDRNAVEAICGTEIYVPRSALPPPH--PDEYYWVDLEGLQVHTLEGVVLGSV 122

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKF-AVLEVNLQENKILID 163
             +++ GA  ++ I    E+  LIPF +   V  V+ +  +I++D
Sbjct: 123 SHLFSNGANDVIVIHGERER--LIPFVQPDYVKSVDFEAERIVVD 165


>gi|225374448|ref|ZP_03751669.1| hypothetical protein ROSEINA2194_00063 [Roseburia inulinivorans DSM
           16841]
 gi|225213686|gb|EEG96040.1| hypothetical protein ROSEINA2194_00063 [Roseburia inulinivorans DSM
           16841]
          Length = 173

 Score = 58.9 bits (141), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 82/164 (50%), Gaps = 8/164 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYV-LYSNDNRELRILKM----YRKNK 58
           ++ L+ +  I TTHG+ GEV +    ++P    +   +  +  +EL  L++    + KN 
Sbjct: 1   MEDLLQVGVITTTHGVRGEVKVFPTTDDPARFKKLKNVVLDTGKELVDLEVAGVKFFKN- 59

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
             I  F GIDNI+   + R   LY  R++    +L+++E+F  DL  ++    +G+  G+
Sbjct: 60  MVIVKFKGIDNINDVEKYRKKSLYVTRENAV--KLKKNEYFIADLIGLQAESDEGEDLGE 117

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
           +  V   GA  +  +        L+P  K  V EV+L+  KI++
Sbjct: 118 LSDVLQTGANDVYVLSKEGTDDILLPAIKECVKEVDLENGKIIV 161


>gi|329936720|ref|ZP_08286427.1| 16S rRNA-processing protein RimM [Streptomyces griseoaurantiacus
           M045]
 gi|329303950|gb|EGG47833.1| 16S rRNA-processing protein RimM [Streptomyces griseoaurantiacus
           M045]
          Length = 211

 Score = 58.9 bits (141), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 77/163 (47%), Gaps = 9/163 (5%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNP-IDLNRYVLYSNDNRE---LRILKMYRKNKRFIAT 63
           +++A IG  HG+ GEV ++   + P + L    + + D      L I      + R +  
Sbjct: 3   LVVARIGRAHGIKGEVTVEVRTDEPELRLAPGAVLATDPPSAGPLTIETGRVHSGRLLLR 62

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEE--DEFFNTDLEEMETFDRQGKYWGQVCG 121
           F G+ +  +A  LR+  L A   D   EE+ E  DE+++  L +++     G   G++  
Sbjct: 63  FEGVRDRTAAEALRNTVLIA---DVDPEEMPEGEDEYYDHQLMDLDVVTVDGTEVGRITE 119

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           V +  +  +  ++       +IPF +  V E++L E K +IDP
Sbjct: 120 VSHLPSQDLFVVERPDGTEVMIPFVEEIVTEIDLAEQKAVIDP 162


>gi|315658472|ref|ZP_07911344.1| 16S rRNA processing protein RimM [Staphylococcus lugdunensis
           M23590]
 gi|315496801|gb|EFU85124.1| 16S rRNA processing protein RimM [Staphylococcus lugdunensis
           M23590]
          Length = 173

 Score = 58.5 bits (140), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 49/170 (28%), Positives = 87/170 (51%), Gaps = 13/170 (7%)

Query: 8   VLMATIGTTHGLNGEVYIDSYAN------NPIDLNRYVLYSNDNRELRILKMYRKNKRF- 60
           V +  I  THG+ GEV + S+++       P ++   + ++NDN EL +   YR +K F 
Sbjct: 10  VEVGQIVNTHGIKGEVKVKSHSDFTDTRFQPGEV-LTLKHNNDNVELTVTS-YRIHKGFH 67

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +  F G DNI+     +   LY +R D +  EL E EF+ +D+     F+ +    G+V 
Sbjct: 68  MLKFEGFDNINDVESFKGDYLYQER-DHEGIELAEHEFYYSDIIGCTVFNGEIPI-GRVI 125

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
            +   GA  +  +K   +K ++IP+    V +V+++   I+I P+   L+
Sbjct: 126 NIIETGANDVWVVKG--DKEYMIPYIADVVKDVDIENKMIMITPLEGLLD 173


>gi|255522476|ref|ZP_05389713.1| 16S rRNA-processing protein RimM [Listeria monocytogenes FSL
           J1-175]
 gi|328466403|gb|EGF37554.1| 16S rRNA-processing protein RimM [Listeria monocytogenes 1816]
 gi|332312234|gb|EGJ25329.1| Ribosome maturation factor rimM [Listeria monocytogenes str. Scott
           A]
          Length = 172

 Score = 58.5 bits (140), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 83/174 (47%), Gaps = 9/174 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNP-----IDLNRYVLYSNDNR-ELRILKMYRKN 57
           ++K+  +  I  THGL GE+ + +  + P     +    Y+   N  + E  I++ +RK+
Sbjct: 1   MEKMYNVGKIVNTHGLIGEIRVIATTDFPEERFQVGNTVYLFEKNSKKPEKLIIRSHRKH 60

Query: 58  KRF-IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           K F +  F G   IH    +++  L  K     D  LEE+EF+  ++         G+  
Sbjct: 61  KNFDLLMFEGFTGIHQVERMKEGVLKIKEAQLTD--LEENEFYFHEIIGCIVVTTDGEEL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           G++  +   GA  +  +K + +K  LIP+    V E+N+ + KI I+ +   L+
Sbjct: 119 GEITEILTPGANDVWVVKGSDKKEKLIPYIADVVKEININDKKITIEVMEGLLD 172


>gi|73667543|ref|YP_303559.1| 16S rRNA processing protein RimM [Ehrlichia canis str. Jake]
 gi|109893014|sp|Q3YQP4|RIMM_EHRCJ RecName: Full=Ribosome maturation factor rimM
 gi|72394684|gb|AAZ68961.1| 16S rRNA processing protein RimM [Ehrlichia canis str. Jake]
          Length = 173

 Score = 58.5 bits (140), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 84/160 (52%), Gaps = 5/160 (3%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSN--DNRELRILKMYRKNKRFIATF 64
           L+ +  I ++HG++G V I ++  +P D   Y + ++  +  ++ I+ +  +N       
Sbjct: 5   LICLGVITSSHGISGHVKIRTFTESPEDFTSYGMLTDGTNTYKISIVSVISQNIIIAKIK 64

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
           + +   + A  LR+ KL+ ++    +     DEF++ DL  +       K +G +  ++N
Sbjct: 65  NIVSR-NDADLLRNKKLFIEKDKLPNLT-NNDEFYHNDLIGLNVILENNKVYGNIKKIHN 122

Query: 125 FGAGSILEIK-NTMEKTFLIPFTKFAVLEVNLQENKILID 163
           FG+  I+EI  +  +K+ ++PFTK     +N++E  I+I+
Sbjct: 123 FGSCDIIEICLSNSKKSTMLPFTKNIFPYINIKEKYIIIN 162


>gi|212636511|ref|YP_002313036.1| 16S rRNA-processing protein RimM [Shewanella piezotolerans WP3]
 gi|226734092|sp|B8CQI3|RIMM_SHEPW RecName: Full=Ribosome maturation factor rimM
 gi|212557995|gb|ACJ30449.1| RimM protein:PRC-barrel [Shewanella piezotolerans WP3]
          Length = 176

 Score = 58.5 bits (140), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 84/166 (50%), Gaps = 12/166 (7%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNP---IDLNRYVLY-SNDNRELRILKMYRKNKRFIAT 63
           V++  +G++HG+ G + I +Y ++     D + ++L    + RE+++L+   + K  +A 
Sbjct: 8   VVLGKLGSSHGIKGWLKITTYTDSVEGIFDYSPWLLKEQGEWREVKVLQWRMQGKAVVAC 67

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
             G++    A  L + ++    +    E L EDEF+  DL   E  + +G   G+V  + 
Sbjct: 68  LEGVETRDQAQALTNCEIAVTPEQM--EVLPEDEFYWRDLIGCEVVNTKGYNMGKVQEIV 125

Query: 124 NFGAGSILEIKNTMEKTF-----LIPF-TKFAVLEVNLQENKILID 163
             G+  +L +K   +  F     +IPF T+  + +V+L   +IL+D
Sbjct: 126 ETGSNDVLLVKANAKDGFGKAERMIPFVTEQFIQKVDLTAKQILVD 171


>gi|319892248|ref|YP_004149123.1| 16S rRNA processing protein RimM [Staphylococcus pseudintermedius
           HKU10-03]
 gi|317161944|gb|ADV05487.1| 16S rRNA processing protein RimM [Staphylococcus pseudintermedius
           HKU10-03]
 gi|323464655|gb|ADX76808.1| 16S rRNA processing protein RimM [Staphylococcus pseudintermedius
           ED99]
          Length = 167

 Score = 58.5 bits (140), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 85/170 (50%), Gaps = 13/170 (7%)

Query: 8   VLMATIGTTHGLNGEVYIDSYAN------NPIDLNRYVLYSNDNRELRILKMYRKNKRF- 60
           V +  I  THG+ GEV + S+++       P ++ +   Y      L  +K +R +K   
Sbjct: 3   VEVGKIVNTHGIKGEVKVQSHSDFTEIRFQPGEVLQ-AEYQGQTL-LLTVKSHRMHKGLH 60

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           + TF G  NI+    L+   LY +R D +  EL+E EF+ +D+     FD   +  G+V 
Sbjct: 61  MLTFEGYTNINDIEHLKGTHLYQER-DHEAIELDEHEFYYSDIIGCTVFDGD-RPIGRVT 118

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
            ++  GA  +  +K   +K  LIP+    V EV+++  +I+I P+   LN
Sbjct: 119 EIFETGANDVWVVKG--DKEHLIPYIADVVKEVDIEGRRIVITPLEGLLN 166


>gi|315639579|ref|ZP_07894720.1| 16S rRNA processing protein RimM [Enterococcus italicus DSM 15952]
 gi|315484678|gb|EFU75133.1| 16S rRNA processing protein RimM [Enterococcus italicus DSM 15952]
          Length = 174

 Score = 58.5 bits (140), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 47/168 (27%), Positives = 83/168 (49%), Gaps = 13/168 (7%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNRY------VLYSNDNRELRI-LKMYRKNKRF-I 61
           +  I  THG+ GEV + S  +    L RY      VL+  +   L + +  YR++K F +
Sbjct: 7   VGKIVNTHGIRGEVRVISQTD--FALERYQPGKTLVLFRENQAPLTLTIDTYRRHKNFDL 64

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
            +F G  +I+     RD  L   ++D    EL E+EF+  ++   E    +GK  G+V  
Sbjct: 65  LSFEGYPSINQVESFRDGILKVAKED--RVELAENEFYYYEIIGAEVVTEEGKVIGKVKE 122

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           + + GA  +  ++   +K  L+P+    + EV++   KI+++ I  GL
Sbjct: 123 ILSPGANDVWVVQRKGKKDALLPYIDSVIKEVDVTAQKIIVE-IPEGL 169


>gi|28198019|ref|NP_778333.1| 16S rRNA-processing protein [Xylella fastidiosa Temecula1]
 gi|182680645|ref|YP_001828805.1| 16S rRNA-processing protein RimM [Xylella fastidiosa M23]
 gi|32129955|sp|Q87F55|RIMM_XYLFT RecName: Full=Ribosome maturation factor rimM
 gi|238691052|sp|B2I6A7|RIMM_XYLF2 RecName: Full=Ribosome maturation factor rimM
 gi|28056079|gb|AAO27982.1| 16S rRNA processing protein [Xylella fastidiosa Temecula1]
 gi|182630755|gb|ACB91531.1| 16S rRNA processing protein RimM [Xylella fastidiosa M23]
 gi|307579104|gb|ADN63073.1| 16S rRNA-processing protein RimM [Xylella fastidiosa subsp.
           fastidiosa GB514]
          Length = 170

 Score = 58.5 bits (140), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 44/165 (26%), Positives = 78/165 (47%), Gaps = 10/165 (6%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY---VLYSNDNRE--LRILKMYRKNKR 59
           ++ +L+  +    GL GE+ I+S+      + RY   +L S    E  L   + Y   KR
Sbjct: 5   ERRILLGRVVGGFGLRGEIKIESWTEPRDAIFRYQPWLLRSPTGTESMLNGARGYETGKR 64

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            IATF GI++ +    +   ++Y  R          DE++  DLE ++    +G   G V
Sbjct: 65  LIATFPGINDRNGVEAICGTEIYVPRSALPPPH--PDEYYWVDLEGLQVHTLEGVVLGSV 122

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKF-AVLEVNLQENKILID 163
             +++ GA  ++ I    E+  LIPF +   V  V+ +  +I++D
Sbjct: 123 SHLFSNGANDVIVIHGERER--LIPFVQPDYVKSVDFEAERIVVD 165


>gi|296394373|ref|YP_003659257.1| 16S rRNA processing protein RimM [Segniliparus rotundus DSM 44985]
 gi|296181520|gb|ADG98426.1| 16S rRNA processing protein RimM [Segniliparus rotundus DSM 44985]
          Length = 171

 Score = 58.5 bits (140), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 71/164 (43%), Gaps = 10/164 (6%)

Query: 9   LMATIGTTHGLNGEVYIDSYANNP--------IDLNRYVLYSNDNRELRILKMYRKNKRF 60
           ++  I  +HGL GEV ++   ++P          L R       ++ L +L         
Sbjct: 1   MVGRIAKSHGLTGEVAVEIRTDDPERRFAPGSTLLLRMPKAKQADKALHVLSAREHASHL 60

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGK-YWGQV 119
           + TF+ + +  +A  LR   L  + +D    E + DEF++ +L  +   DR G    G+V
Sbjct: 61  LVTFAEVMDRAAADSLRGALLVVRTEDLPPSE-DPDEFYDHELVGLRIVDRAGGGELGEV 119

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
             V +   G  L  +    +  L+PF    V+EV+L E    ++
Sbjct: 120 ADVVHSAGGDWLVARVEGGREVLVPFVAAIVVEVSLAEKTAWVE 163


>gi|256824951|ref|YP_003148911.1| 16S rRNA processing protein RimM [Kytococcus sedentarius DSM 20547]
 gi|256688344|gb|ACV06146.1| 16S rRNA processing protein RimM [Kytococcus sedentarius DSM 20547]
          Length = 182

 Score = 58.5 bits (140), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 43/162 (26%), Positives = 71/162 (43%), Gaps = 8/162 (4%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNP-IDLNRYVLYSNDNRELRILKMYRKNKRFIAT 63
           + +V +A IG  H L GEV +  + + P + L           E   L +  +      T
Sbjct: 14  EGMVRLARIGKPHALKGEVTVQLHTDEPEVRLAVGTAVQTVPAEEGPLTIASRRVHQGVT 73

Query: 64  FSGIDNI---HSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
             G + +     A  LR + L A      DEEL+ + F+  DL  +E  D QG+  G V 
Sbjct: 74  LLGFEQVTGRDGAEALRGVVLVAP----ADEELDGEGFYPEDLRGLEVVDGQGEPLGAVK 129

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
            ++   A  +LE+  T     L+PF +  V  V+L+  ++ +
Sbjct: 130 DLHLRPAQDLLEVTTTAGHDVLVPFVEELVPHVDLEAGQVTV 171


>gi|227833408|ref|YP_002835115.1| 16S rRNA processing protein [Corynebacterium aurimucosum ATCC
           700975]
 gi|262184396|ref|ZP_06043817.1| 16S rRNA-processing protein RimM [Corynebacterium aurimucosum ATCC
           700975]
 gi|227454424|gb|ACP33177.1| 16S rRNA processing protein [Corynebacterium aurimucosum ATCC
           700975]
          Length = 166

 Score = 58.5 bits (140), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 46/165 (27%), Positives = 79/165 (47%), Gaps = 16/165 (9%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNR---ELRILKMYRKNKRF 60
           +L+  +  +HG+ GEV ++   ++P    R+    VL+    +   EL I  +     R 
Sbjct: 3   LLIGRVVKSHGIKGEVSVEVTTDSP--ETRFAVGEVLHGTQGKKEHELTIAAVRAHKGRL 60

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETF-DRQGKYWGQV 119
           + TF  I +  +A  LR  + +A+  D    + E+D F++ +LE +    DR  K  G+V
Sbjct: 61  LITFKEIPDRTAADSLRGTQFFAEPLD----DPEDDGFYDHELEGLRVLLDR--KEVGEV 114

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
            GV +    S+LE+     K  L+PF +  V E++L      I P
Sbjct: 115 TGVTHGPTQSLLEVTLAEGKEALVPFVEEIVPEIDLDAGTCTITP 159


>gi|149928268|ref|ZP_01916511.1| 16S rRNA-processing protein [Limnobacter sp. MED105]
 gi|149822997|gb|EDM82239.1| 16S rRNA-processing protein [Limnobacter sp. MED105]
          Length = 188

 Score = 58.5 bits (140), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 55/116 (47%), Gaps = 2/116 (1%)

Query: 48  LRILKMYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEME 107
            R+L+    + R +A   GI+    A++ +  ++Y  R  F      E E++  DL    
Sbjct: 70  FRVLQSKPHSSRIVAHLEGIEQPELAAQFKGRRVYVSRARFPAP--AEGEYYWVDLVGCR 127

Query: 108 TFDRQGKYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
             + +G+  G V  V + GA  IL +K+  E+  LIPF    V+ V+ Q  +I  D
Sbjct: 128 VTNLEGRVLGTVTQVVDHGAHPILSVKSDAEQEMLIPFVAAYVVNVDTQAKQIQAD 183


>gi|110803164|ref|YP_698997.1| 16S rRNA-processing protein RimM [Clostridium perfringens SM101]
 gi|122956637|sp|Q0SSB0|RIMM_CLOPS RecName: Full=Ribosome maturation factor rimM
 gi|110683665|gb|ABG87035.1| 16S rRNA processing protein RimM [Clostridium perfringens SM101]
          Length = 165

 Score = 58.5 bits (140), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 45/163 (27%), Positives = 80/163 (49%), Gaps = 8/163 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANN--PIDLNRYVLYSNDNRELRILKMYRKNKRFI 61
           ++ L+++  I  THGL GE+ +     +    D   YV+      ++  +K ++   + I
Sbjct: 1   MEDLLVVGQIINTHGLRGEMKVMPLTEDMRRFDYLEYVILKGQKIKVEGVKYFKD--KVI 58

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               GI++I  A +L+   L  +R+D    ELEEDE+F  DL      D +G  +G++  
Sbjct: 59  LKLQGINSIEEAEKLKRTYLEIEREDAI--ELEEDEYFIVDLVGCTVVDTEGFEYGKIKD 116

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           V    +  +  ++   +K  L+P  K  VL++N+ E  I I P
Sbjct: 117 VIQTPSNDVYWVQG--KKEVLVPVLKDIVLDINMDEKLITIRP 157


>gi|169630308|ref|YP_001703957.1| 16S rRNA-processing protein RimM [Mycobacterium abscessus ATCC
           19977]
 gi|238688780|sp|B1MDI4|RIMM_MYCA9 RecName: Full=Ribosome maturation factor rimM
 gi|169242275|emb|CAM63303.1| Probable 16S rRNA processing protein RimM [Mycobacterium abscessus]
          Length = 173

 Score = 58.5 bits (140), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 36/164 (21%), Positives = 70/164 (42%), Gaps = 8/164 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPID-------LNRYVLYSNDNRELRILKMYRKNKRF 60
           +++  I   HG+ GE+ ++   ++P +       L   +     +R   +  +   + R 
Sbjct: 3   LVVGRIARAHGVTGELSVEVRTDDPDERFAVGSVLTGRLPRGGGSRRFTVESVREHSGRL 62

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +  F+G+ +  +A  LR         D    E + DEF++  LE +      G   G V 
Sbjct: 63  LIRFAGVSDRDAADALRGTLFMVDTTDLPPIE-DPDEFYDHQLEGLAVRTLDGAAVGTVS 121

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
            V +   G +L ++ +  +  L+PF    V  ++L +  I IDP
Sbjct: 122 EVLHTPGGELLSVRGSERREILVPFVSAIVTSISLADKVIEIDP 165


>gi|154509170|ref|ZP_02044812.1| hypothetical protein ACTODO_01691 [Actinomyces odontolyticus ATCC
           17982]
 gi|153798804|gb|EDN81224.1| hypothetical protein ACTODO_01691 [Actinomyces odontolyticus ATCC
           17982]
          Length = 170

 Score = 58.5 bits (140), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 68/155 (43%), Gaps = 9/155 (5%)

Query: 11  ATIGTTHGLNGEVYIDSYANNP--IDLNRYVLYSNDNRELRILKMYRKNKRFIATFSGID 68
           A +G  HGL GEV +D  +++P  +     +  + D R L +  +     R +A+F    
Sbjct: 6   AIVGPAHGLRGEVIVDVRSDDPEVMAPGSRLDIAGDQRSLTVRTVRVHKDRVLASFEECV 65

Query: 69  NIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFGAG 128
               A  LR  +L        D   EED ++  +L+ ++     G   G V G+   GA 
Sbjct: 66  TREDAEALRGARL------LVDAHPEEDAWYPHELKGLQARTPSGDVLGSVSGLTP-GAA 118

Query: 129 SILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
             L +  T   T L+PF    V  V+++   ++ID
Sbjct: 119 QDLLLVATDRGTVLVPFVTALVPTVDVEGGFVVID 153


>gi|224282417|ref|ZP_03645739.1| 16S rRNA-processing protein rimM [Bifidobacterium bifidum NCIMB
           41171]
          Length = 186

 Score = 58.5 bits (140), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 52/181 (28%), Positives = 87/181 (48%), Gaps = 26/181 (14%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNRELRILKMYRKNK-RFI 61
           ++ +  IG   GL GEV +  + + P    R+    VLY+ D  +  +++  R  K R+I
Sbjct: 1   MLRVCRIGRAQGLKGEVTVQIFTDEP--EYRFAPDSVLYTRDGSQEYVVEYARTFKNRWI 58

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG---- 117
             F GID+  ++     ++LY +  D +D  LEED ++  DL  +E    +G   G    
Sbjct: 59  VKFEGIDDRDASEAANGIELYGEADDPEDM-LEEDAWYPKDLVGLEARLAEGNGLGLPAG 117

Query: 118 QVCG-VYNF--GAGSILEIK-----------NTMEKTFLIPFTKFAVLEVNLQENKILID 163
           QV G V +    A ++L+I+              E T L+PF    V +++L+E  + ID
Sbjct: 118 QVIGKVVDVLDSAQTLLKIRLVSPVRDTVTGEVTESTALVPFVDELVPDIDLEEGYLTID 177

Query: 164 P 164
           P
Sbjct: 178 P 178


>gi|18310692|ref|NP_562626.1| 16S rRNA-processing protein [Clostridium perfringens str. 13]
 gi|110800602|ref|YP_696397.1| 16S rRNA-processing protein RimM [Clostridium perfringens ATCC
           13124]
 gi|168207939|ref|ZP_02633944.1| 16S rRNA processing protein RimM [Clostridium perfringens E str.
           JGS1987]
 gi|168210657|ref|ZP_02636282.1| 16S rRNA processing protein RimM [Clostridium perfringens B str.
           ATCC 3626]
 gi|168216997|ref|ZP_02642622.1| 16S rRNA processing protein RimM [Clostridium perfringens NCTC
           8239]
 gi|182625872|ref|ZP_02953638.1| 16S rRNA processing protein RimM [Clostridium perfringens D str.
           JGS1721]
 gi|21362851|sp|Q8XJP6|RIMM_CLOPE RecName: Full=Ribosome maturation factor rimM
 gi|122958814|sp|Q0TPP3|RIMM_CLOP1 RecName: Full=Ribosome maturation factor rimM
 gi|18145373|dbj|BAB81416.1| probable 16S rRNA processing protein [Clostridium perfringens str.
           13]
 gi|110675249|gb|ABG84236.1| 16S rRNA processing protein RimM [Clostridium perfringens ATCC
           13124]
 gi|170660750|gb|EDT13433.1| 16S rRNA processing protein RimM [Clostridium perfringens E str.
           JGS1987]
 gi|170711249|gb|EDT23431.1| 16S rRNA processing protein RimM [Clostridium perfringens B str.
           ATCC 3626]
 gi|177908906|gb|EDT71398.1| 16S rRNA processing protein RimM [Clostridium perfringens D str.
           JGS1721]
 gi|182380889|gb|EDT78368.1| 16S rRNA processing protein RimM [Clostridium perfringens NCTC
           8239]
          Length = 165

 Score = 58.5 bits (140), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 45/163 (27%), Positives = 80/163 (49%), Gaps = 8/163 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANN--PIDLNRYVLYSNDNRELRILKMYRKNKRFI 61
           ++ L+++  I  THGL GE+ +     +    D   YV+      ++  +K ++   + I
Sbjct: 1   MEDLLVVGQIINTHGLRGEMKVMPLTEDMRRFDYLEYVILKGKKVKVEGVKYFKD--KVI 58

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               GI++I  A +L+   L  +R+D    ELEEDE+F  DL      D +G  +G++  
Sbjct: 59  LKLEGINSIEEAEKLKRTYLEIEREDAI--ELEEDEYFIVDLVGCTVVDTEGFEYGKIKD 116

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           V    +  +  ++   +K  L+P  K  VL++N+ E  I I P
Sbjct: 117 VIQTPSNDVYWVQG--KKEVLVPVLKDIVLDINMDEKLITIRP 157


>gi|242277677|ref|YP_002989806.1| 16S rRNA processing protein RimM [Desulfovibrio salexigens DSM
           2638]
 gi|242120571|gb|ACS78267.1| 16S rRNA processing protein RimM [Desulfovibrio salexigens DSM
           2638]
          Length = 185

 Score = 58.5 bits (140), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 76/164 (46%), Gaps = 7/164 (4%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNR----YVLYSNDNRELRILKMYRKNK-RF 60
           +++++A +   HGL GEV I+S+A++P   +     Y+          +++  RK+K R 
Sbjct: 2   EMLVVAEVVKPHGLRGEVCIESHADSPFLFDEVPCLYLAKKGQKPRRFVVRSSRKHKGRV 61

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           + TF G+++   A  LR +++  +  D    E  +DE +  +LE M      G   G + 
Sbjct: 62  LLTFKGVEDRDQAENLRGMEILVREADLP--ESGDDEVYMYELEGMSVELEDGTVVGTIS 119

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
                       I +   K  L P  +  VL V+L   K++++P
Sbjct: 120 NFILAPGQETWVISSAEGKEILFPAVEEFVLSVDLDAEKVVVEP 163


>gi|115351000|ref|YP_772839.1| 16S rRNA-processing protein RimM [Burkholderia ambifaria AMMD]
 gi|115280988|gb|ABI86505.1| 16S rRNA processing protein RimM [Burkholderia ambifaria AMMD]
          Length = 237

 Score = 58.5 bits (140), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 78/174 (44%), Gaps = 17/174 (9%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNP------IDLNRYVLYSNDNR-ELRILKMYRKN 57
           D  V +  +   +GL G + + ++A+        +D  R+ L     R   RIL+     
Sbjct: 60  DDAVEVGAVVDAYGLKGWIKVATHADAGRGGDALLDARRWWLERGGERLSARILQSKTHG 119

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              +A  +G+ +  +A  LR  +++ +R+DF    L  DEF+  DL  +E  + Q    G
Sbjct: 120 DTVVAHAAGVSDRDAALALRGFRVFVRREDFP--ALAADEFYWVDLIGLEVVNEQSVALG 177

Query: 118 QVCGVYNFGAGSILEI------KNTMEKT--FLIPFTKFAVLEVNLQENKILID 163
            V G+ + G  SI+ +      K+    T   LIPF    V  V+    +I++D
Sbjct: 178 TVSGMIDNGVHSIMRVEYPAVGKDGQPTTDERLIPFVGVYVKTVDQAARRIVVD 231


>gi|289550971|ref|YP_003471875.1| 16S rRNA processing protein RimM [Staphylococcus lugdunensis
           HKU09-01]
 gi|289180503|gb|ADC87748.1| 16S rRNA processing protein RimM [Staphylococcus lugdunensis
           HKU09-01]
          Length = 166

 Score = 58.5 bits (140), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 49/170 (28%), Positives = 87/170 (51%), Gaps = 13/170 (7%)

Query: 8   VLMATIGTTHGLNGEVYIDSYAN------NPIDLNRYVLYSNDNRELRILKMYRKNKRF- 60
           V +  I  THG+ GEV + S+++       P ++   + ++NDN EL +   YR +K F 
Sbjct: 3   VEVGQIVNTHGIKGEVKVKSHSDFTDTRFQPGEV-LTLKHNNDNVELTVTS-YRIHKGFH 60

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +  F G DNI+     +   LY +R D +  EL E EF+ +D+     F+ +    G+V 
Sbjct: 61  MLKFEGFDNINDVESYKGDYLYQER-DHEGIELAEHEFYYSDIIGCTVFNGEIPI-GRVT 118

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
            +   GA  +  +K   +K ++IP+    V +V+++   I+I P+   L+
Sbjct: 119 NIIETGANDVWVVKG--DKEYMIPYIADVVKDVDIENKTIMITPLEGLLD 166


>gi|254252904|ref|ZP_04946222.1| RIMM_BURS3 Probable 16S rRNA-processing protein rimM [Burkholderia
           dolosa AUO158]
 gi|124895513|gb|EAY69393.1| RIMM_BURS3 Probable 16S rRNA-processing protein rimM [Burkholderia
           dolosa AUO158]
          Length = 226

 Score = 58.5 bits (140), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 82/176 (46%), Gaps = 21/176 (11%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNP------IDLNRYVLYSNDNR-ELRILKMYRKN 57
           D  V +  +   +GL G + + ++A+        ++  R+ L     R   R+++     
Sbjct: 50  DDAVEVGAVVDAYGLKGWIKVAAHADAGRGGDALLNARRWWLERGAERLSARLVQSKTHG 109

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              +A  +G+ +  +A  LR  +++ +R+DF    L  DEF+  DL  ++  ++Q    G
Sbjct: 110 DTVVAQPAGVSDRDAALALRGFRVFVRREDFP--ALAADEFYWVDLIGLDVVNQQSVALG 167

Query: 118 QVCGVYNFGAGSILEIK----------NTMEKTFLIPFTKFAVLEVNLQENKILID 163
           QV G+ + GA SI+ ++           T E+  LIPF    V  V+    +I++D
Sbjct: 168 QVIGMIDNGAHSIMRVEYPAIGKDGRPGTAER--LIPFVGVYVKTVDRAARRIVVD 221


>gi|169342654|ref|ZP_02863696.1| 16S rRNA processing protein RimM [Clostridium perfringens C str.
           JGS1495]
 gi|169299160|gb|EDS81230.1| 16S rRNA processing protein RimM [Clostridium perfringens C str.
           JGS1495]
          Length = 165

 Score = 58.5 bits (140), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 45/163 (27%), Positives = 80/163 (49%), Gaps = 8/163 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANN--PIDLNRYVLYSNDNRELRILKMYRKNKRFI 61
           ++ L+++  I  THGL GE+ +     +    D   YV+      ++  +K ++   + I
Sbjct: 1   MEDLLVVGQIINTHGLRGEMKVMPLTEDMRRFDYLEYVILKGKKIKVEGVKYFKD--KVI 58

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               GI++I  A +L+   L  +R+D    ELEEDE+F  DL      D +G  +G++  
Sbjct: 59  LKLQGINSIEEAEKLKRTYLEIEREDAI--ELEEDEYFIVDLVGCTVVDTEGFEYGKIKD 116

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           V    +  +  ++   +K  L+P  K  VL++N+ E  I I P
Sbjct: 117 VIQTPSNDVYWVQG--KKEVLVPVLKDIVLDINMDEKLITIRP 157


>gi|328885335|emb|CCA58574.1| 16S rRNA processing protein RimM [Streptomyces venezuelae ATCC
           10712]
          Length = 183

 Score = 58.2 bits (139), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 39/161 (24%), Positives = 79/161 (49%), Gaps = 5/161 (3%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNP-IDLNRYVLYSNDNRE---LRILKMYRKNKRFIAT 63
           +++A IG  HG+ GEV ++   + P + L    +   D      L I      + R +  
Sbjct: 1   MVVARIGRAHGIKGEVTVEVRTDEPELRLGPGAVLLTDPASAGPLTIETGRVHSGRLLLR 60

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F G+ + ++A  LR++ L A+    +  E EEDE+++  L +++     G   G++  + 
Sbjct: 61  FEGVRDRNAAEALRNILLIAEVDPTELPE-EEDEYYDHQLMDLDVVLADGTEIGRITEIS 119

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           +  +  +  ++       +IPF +  V E++L+E + +IDP
Sbjct: 120 HLPSQDLFIVERPDGTELMIPFVESIVTEIDLEEQRAVIDP 160


>gi|209573747|sp|Q0BH68|RIMM_BURCM RecName: Full=Ribosome maturation factor rimM
          Length = 226

 Score = 58.2 bits (139), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 78/174 (44%), Gaps = 17/174 (9%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNP------IDLNRYVLYSNDNR-ELRILKMYRKN 57
           D  V +  +   +GL G + + ++A+        +D  R+ L     R   RIL+     
Sbjct: 49  DDAVEVGAVVDAYGLKGWIKVATHADAGRGGDALLDARRWWLERGGERLSARILQSKTHG 108

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              +A  +G+ +  +A  LR  +++ +R+DF    L  DEF+  DL  +E  + Q    G
Sbjct: 109 DTVVAHAAGVSDRDAALALRGFRVFVRREDFP--ALAADEFYWVDLIGLEVVNEQSVALG 166

Query: 118 QVCGVYNFGAGSILEI------KNTMEKT--FLIPFTKFAVLEVNLQENKILID 163
            V G+ + G  SI+ +      K+    T   LIPF    V  V+    +I++D
Sbjct: 167 TVSGMIDNGVHSIMRVEYPAVGKDGQPTTDERLIPFVGVYVKTVDQAARRIVVD 220


>gi|303327977|ref|ZP_07358416.1| 16S rRNA processing protein RimM [Desulfovibrio sp. 3_1_syn3]
 gi|302861803|gb|EFL84738.1| 16S rRNA processing protein RimM [Desulfovibrio sp. 3_1_syn3]
          Length = 171

 Score = 58.2 bits (139), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 71/161 (44%), Gaps = 5/161 (3%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRYV-LYSNDN--RELRILKMYRKNKRFIAT 63
           ++ M T+   HG+ GE+ ID +A++P+ L+  + L + D   R +R L   R   R +  
Sbjct: 1   MIHMGTLARPHGIKGEICIDWHADSPLLLDAPLWLQAGDEPPRLVRALSCRRHKGRPLLL 60

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
             G+ +  +A  LR  K+   R        +EDE +  DL   E F   G+  G++  V 
Sbjct: 61  LEGVTDRTAAEALRGQKILVSRDSLPPP--DEDEAYLEDLLGCEVFLPDGRRLGRLDHVE 118

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
                 I  I    ++  L P     ++  +L    + IDP
Sbjct: 119 YPADQEIWVIVTEQDQEILFPAQPCFIVGFDLDARTVTIDP 159


>gi|170700971|ref|ZP_02891953.1| 16S rRNA processing protein RimM [Burkholderia ambifaria IOP40-10]
 gi|170134111|gb|EDT02457.1| 16S rRNA processing protein RimM [Burkholderia ambifaria IOP40-10]
          Length = 225

 Score = 58.2 bits (139), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 78/174 (44%), Gaps = 17/174 (9%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNP------IDLNRYVLYSNDNR-ELRILKMYRKN 57
           D  V +  +   +GL G + + ++A+        +D  R+ L     R   RIL+     
Sbjct: 49  DDAVEVGAVVDAYGLKGWIKVATHADAGRGGDALLDARRWWLERGGERLSARILQSKTHG 108

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              +A  +G+ +  +A  LR  +++ +R+DF    L  DEF+  DL  +E  + Q    G
Sbjct: 109 DTVVAHAAGVSDRDAALALRGFRVFVRREDFP--ALAADEFYWVDLIGLEVVNEQSVALG 166

Query: 118 QVCGVYNFGAGSILEI------KNTMEKT--FLIPFTKFAVLEVNLQENKILID 163
            V G+ + G  SI+ +      K+    T   LIPF    V  V+    +I++D
Sbjct: 167 TVSGMIDNGVHSIMRVEYPAVGKDGQPTTDERLIPFVGVYVKTVDQAARRIVVD 220


>gi|146308419|ref|YP_001188884.1| 16S rRNA-processing protein [Pseudomonas mendocina ymp]
 gi|166226467|sp|A4XXT6|RIMM_PSEMY RecName: Full=Ribosome maturation factor rimM
 gi|145576620|gb|ABP86152.1| 16S rRNA processing protein RimM [Pseudomonas mendocina ymp]
          Length = 178

 Score = 58.2 bits (139), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 81/165 (49%), Gaps = 10/165 (6%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYAN---NPIDLNRYVLYSN-DNRELRILKMYRKNKRFIA 62
           L+++  I + HG+ GEV + S+ +   N +D   + L  + + +++ +     + K  +A
Sbjct: 11  LIVLGKIVSVHGVRGEVKVYSFTDPIDNVLDYRHWTLRRDGEVKKVELASGRLQGKVLVA 70

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
              G+D+   A      ++   R +  D  LEE EF+   L+ ++  D+ G+  G V  +
Sbjct: 71  KLKGLDDREIARTYAGFEICVPRSELPD--LEEGEFYWYQLQGLKVIDQAGQLLGVVDHL 128

Query: 123 YNFGAGSILEIKNTM----EKTFLIPFTKFAVLEVNLQENKILID 163
           +  GA  ++ +K       ++  L+P+T   VL ++L   ++ +D
Sbjct: 129 FETGANDVMVVKACAGSLDDRERLLPYTDQCVLSIDLAAGEMRVD 173


>gi|228475074|ref|ZP_04059802.1| 16S rRNA processing protein RimM [Staphylococcus hominis SK119]
 gi|228271059|gb|EEK12447.1| 16S rRNA processing protein RimM [Staphylococcus hominis SK119]
          Length = 166

 Score = 58.2 bits (139), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 45/167 (26%), Positives = 85/167 (50%), Gaps = 9/167 (5%)

Query: 8   VLMATIGTTHGLNGEVYIDS---YANNPIDLNRYVLYSNDNRELRI-LKMYRKNKRF-IA 62
           V +  I  THG+ GE+ + S   + +        ++ ++ + E+ + +  YR +K F + 
Sbjct: 3   VEVGQIVNTHGIKGEIKVKSNSDFTDTRFQPGEVLIVNHHHNEIEMTITSYRIHKGFHML 62

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F GI+NI+   + +   L+ +R D +D EL E+EF+ +D+     F+      G+V  +
Sbjct: 63  KFEGINNINDIEQYKGDYLFQER-DHEDIELNENEFYYSDIIGCTVFNNDTPI-GRVINI 120

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           +  GA  +  +K   +K +LIP+    V EV+++   I I P+   L
Sbjct: 121 FETGANDVWVVKG--DKEYLIPYIADVVKEVDVEHKTICITPMEGLL 165


>gi|291527946|emb|CBK93532.1| 16S rRNA processing protein RimM [Eubacterium rectale M104/1]
          Length = 168

 Score = 58.2 bits (139), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 81/170 (47%), Gaps = 7/170 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY--VLYSN--DNRELRILKMYRKNKR 59
           ++ L+ +  I +THG+ GEV +    ++     +   V+  N  + R+L I  +     +
Sbjct: 1   MEDLLQVGVITSTHGIRGEVKVFPTTDDAARFKKLKNVILDNGKERRDLEITSVKFFKNQ 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F GID+I+   + +   L+  R++     LEE+E+F  DL  +     +G+  G +
Sbjct: 61  VILKFKGIDDINDVEKYKKAPLFVTRENAV--PLEENEYFIADLIGLSVTSDEGEELGVI 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
             V   GA  +  +K       LIP  K  +L+V++ EN  +   + AGL
Sbjct: 119 ADVLQTGANDVYVVKKAGANDLLIPAIKDCILDVDV-ENGTMKVHLLAGL 167


>gi|171321194|ref|ZP_02910165.1| 16S rRNA processing protein RimM [Burkholderia ambifaria MEX-5]
 gi|171093532|gb|EDT38700.1| 16S rRNA processing protein RimM [Burkholderia ambifaria MEX-5]
          Length = 225

 Score = 58.2 bits (139), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 78/174 (44%), Gaps = 17/174 (9%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNP------IDLNRYVLYSNDNR-ELRILKMYRKN 57
           D  V +  +   +GL G + + ++A+        +D  R+ L     R   RIL+     
Sbjct: 49  DDAVEVGAVVDAYGLKGWIKVATHADAGRGGDALLDARRWWLERGGERLSARILQSKTHG 108

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              +A  +G+ +  +A  LR  +++ +R+DF    L  DEF+  DL  +E  + Q    G
Sbjct: 109 DTVVAHAAGVSDRDAALALRGFRVFVRREDFP--ALAADEFYWVDLIGLEVVNEQSVALG 166

Query: 118 QVCGVYNFGAGSILEI------KNTMEKT--FLIPFTKFAVLEVNLQENKILID 163
            V G+ + G  SI+ +      K+    T   LIPF    V  V+    +I++D
Sbjct: 167 TVSGMIDNGVHSIMRVEYPAVGKDGQPTTDERLIPFVGVYVKTVDQAARRIVVD 220


>gi|290893076|ref|ZP_06556065.1| 16S rRNA processing protein RimM [Listeria monocytogenes FSL
           J2-071]
 gi|290557436|gb|EFD90961.1| 16S rRNA processing protein RimM [Listeria monocytogenes FSL
           J2-071]
 gi|307571375|emb|CAR84554.1| 16S rRNA processing protein [Listeria monocytogenes L99]
          Length = 169

 Score = 58.2 bits (139), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 79/168 (47%), Gaps = 9/168 (5%)

Query: 10  MATIGTTHGLNGEVYIDSYANNP-----IDLNRYVLYSNDNR-ELRILKMYRKNKRF-IA 62
           +  I  THGL GE+ + +  + P     +    Y+   N  + E  I++ +RK+K F + 
Sbjct: 4   VGKIVNTHGLIGEIRVIATTDFPEERFQVGNTVYLFEKNSKKPEKLIIRSHRKHKNFDLL 63

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F G   IH    +++  L  K     D  LEE+EF+  ++         G+  G++  +
Sbjct: 64  MFEGFTGIHQVERMKEGVLKIKEAQLTD--LEENEFYFHEIIGCTVVTTDGEELGEITEI 121

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
              GA  +  +K + +K  LIP+    V E+N+ + KI I+ +   L+
Sbjct: 122 LTPGANDVWVVKGSDKKEKLIPYIADVVKEININDKKITIEVMEGLLD 169


>gi|308048459|ref|YP_003912025.1| 16S rRNA processing protein RimM [Ferrimonas balearica DSM 9799]
 gi|307630649|gb|ADN74951.1| 16S rRNA processing protein RimM [Ferrimonas balearica DSM 9799]
          Length = 175

 Score = 58.2 bits (139), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 84/168 (50%), Gaps = 12/168 (7%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNRELRILKMYRKNKRFI 61
           +L+++  +G+ +G+ G + ++++ ++   +  Y    VL+  + +E+++    R N   I
Sbjct: 5   ELIVVGRLGSAYGIRGWLKVNAFTDSLEGIFEYSPWLVLHQGEWQEMKVADWRRHNNGII 64

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
              +G+++ + A +  +  +         E L EDEF+  DL      + QG   G+V G
Sbjct: 65  CRLAGVEDRNQAEQYINCDVAILPAQL--EALPEDEFYWRDLVGCTVVNTQGYDMGKVTG 122

Query: 122 VYNFGAGSILEIKNTMEKTF-----LIPF-TKFAVLEVNLQENKILID 163
           +   G+  +LE++      F     LIPF T+  +LEV+    KI++D
Sbjct: 123 LLETGSNDVLEVEAKSNDAFGKRERLIPFVTEQFILEVDTLGKKIVVD 170


>gi|319786604|ref|YP_004146079.1| 16S rRNA processing protein RimM [Pseudoxanthomonas suwonensis
           11-1]
 gi|317465116|gb|ADV26848.1| 16S rRNA processing protein RimM [Pseudoxanthomonas suwonensis
           11-1]
          Length = 190

 Score = 58.2 bits (139), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 74/164 (45%), Gaps = 10/164 (6%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY-----SNDNRELRILKMYRKNKRF 60
           K++L+  +    G+ G+V ++S+      + RY  +     +   RELR  K     K  
Sbjct: 26  KMILLGRVTGAFGVRGDVKVESWTEPRAQIFRYQPWILRAPNGAERELRGAKGRDTGKHV 85

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +AT  G D+  +A  LR  +++  R           E++  DLE ++    +G   G+V 
Sbjct: 86  VATLPGCDDRDAAEALRGTEIWVPRDVLPPP--APGEYYWVDLEGLKVVTVEGVALGEVS 143

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFA-VLEVNLQENKILID 163
            + + GA  +L ++   E+  +IPF +   V  V+     I +D
Sbjct: 144 HLLSTGANDVLVVRGERER--MIPFVQPDYVTSVDFDTATITVD 185


>gi|315282787|ref|ZP_07871115.1| 16S rRNA processing protein RimM [Listeria marthii FSL S4-120]
 gi|313613566|gb|EFR87382.1| 16S rRNA processing protein RimM [Listeria marthii FSL S4-120]
          Length = 172

 Score = 58.2 bits (139), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 81/174 (46%), Gaps = 9/174 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNP-----IDLNRYVLYSNDNR-ELRILKMYRKN 57
           ++K+  +  I  THGL GE+ + +  + P     +    Y+   N  + E  I++ +RK+
Sbjct: 1   MEKMYNVGKIVNTHGLIGEIRVIATTDFPEERFQVGNTVYLFEKNSKKPEKLIIRSHRKH 60

Query: 58  KRF-IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           K F +  F G   IH    +++  L  K     D  LEE+EF+  ++         G+  
Sbjct: 61  KNFDLLMFEGFTGIHQVERMKEGVLKIKEAQLTD--LEENEFYFHEIIGCTVVTTDGEEL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           G++  +   GA  +  +K   +K  LIP+    V E+N  + KI I+ +   L+
Sbjct: 119 GEITEILTPGANDVWVVKGADKKEKLIPYIADVVKEINTNDKKITIEVMEGLLD 172


>gi|107022148|ref|YP_620475.1| 16S rRNA-processing protein RimM [Burkholderia cenocepacia AU 1054]
 gi|122979075|sp|Q1BY03|RIMM_BURCA RecName: Full=Ribosome maturation factor rimM
 gi|105892337|gb|ABF75502.1| 16S rRNA processing protein RimM [Burkholderia cenocepacia AU 1054]
          Length = 225

 Score = 58.2 bits (139), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 82/174 (47%), Gaps = 17/174 (9%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNP------IDLNRYVLYSNDNR-ELRILKMYRKN 57
           D  V +  +   +GL G V + ++A+        ++  R+ L     R  +RI++   ++
Sbjct: 49  DDAVEVGAVVDAYGLKGWVKVATHADAGRGGDALLNARRWWLERGAERLSVRIMQSKTRS 108

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              +A  +G+ +  +A  +R  +++ +R+DF    L  DEF+  DL  +E  + Q    G
Sbjct: 109 DTVVAQPAGVSDRDAALSMRGFRVFVRREDFP--ALAADEFYWVDLIGLEVVNEQSVALG 166

Query: 118 QVCGVYNFGAGSILEI------KNTMEKT--FLIPFTKFAVLEVNLQENKILID 163
           +V G+ + G  SI+ +      K+    T   LIPF    V  V+    +I++D
Sbjct: 167 KVSGMIDNGVHSIMRVEYPATGKDGQPTTDERLIPFVGVYVKTVDQAARRIVVD 220


>gi|209573745|sp|Q1GYT7|RIMM_METFK RecName: Full=Ribosome maturation factor rimM
          Length = 173

 Score = 57.8 bits (138), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 80/172 (46%), Gaps = 13/172 (7%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDS---YANNPIDLNRYVLYSNDNRE------LRIL 51
           M  + +LV+M  I   +G+ G V +     Y ++  D  R++L   D ++        + 
Sbjct: 1   MQIVSELVIMGRIVAPYGVYGWVKVQPATEYVDSLFDYGRWMLGRGDPKQPEQWQSCEVE 60

Query: 52  KMYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDR 111
           K    N   +    GID+   A   + + +   R +    E EE E++ +DL  ++  ++
Sbjct: 61  KAKVHNDLLLVKLQGIDDRDQAFSCKGMYVAVYRDELP--EPEEGEYYWSDLIGLQVRNQ 118

Query: 112 QGKYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
           Q   +GQV  V+  GA  +L +K   E+  L+PF    VLEV+     +L+D
Sbjct: 119 QEVDFGQVVDVFATGANDVLVVKGDRER--LVPFIGQVVLEVDTDGKTMLVD 168


>gi|167758977|ref|ZP_02431104.1| hypothetical protein CLOSCI_01323 [Clostridium scindens ATCC 35704]
 gi|167663384|gb|EDS07514.1| hypothetical protein CLOSCI_01323 [Clostridium scindens ATCC 35704]
          Length = 168

 Score = 57.8 bits (138), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 48/173 (27%), Positives = 85/173 (49%), Gaps = 13/173 (7%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-----VLYSNDNRELRI-LKMYRKN 57
           +++L+ +  I +THG+ GEV +    +   D  R+     V+       L + ++  +  
Sbjct: 1   MEELLQVGVITSTHGIRGEVKVFPTTD---DAKRFRELKDVMLDTGKETLSLEIEGVKFF 57

Query: 58  KRF-IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           K+F I  F GIDNI+     +   L+  R+D    ELEEDE+F  D+  M+    +G+ +
Sbjct: 58  KQFVILKFKGIDNINDVERYKRCPLFVNREDAV--ELEEDEYFIADMIGMKVITDEGEEF 115

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           G +  V   GA  +  I+       LIP  K  +L+V++   +++   + AGL
Sbjct: 116 GTLKDVMETGANDVYVIRRADGGEVLIPAIKECILDVDIP-GRLMKIHVMAGL 167


>gi|229818298|ref|ZP_04448579.1| hypothetical protein BIFANG_03598 [Bifidobacterium angulatum DSM
           20098]
 gi|229784168|gb|EEP20282.1| hypothetical protein BIFANG_03598 [Bifidobacterium angulatum DSM
           20098]
          Length = 204

 Score = 57.8 bits (138), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 52/186 (27%), Positives = 87/186 (46%), Gaps = 30/186 (16%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYV----LYSNDNRELRILKMYRKNK-RF 60
           +L+ +  IG   G+ GEV +  + + P    R+     L+S +  +  +++  R  K R+
Sbjct: 14  ELLRVCRIGRAQGMKGEVTVQVFTDEP--EWRFEPGSELFSRNGEQRYVVERSRTFKNRW 71

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDL--------EEMETFDRQ 112
           I    G D+ +++  L   +LY +  D +D  LE DE++  DL        EE E     
Sbjct: 72  IIKLEGCDDRNASEALNGTELYGEADDPEDM-LEADEWYPKDLIGLEARMDEENEIGAPA 130

Query: 113 GKYWGQVCGVYNFGAGSILEIKNT--------------MEKTFLIPFTKFAVLEVNLQEN 158
           GK  G V  V +  A S+L+I+ T              +EKT L+PF    V  ++L+E 
Sbjct: 131 GKPIGMVVDVIDSPAQSLLKIRLTEPVETGTASDGTPIVEKTTLVPFVDELVPLIDLEEG 190

Query: 159 KILIDP 164
            + +DP
Sbjct: 191 YLTLDP 196


>gi|210615862|ref|ZP_03290824.1| hypothetical protein CLONEX_03043 [Clostridium nexile DSM 1787]
 gi|210150065|gb|EEA81074.1| hypothetical protein CLONEX_03043 [Clostridium nexile DSM 1787]
          Length = 168

 Score = 57.8 bits (138), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 44/166 (26%), Positives = 87/166 (52%), Gaps = 12/166 (7%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-----VLYSNDNRELRI-LKMYRKN 57
           +++L+ +  I +THG+ GEV +    +   D+ R+     V+      +L + ++  +  
Sbjct: 1   MEQLLQVGVISSTHGVRGEVKVFPTTD---DVKRFKKLKKVILDTGKEQLPLEIEGVKFF 57

Query: 58  KRF-IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           K+F I  F GIDNI+   + +  +L   R+     +L++DE+F  D+  M+ F   G+ +
Sbjct: 58  KQFVILKFRGIDNINDIEKYKGKRLLVDRE--HAVKLKKDEYFIADMIGMDVFTEDGELF 115

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
           G +  V   GA  +  I+ +  K  L+P  K  +L+V+++  K++I
Sbjct: 116 GALKDVMETGANDVYIIEMSDGKEVLVPAIKQCILDVDIENRKMVI 161


>gi|29829184|ref|NP_823818.1| 16S rRNA-processing protein RimM [Streptomyces avermitilis MA-4680]
 gi|48474815|sp|Q82JW2|RIMM_STRAW RecName: Full=Ribosome maturation factor rimM
 gi|29606290|dbj|BAC70353.1| putative 16S rRNA processing protein [Streptomyces avermitilis
           MA-4680]
          Length = 186

 Score = 57.8 bits (138), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 38/162 (23%), Positives = 81/162 (50%), Gaps = 7/162 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNP-IDLNRYVLYSNDNRELRILKMYR---KNKRFIAT 63
           +++A IG  HG+ GEV ++   + P + L    + + D   +  L +      + R +  
Sbjct: 3   LVVARIGRAHGIKGEVTVEVRTDEPELRLGPGAVLATDPASVGPLTIETGRVHSGRLLLR 62

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEE-DEFFNTDLEEMETFDRQGKYWGQVCGV 122
           F G+ + + A  LR+  L A+     DE  E+ DE+++  L +++   + G   G++  +
Sbjct: 63  FEGVRDRNGAEALRNTLLIAEVD--PDEVPEDPDEYYDHQLMDLDVVTKDGTEVGRITEI 120

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
            +  +  +  ++ +      IPF +  V+E++L+E + +IDP
Sbjct: 121 SHLPSQDLFVVERSDGSEVYIPFVEEIVVEIDLEEQRAVIDP 162


>gi|88808142|ref|ZP_01123653.1| 16S rRNA-processing protein [Synechococcus sp. WH 7805]
 gi|88788181|gb|EAR19337.1| 16S rRNA-processing protein [Synechococcus sp. WH 7805]
          Length = 190

 Score = 57.8 bits (138), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 48/168 (28%), Positives = 77/168 (45%), Gaps = 11/168 (6%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLN----RYV-LYSNDNRELRILKMYRKNKR 59
           D  + +  +    GL GE+ ++  ++ P        R++    +  RE+ +    ++  +
Sbjct: 19  DHWLPVGKVVGAQGLRGELRVNPASDFPERFTQPGPRWLQTQGSPPREIELTSGRQQPGK 78

Query: 60  --FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMET-FDRQGKYW 116
             FI  F GIDN  SA  L    L  +  D    +LEE EF   DL  +E    R+ +  
Sbjct: 79  SLFIVRFKGIDNRSSAEALVGQTLLVRADDRP--QLEEGEFHLLDLVGLEARLSREAEAI 136

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           G V  + + G   +LEI     +  L+PF +  V EVNLQ+  IL+ P
Sbjct: 137 GTVTDLIS-GGNDLLEITRPDGRKLLVPFVEAIVPEVNLQDGWILLTP 183


>gi|229592397|ref|YP_002874516.1| 16S rRNA-processing protein RimM [Pseudomonas fluorescens SBW25]
 gi|259585649|sp|C3K1H0|RIMM_PSEFS RecName: Full=Ribosome maturation factor rimM
 gi|229364263|emb|CAY51980.1| 16S rRNA processing protein [Pseudomonas fluorescens SBW25]
          Length = 178

 Score = 57.8 bits (138), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 38/167 (22%), Positives = 85/167 (50%), Gaps = 10/167 (5%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRF 60
           D L+++  I + HG+ GEV + S+ +   +L +Y  ++       +++ ++     +K  
Sbjct: 9   DDLIVIGKIYSVHGVRGEVKVYSFTDPTENLLQYKTWTLKREGSVKQVELVSGRGSDKFL 68

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +A   G+D+   A  L   ++   R  F   EL + E++   LE ++  D+ G+ +G++ 
Sbjct: 69  VAKLKGLDDREEARLLAGYEICVPRNLFP--ELTDGEYYWYQLEGLKVIDQLGQLFGKID 126

Query: 121 GVYNFGAGSILEIKNTM----EKTFLIPFTKFAVLEVNLQENKILID 163
            +   GA  ++ +K       ++  L+P+TK  VL V+L+  ++ ++
Sbjct: 127 HLLETGANDVMVVKPCAGSLDDRERLLPYTKQCVLAVDLEAGEMKVE 173


>gi|47097598|ref|ZP_00235125.1| 16S rRNA processing protein RimM [Listeria monocytogenes str. 1/2a
           F6854]
 gi|258611625|ref|ZP_05234263.2| 16S rRNA processing protein RimM [Listeria monocytogenes FSL
           N3-165]
 gi|258612340|ref|ZP_05270099.2| 16S rRNA processing protein RimM [Listeria monocytogenes F6900]
 gi|47014029|gb|EAL05035.1| 16S rRNA processing protein RimM [Listeria monocytogenes str. 1/2a
           F6854]
 gi|258601991|gb|EEW15316.1| 16S rRNA processing protein RimM [Listeria monocytogenes FSL
           N3-165]
 gi|258611013|gb|EEW23621.1| 16S rRNA processing protein RimM [Listeria monocytogenes F6900]
          Length = 169

 Score = 57.8 bits (138), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 78/168 (46%), Gaps = 9/168 (5%)

Query: 10  MATIGTTHGLNGEVYIDSYANNP-----IDLNRYVLYSNDNR-ELRILKMYRKNKRF-IA 62
           +  I  THGL GE+ + +  + P     +    Y+   N  + E  I++ +RK+K F + 
Sbjct: 4   VGKIVNTHGLIGEIRVIATTDFPEERFQVGNTVYLFEKNSKKPEKLIIRSHRKHKNFDLL 63

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F G   IH    +++  L  K     D  LEE+EF+  ++         G+  G++  +
Sbjct: 64  MFEGFTGIHQVERMKEGVLKIKETQLTD--LEENEFYFHEIIGCTVVTTDGEELGEITEI 121

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
              GA  +  +K   +K  LIP+    V E+N+ + KI I+ +   L+
Sbjct: 122 LTPGANDVWVVKGADKKEKLIPYIADVVKEINIDDQKITIEVMEGLLD 169


>gi|296285087|ref|ZP_06863085.1| 16S rRNA processing protein [Citromicrobium bathyomarinum JL354]
          Length = 159

 Score = 57.8 bits (138), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 46/149 (30%), Positives = 68/149 (45%), Gaps = 10/149 (6%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKR-FIATFSGID 68
           MA +   HG+ GEV +  + ++   L  +  + ND  +L   K+   NK   IA F+ + 
Sbjct: 1   MAAVTGAHGVAGEVRLKLFGDDVDALKAHKTF-NDG-QLTASKIRSDNKGGAIARFAEVP 58

Query: 69  NIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFGAG 128
           +  +A  LR   L   R       LEE EF++ DL  +      G   G V  V N+GA 
Sbjct: 59  DRTAAEALRGTLLSVSRDALP--ALEEGEFYHADLIGLPVVTTDGAAVGHVIDVANYGAT 116

Query: 129 SILEIKNTM-----EKTFLIPFTKFAVLE 152
            I+EI +        KTF++P    AV E
Sbjct: 117 DIVEIAHDPVPEKGPKTFMVPMIPTAVPE 145


>gi|329770416|ref|ZP_08261798.1| 16S rRNA processing protein RimM [Gemella sanguinis M325]
 gi|328836539|gb|EGF86199.1| 16S rRNA processing protein RimM [Gemella sanguinis M325]
          Length = 169

 Score = 57.8 bits (138), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 49/166 (29%), Positives = 79/166 (47%), Gaps = 9/166 (5%)

Query: 10  MATIGTTHGLNGEVYIDS---YANNPIDLNRYVLYSNDNR--ELRILKMYRKNK-RFIAT 63
           +  I  TH L GEV + S   +          +L +  N+  E  +++ YR +K   +  
Sbjct: 5   VGKIVNTHSLRGEVKVISSTDFEEERFKKGSKLLITRGNQVIEEVVVESYRSHKNSLLVK 64

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F GID+I+ A + ++L+L    ++    ELEE+EF+  ++     FD      G+V  + 
Sbjct: 65  FEGIDSINEAEKFKNLQLKVDSENIS--ELEENEFYFHEIIGCRVFDENNMLLGEVVEIL 122

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
             GA  +  IK    K  LIP+    V  V++Q  KI I+ I  GL
Sbjct: 123 TPGANDVWVIKGENGKEILIPYIVDVVKNVDVQNKKIDIE-IMEGL 167


>gi|168214187|ref|ZP_02639812.1| 16S rRNA processing protein RimM [Clostridium perfringens CPE str.
           F4969]
 gi|170714269|gb|EDT26451.1| 16S rRNA processing protein RimM [Clostridium perfringens CPE str.
           F4969]
          Length = 165

 Score = 57.8 bits (138), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 45/163 (27%), Positives = 79/163 (48%), Gaps = 8/163 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANN--PIDLNRYVLYSNDNRELRILKMYRKNKRFI 61
           ++ L+++  I  THGL GE+ +     +    D   YV+      ++  +K ++   + I
Sbjct: 1   MEDLLVVGQIINTHGLRGEMKVMPLTEDMRRFDYLEYVILKGKKVKVEGVKYFKD--KVI 58

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               GI++I  A +L+   L  +R+D    ELEEDE+F  DL      D +G  +G++  
Sbjct: 59  LKLEGINSIEEAEKLKRTYLEIEREDAI--ELEEDEYFIVDLVGCTVVDTEGFEYGKIKD 116

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           V    +  +  ++   +K  L+P  K  VL +N+ E  I I P
Sbjct: 117 VIQTPSNDVYWVQG--KKEVLVPVLKDIVLNINMDEKLITIRP 157


>gi|257877633|ref|ZP_05657286.1| ribosome maturation factor rimM [Enterococcus casseliflavus EC20]
 gi|257811799|gb|EEV40619.1| ribosome maturation factor rimM [Enterococcus casseliflavus EC20]
          Length = 174

 Score = 57.4 bits (137), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 45/166 (27%), Positives = 81/166 (48%), Gaps = 9/166 (5%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNR----YVLYSNDNRELR-ILKMYRKNKRF-IAT 63
           +  I  THG+ GEV + S  + P +  R      L+  +   L  I+  +RK+K F + T
Sbjct: 7   VGKIVNTHGIRGEVRVISQTDFPEERYRKGAELTLFRENKEPLPLIVSGHRKHKNFDLLT 66

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F G  NI+     R+  L   + D  D  L E+EF+  ++  +E  +  G   G+V  + 
Sbjct: 67  FEGYSNINDVEPFRNGILKVTKDDLVD--LAENEFYYHEIIGLEVVEEDGTVIGKVKEIL 124

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           + GA  +  ++   +K  LIP+ +  V  ++L+  ++ ++ I  GL
Sbjct: 125 SPGANDVWVVQRKGKKDALIPYIESVVHTIDLENGQVTVE-IPEGL 169


>gi|170077861|ref|YP_001734499.1| 16S rRNA processing protein RimM [Synechococcus sp. PCC 7002]
 gi|209573625|sp|B1XKY8|RIMM_SYNP2 RecName: Full=Ribosome maturation factor rimM
 gi|169885530|gb|ACA99243.1| 16S rRNA processing protein RimM [Synechococcus sp. PCC 7002]
          Length = 175

 Score = 57.4 bits (137), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 78/165 (47%), Gaps = 13/165 (7%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNP----IDLNRYVLYSNDNRELRILKMYRK---NKRF 60
           +++  +    GL GEV I+   + P    +   R++   N + +   L+  R+      F
Sbjct: 7   IIIGQVVAAQGLKGEVRINPSTDFPERFEVPGQRWLQLPNQDPQSVELERGRQIPGKNLF 66

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFD--RQGKYWGQ 118
           +  F  I +   A  +R  K+  +  D    ELE DE+  +DL  +E FD   Q K  G 
Sbjct: 67  VVKFEHIQDRTQAENIRGAKVLVRAGDRP--ELEADEYHVSDLIGLEVFDYNTQAKL-GI 123

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
           V  +Y   A  +LE+ +  +K  L+PF K  V  V+L EN++ +D
Sbjct: 124 VSDLYT-AAQDVLEVTDANQKKHLVPFVKAIVPVVDLVENRLEVD 167


>gi|257867551|ref|ZP_05647204.1| ribosome maturation factor rimM [Enterococcus casseliflavus EC30]
 gi|257873880|ref|ZP_05653533.1| ribosome maturation factor rimM [Enterococcus casseliflavus EC10]
 gi|257801607|gb|EEV30537.1| ribosome maturation factor rimM [Enterococcus casseliflavus EC30]
 gi|257808044|gb|EEV36866.1| ribosome maturation factor rimM [Enterococcus casseliflavus EC10]
          Length = 174

 Score = 57.4 bits (137), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 45/166 (27%), Positives = 81/166 (48%), Gaps = 9/166 (5%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNR----YVLYSNDNRELR-ILKMYRKNKRF-IAT 63
           +  I  THG+ GEV + S  + P +  R      L+  +   L  I+  +RK+K F + T
Sbjct: 7   VGKIVNTHGIRGEVRVISQTDFPEERYRKGAELTLFRENKEPLPLIVSGHRKHKNFDLLT 66

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F G  NI+     R+  L   + D  D  L E+EF+  ++  +E  +  G   G+V  + 
Sbjct: 67  FEGYPNINDVEPFRNGILKVTKDDLVD--LAENEFYYHEIIGLEVVEEDGTVIGKVKEIL 124

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           + GA  +  ++   +K  LIP+ +  V  ++L+  ++ ++ I  GL
Sbjct: 125 SPGANDVWVVQRKGKKDALIPYIESVVHTIDLENGQVTVE-IPEGL 169


>gi|46908025|ref|YP_014414.1| 16S rRNA-processing protein RimM [Listeria monocytogenes serotype
           4b str. F2365]
 gi|47094472|ref|ZP_00232150.1| 16S rRNA processing protein RimM [Listeria monocytogenes str. 4b
           H7858]
 gi|293596406|ref|ZP_05231381.2| ribosome maturation factor rimM [Listeria monocytogenes FSL J1-194]
 gi|293597068|ref|ZP_05267001.2| ribosome maturation factor rimM [Listeria monocytogenes HPB2262]
 gi|59798758|sp|Q71YM3|RIMM_LISMF RecName: Full=Ribosome maturation factor rimM
 gi|46881295|gb|AAT04591.1| 16S rRNA processing protein RimM [Listeria monocytogenes serotype
           4b str. F2365]
 gi|47017155|gb|EAL08010.1| 16S rRNA processing protein RimM [Listeria monocytogenes str. 4b
           H7858]
 gi|293585205|gb|EFF97237.1| ribosome maturation factor rimM [Listeria monocytogenes HPB2262]
 gi|293595620|gb|EFG03381.1| ribosome maturation factor rimM [Listeria monocytogenes FSL J1-194]
          Length = 169

 Score = 57.4 bits (137), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 79/168 (47%), Gaps = 9/168 (5%)

Query: 10  MATIGTTHGLNGEVYIDSYANNP-----IDLNRYVLYSNDNR-ELRILKMYRKNKRF-IA 62
           +  I  THGL GE+ + +  + P     +    Y+   N  + E  I++ +RK+K F + 
Sbjct: 4   VGKIVNTHGLIGEIRVIATTDFPEERFQVGNTVYLFEKNSKKPEKLIIRSHRKHKNFDLL 63

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F G   IH    +++  L  K     D  LEE+EF+  ++         G+  G++  +
Sbjct: 64  MFEGFTGIHQVERMKEGVLKIKEAQLTD--LEENEFYFHEIIGCIVVTTDGEELGEITEI 121

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
              GA  +  +K + +K  LIP+    V E+N+ + KI I+ +   L+
Sbjct: 122 LTPGANDVWVVKGSDKKEKLIPYIADVVKEININDKKITIEVMEGLLD 169


>gi|187778961|ref|ZP_02995434.1| hypothetical protein CLOSPO_02556 [Clostridium sporogenes ATCC
           15579]
 gi|187772586|gb|EDU36388.1| hypothetical protein CLOSPO_02556 [Clostridium sporogenes ATCC
           15579]
          Length = 164

 Score = 57.4 bits (137), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 41/165 (24%), Positives = 76/165 (46%), Gaps = 10/165 (6%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSN---DNRELRILKMYRKNKRF 60
           + + + +  I  THG+ GEV +    +   D+ R+        D  E +I+    +    
Sbjct: 1   MKEFLAVGEIINTHGIKGEVKVYPLTD---DMKRFKKLKEVFIDGEERKIVSCKLQPNNV 57

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +    GID+I  A++ R   L  KR++    +L +  +F  DL E    D +G+  GQ+ 
Sbjct: 58  VLKIDGIDSIEEANKYRKKLLEIKREN--SVKLPKGSYFIADLMECRVIDEEGREIGQIS 115

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPI 165
            V   G+  + E+K  +E   L+P  K  V  ++++   + I P+
Sbjct: 116 DVIKTGSNDVYEVKGKIE--VLVPAIKDIVTNIDIENKTVTIKPL 158


>gi|86742273|ref|YP_482673.1| 16S rRNA-processing protein RimM [Frankia sp. CcI3]
 gi|109893016|sp|Q2J6Z8|RIMM_FRASC RecName: Full=Ribosome maturation factor rimM
 gi|86569135|gb|ABD12944.1| 16S rRNA processing protein RimM [Frankia sp. CcI3]
          Length = 179

 Score = 57.4 bits (137), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 74/169 (43%), Gaps = 14/169 (8%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRE-----LRILKMYRKNKRFIA 62
           +++  IG  HG+ GEV I+   + P    R+V+ +   RE     L +   +  + R + 
Sbjct: 5   IVVGRIGRPHGIRGEVTIEIRTDVP--HRRFVVGAVLGREGGGTALTVSGAHWHSGRLLL 62

Query: 63  TFSGIDNIHSASELRDLKL------YAKRQDFKDEELEEDE-FFNTDLEEMETFDRQGKY 115
            F G+D+  +A  LR + L           D  D + E  E +++ DL  +      G  
Sbjct: 63  HFRGVDDRGAAEALRGVLLTIDADQAGSPLDDADGDGEAVEMWWDRDLVGLRAVTTAGML 122

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
            G V  + +  AG +L I        L+PF +  V  V+    +I++DP
Sbjct: 123 LGHVTDIIHSPAGDLLAIGGPDGGEHLVPFVRDIVPTVDPPAGRIVVDP 171


>gi|68171521|ref|ZP_00544901.1| RimM protein:PRC-barrel [Ehrlichia chaffeensis str. Sapulpa]
 gi|88658505|ref|YP_506837.1| 16S rRNA processing protein RimM [Ehrlichia chaffeensis str.
           Arkansas]
 gi|109893015|sp|Q2GI96|RIMM_EHRCR RecName: Full=Ribosome maturation factor rimM
 gi|67999049|gb|EAM85720.1| RimM protein:PRC-barrel [Ehrlichia chaffeensis str. Sapulpa]
 gi|88599962|gb|ABD45431.1| 16S rRNA processing protein RimM [Ehrlichia chaffeensis str.
           Arkansas]
          Length = 175

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 78/158 (49%), Gaps = 3/158 (1%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRI-LKMYRKNKRFIATFS 65
           L+ +  I ++HG++G V I ++  NP D   Y   ++      + +         IA   
Sbjct: 5   LICLGVITSSHGISGHVKIKTFTENPEDFTSYGTLTDGINTYEVEIISIISQNIIIAQIK 64

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNF 125
           GI +   A  LR+ K + ++    +    +DEF+ +DL  +         +G +  ++NF
Sbjct: 65  GIVSRTDADLLRNKKFFVEKNKLPNPT-NDDEFYYSDLIGLNVVLENNNVYGNIKKIHNF 123

Query: 126 GAGSILEIK-NTMEKTFLIPFTKFAVLEVNLQENKILI 162
           G+  I+EI+ +  +K+ ++PFTK     VN++E  I+I
Sbjct: 124 GSCDIIEIRLSNSKKSTMLPFTKDIFPYVNVKEKYIII 161


>gi|16800973|ref|NP_471241.1| 16S rRNA-processing protein RimM [Listeria innocua Clip11262]
 gi|21362865|sp|Q92AL5|RIMM_LISIN RecName: Full=Ribosome maturation factor rimM
 gi|16414408|emb|CAC97137.1| lin1907 [Listeria innocua Clip11262]
          Length = 172

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 82/174 (47%), Gaps = 9/174 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNP-----IDLNRYVLYSNDNR-ELRILKMYRKN 57
           ++K+  +  I  THGL GE+ + +  + P     +    Y+   N  + E  I++ +RK+
Sbjct: 1   MEKMYNVGKIVNTHGLIGEIRVIATTDFPEERFQVGNTVYLFEKNSKKPEKLIIRSHRKH 60

Query: 58  KRF-IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           K F +  F G+  IH    +++  L  K     D  LEE+EF+  ++         G+  
Sbjct: 61  KNFDLLMFEGLTGIHQVERMKEGVLKIKEAQLTD--LEENEFYFHEIIGCTVVTTDGEEL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           G++  +   GA  +  +K   +K  LIP+    V ++N  + KI I+ +   L+
Sbjct: 119 GEITEILTPGANDVWVVKGADKKEKLIPYIADVVKDINTNDKKITIEVMEGLLD 172


>gi|238923880|ref|YP_002937396.1| 16S rRNA-processing protein [Eubacterium rectale ATCC 33656]
 gi|238875555|gb|ACR75262.1| 16S rRNA-processing protein [Eubacterium rectale ATCC 33656]
          Length = 178

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 82/171 (47%), Gaps = 7/171 (4%)

Query: 3   KLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY--VLYSN--DNRELRILKMYRKNK 58
           +++ L+ +  I +THG+ GEV +    ++     +   V+  N  + R+L I  +     
Sbjct: 10  RMEDLLQVGVITSTHGIRGEVKVFPTTDDAARFKKLKNVILDNGKERRDLEITSVKFFKN 69

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
           + I  F GID+I+   + +   L+  R++     LEE+E+F  DL  +     +G+  G 
Sbjct: 70  QVILKFKGIDDINDVEKYKKAPLFVTRENAV--PLEENEYFIADLIGLSVTSDEGEELGV 127

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           +  V   GA  +  +K       LIP  K  +L+V++ EN  +   + AGL
Sbjct: 128 IDDVLQTGANDVYVVKKAGANDLLIPAIKDCILDVDV-ENGTMKVHLLAGL 177


>gi|16803833|ref|NP_465318.1| 16S rRNA-processing protein RimM [Listeria monocytogenes EGD-e]
 gi|224500788|ref|ZP_03669137.1| 16S rRNA-processing protein [Listeria monocytogenes Finland 1988]
 gi|224503775|ref|ZP_03672082.1| 16S rRNA-processing protein [Listeria monocytogenes FSL R2-561]
 gi|254831606|ref|ZP_05236261.1| 16S rRNA-processing protein RimM [Listeria monocytogenes 10403S]
 gi|21362860|sp|Q8Y6A2|RIMM_LISMO RecName: Full=Ribosome maturation factor rimM
 gi|16411247|emb|CAC99871.1| lmo1793 [Listeria monocytogenes EGD-e]
          Length = 172

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 82/174 (47%), Gaps = 9/174 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNP-----IDLNRYVLYSNDNR-ELRILKMYRKN 57
           ++K+  +  I  THGL GE+ + +  + P     +    Y+   N  + E  I++ +RK+
Sbjct: 1   MEKMYNVGKIVNTHGLIGEIRVIATTDFPEERFQVGNTVYLFEKNSKKPEKLIIRSHRKH 60

Query: 58  KRF-IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           K F +  F G   IH    +++  L  K     +  LEE+EF+  ++         G+  
Sbjct: 61  KNFDLLMFEGFTGIHQVERMKEGVLKIKETQLTN--LEENEFYFHEIIGCTVVTTDGEEL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           G++  +   GA  +  +K   +K  LIP+    V E+N+ + KI I+ +   L+
Sbjct: 119 GEITEILTPGANDVWVVKGADKKEKLIPYIADVVKEINIDDQKITIEVMEGLLD 172


>gi|254458776|ref|ZP_05072200.1| 16S rRNA processing protein RimM [Campylobacterales bacterium GD 1]
 gi|207084542|gb|EDZ61830.1| 16S rRNA processing protein RimM [Campylobacterales bacterium GD 1]
          Length = 180

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/163 (28%), Positives = 80/163 (49%), Gaps = 12/163 (7%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDL-NRYVLYSNDNRELRILKMYRKNKRFIATFSGID 68
           +ATIG T G+ G++    + + P    +     +N N  + +  +   ++R +   +GI+
Sbjct: 12  IATIGKTVGIKGDLKFHIHCDFPEQFQDNSTFLTNKNNTITLSDV--NHERSLIKIAGIN 69

Query: 69  NIHSASELRDLKLYAKRQDF-KDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFGA 127
            I  A +  ++KLY  R++  K+  L + EFF  DLE+ E F+  GK  G V  V     
Sbjct: 70  TIEDAKKFTNIKLYTTREETRKNCHLNDGEFFWFDLEDCEVFE-DGKLLGVVNEVERITI 128

Query: 128 GSILEIKNTME-------KTFLIPFTKFAVLEVNLQENKILID 163
            + L +K   E       K+FLIPF K  +L  ++ +  I +D
Sbjct: 129 SNYLNVKTNEELVKSGSAKSFLIPFHKPFILNTDIDKKIITVD 171


>gi|161525403|ref|YP_001580415.1| 16S rRNA-processing protein RimM [Burkholderia multivorans ATCC
           17616]
 gi|189349860|ref|YP_001945488.1| 16S rRNA-processing protein RimM [Burkholderia multivorans ATCC
           17616]
 gi|221201284|ref|ZP_03574324.1| 16S rRNA processing protein RimM [Burkholderia multivorans CGD2M]
 gi|221206262|ref|ZP_03579275.1| 16S rRNA processing protein RimM [Burkholderia multivorans CGD2]
 gi|209573548|sp|A9ADT0|RIMM_BURM1 RecName: Full=Ribosome maturation factor rimM
 gi|160342832|gb|ABX15918.1| 16S rRNA processing protein RimM [Burkholderia multivorans ATCC
           17616]
 gi|189333882|dbj|BAG42952.1| 16S rRNA processing protein [Burkholderia multivorans ATCC 17616]
 gi|221173571|gb|EEE06005.1| 16S rRNA processing protein RimM [Burkholderia multivorans CGD2]
 gi|221179134|gb|EEE11541.1| 16S rRNA processing protein RimM [Burkholderia multivorans CGD2M]
          Length = 223

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 77/174 (44%), Gaps = 17/174 (9%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNP------IDLNRYVLYSNDNR-ELRILKMYRKN 57
           D  V +  +   +GL G V + ++A+        +   R+ L     R   RI++     
Sbjct: 47  DDAVEVGAVVDAYGLKGWVKVATHADAGRGGDALLSARRWWLEKGTQRFSARIVQSKTHG 106

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              +A  +G+ +  +A  LR  +++ +R+DF    L  DEF+  DL  ++  + Q    G
Sbjct: 107 DTVVAQPAGVGDRDAALALRGFRVFVRREDFP--ALAADEFYWVDLIGLDVVNEQSATLG 164

Query: 118 QVCGVYNFGAGSILEIK--------NTMEKTFLIPFTKFAVLEVNLQENKILID 163
           +V G+ + GA SI+ ++               LIPF    V  V+    +I++D
Sbjct: 165 KVVGMIDNGAHSIMRVEYPSVGKDGRPAAAERLIPFVGVYVKTVDQAARRIVVD 218


>gi|302558141|ref|ZP_07310483.1| 16S rRNA processing protein RimM [Streptomyces griseoflavus Tu4000]
 gi|302475759|gb|EFL38852.1| 16S rRNA processing protein RimM [Streptomyces griseoflavus Tu4000]
          Length = 191

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 40/184 (21%), Positives = 83/184 (45%), Gaps = 5/184 (2%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNP-IDLNRYVLYSNDNRE---LRILKMYRKNKRFIAT 63
           +++A IG  HG+ GEV ++   + P + L    + + D      L I      + R +  
Sbjct: 3   LVVARIGRAHGIKGEVTVEVRTDEPELRLGPGAVLTTDPASAGPLTIETGRVHSGRLLLR 62

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F G+ + + A  LR+  L A   D  +   +EDE+++  L +++   + G+  G++  + 
Sbjct: 63  FEGVRDRNGAEALRNTLLIAD-VDPDERPEDEDEYYDHQLIDLDVVTKDGEEVGRITEIS 121

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQYDCPL 183
           +     +  ++        +PF +  V E++L+E + +IDP    +++        D   
Sbjct: 122 HLPTQDLFVVERPDGSEVYVPFVEEIVTEIDLEEQRAVIDPPPGLIDDRAETASARDAAE 181

Query: 184 DSAG 187
           D  G
Sbjct: 182 DERG 185


>gi|325571318|ref|ZP_08146818.1| 16S rRNA processing protein RimM [Enterococcus casseliflavus ATCC
           12755]
 gi|325155794|gb|EGC67990.1| 16S rRNA processing protein RimM [Enterococcus casseliflavus ATCC
           12755]
          Length = 174

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/166 (26%), Positives = 81/166 (48%), Gaps = 9/166 (5%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNR----YVLYSNDNRELR-ILKMYRKNKRF-IAT 63
           +  I  THG+ GEV + S  + P +  R      L+  +   +  I+  +RK+K F + T
Sbjct: 7   VGKIVNTHGIRGEVRVISQTDFPEERYRKGAELTLFRENKEPITLIVSGHRKHKNFDLVT 66

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F G  NI+     R+  L   + D  D  L E+EF+  ++  +E  +  G   G+V  + 
Sbjct: 67  FEGYPNINDVEPFRNGILKVTKDDLVD--LAENEFYYHEIIGLEVVEEDGTIIGKVKEIL 124

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           + GA  +  ++   +K  LIP+ +  V  ++L+  ++ ++ I  GL
Sbjct: 125 SPGANDVWVVQRKGKKDALIPYIESVVHTIDLENGQVTVE-IPEGL 169


>gi|322418206|ref|YP_004197429.1| 16S rRNA processing protein RimM [Geobacter sp. M18]
 gi|320124593|gb|ADW12153.1| 16S rRNA processing protein RimM [Geobacter sp. M18]
          Length = 172

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/162 (26%), Positives = 74/162 (45%), Gaps = 8/162 (4%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPID---LNRYVLYSNDN--RELRILKMYRKNKRF 60
           K VL+  I   HG+ G++ +  +A +      LN   L S      E  ++      KR 
Sbjct: 5   KKVLIGKIQGPHGIRGQLRVIPFAGDASSISQLNSVFLKSPKGAMEEYSVVSAKNNGKRI 64

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           I T    DNI+    L   ++YA R    D  L +DEF+ +DL  ++     G+  G++ 
Sbjct: 65  ILTLKPFDNINQVLHLVGSEIYADRVALPD--LPDDEFYWSDLLGLQVVTSDGEELGELV 122

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
            +   G+  +  +K+   +  LIP  +  VL V+L E ++ +
Sbjct: 123 DIIETGSNDVYVVKHN-GREVLIPALEDVVLSVDLAEGRMTV 163


>gi|254245968|ref|ZP_04939289.1| RimM protein [Burkholderia cenocepacia PC184]
 gi|124870744|gb|EAY62460.1| RimM protein [Burkholderia cenocepacia PC184]
          Length = 226

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 81/174 (46%), Gaps = 17/174 (9%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNP------IDLNRYVLYSNDNR-ELRILKMYRKN 57
           D  V +  +   +GL G V + ++A+        ++  R+ L     R  +RI++    +
Sbjct: 50  DDAVEVGAVVDAYGLKGWVKVATHADAGRGGDALLNARRWWLERGAERLSVRIMQSKTHS 109

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              +A  +G+ +  +A  +R  +++ +R+DF    L  DEF+  DL  +E  + Q    G
Sbjct: 110 DTVVAQPAGVSDRDAALSMRGFRVFVRREDFP--ALAADEFYWVDLIGLEVVNEQSVALG 167

Query: 118 QVCGVYNFGAGSILEI------KNTMEKT--FLIPFTKFAVLEVNLQENKILID 163
           +V G+ + G  SI+ +      K+    T   LIPF    V  V+    +I++D
Sbjct: 168 KVSGMIDNGVHSIMRVEYPATGKDGQPTTDERLIPFVGVYVKTVDQAARRIVVD 221


>gi|170732381|ref|YP_001764328.1| 16S rRNA-processing protein RimM [Burkholderia cenocepacia MC0-3]
 gi|209573546|sp|B1JXU4|RIMM_BURCC RecName: Full=Ribosome maturation factor rimM
 gi|169815623|gb|ACA90206.1| 16S rRNA processing protein RimM [Burkholderia cenocepacia MC0-3]
          Length = 225

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 81/174 (46%), Gaps = 17/174 (9%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNP------IDLNRYVLYSNDNR-ELRILKMYRKN 57
           D  V +  +   +GL G V + ++A+        ++  R+ L     R  +RI++    +
Sbjct: 49  DDAVEVGAVVDAYGLKGWVKVATHADAGRGGDALLNARRWWLERGAERLSVRIMQSKTHS 108

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              +A  +G+ +  +A  +R  +++ +R+DF    L  DEF+  DL  +E  + Q    G
Sbjct: 109 DTVVAQPAGVSDRDAALSMRGFRVFVRREDFP--ALAADEFYWVDLIGLEVVNEQSVALG 166

Query: 118 QVCGVYNFGAGSILEI------KNTMEKT--FLIPFTKFAVLEVNLQENKILID 163
           +V G+ + G  SI+ +      K+    T   LIPF    V  V+    +I++D
Sbjct: 167 KVSGMIDNGVHSIMRVEYPATGKDGQPTTDERLIPFVGVYVKTVDQAARRIVVD 220


>gi|315303689|ref|ZP_07874207.1| 16S rRNA processing protein RimM [Listeria ivanovii FSL F6-596]
 gi|313627938|gb|EFR96553.1| 16S rRNA processing protein RimM [Listeria ivanovii FSL F6-596]
          Length = 172

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 84/174 (48%), Gaps = 9/174 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDS---YANNPIDLNRYV-LYSNDNR--ELRILKMYRKN 57
           ++K+  +  I  THGL GE+ + +   +AN    +   V L+  +++  E  I++ +RK+
Sbjct: 1   MEKMYNVGKIVNTHGLIGEIRVIATTDFANERFQVGNTVYLFEKNSKKPEKLIIRSHRKH 60

Query: 58  KRF-IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           K F +  F G   IH    +++  L    +   D  LEE+EF+  ++         G+  
Sbjct: 61  KNFDLLMFEGFTGIHQVERMKEGTLKISEKQLTD--LEENEFYFHEIIGCSVVTTDGEEL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           G++  +   GA  +  +K   +K  LIP     V E+N+ + KI I+ +   L+
Sbjct: 119 GEITEILTPGANDVWVVKGNDKKEKLIPXXXDVVKEINISDKKITIEVMEGLLD 172


>gi|295397869|ref|ZP_06807932.1| 16S rRNA processing protein RimM [Aerococcus viridans ATCC 11563]
 gi|294973914|gb|EFG49678.1| 16S rRNA processing protein RimM [Aerococcus viridans ATCC 11563]
          Length = 191

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/177 (25%), Positives = 89/177 (50%), Gaps = 12/177 (6%)

Query: 1   MVKLDKLV-----LMATIGTTHGLNGEVYIDSYANNPIDLNR----YVLYSNDNR-ELRI 50
           MVK++ +      L+  I  T  L GEV + +  + P +  R      +++ D   E   
Sbjct: 1   MVKIEGMAEEQYYLVGKIVNTQALRGEVRVMATTDFPEERFRIGATLAIFNGDKLVETVE 60

Query: 51  LKMYRKNKRF-IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETF 109
           +  +R +K F +  F G DNI+   + +   L     + + +EL+E+EF+  D+  +E +
Sbjct: 61  VDGHRLHKNFNLLHFKGKDNINDVEKFKGFDLKVAGTEREADELDENEFYYDDIIGLEVY 120

Query: 110 DRQGKYWGQVCGVYNFGAGSILEIKNTME-KTFLIPFTKFAVLEVNLQENKILIDPI 165
                Y G+V  + +  +  +  I+   + K  LIP+ +  VLE++L +N+++IDP+
Sbjct: 121 TTDETYLGKVREITSLPSNDVWAIQRPNKGKDILIPYIEDIVLEIDLDDNRVVIDPM 177


>gi|73542224|ref|YP_296744.1| 16S rRNA-processing protein [Ralstonia eutropha JMP134]
 gi|109893038|sp|Q46Y83|RIMM_RALEJ RecName: Full=Ribosome maturation factor rimM
 gi|72119637|gb|AAZ61900.1| 16S rRNA processing protein RimM [Ralstonia eutropha JMP134]
          Length = 221

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/180 (22%), Positives = 81/180 (45%), Gaps = 23/180 (12%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDL---NRYVLYSNDNREL------------- 48
           D LV +  +G  +G+ G + ++ +AN+   L    R+ L +     L             
Sbjct: 39  DDLVEVGYVGAAYGIRGWIKVEPHANDASALLHARRWWLLTPPQAGLVATAEASRAQAVC 98

Query: 49  -RILKMYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEME 107
            R+ +    +   +A  +G+ + + A  L+  +++ +R DF   E  E+EF+  DL    
Sbjct: 99  VRVAQSREHSGTVVAQATGVSDRNLAEALKGRRVWIRRADFPAPE--ENEFYWVDLIGCA 156

Query: 108 TFDRQGKYWGQVCGVYNFGAGSILEIKNTME----KTFLIPFTKFAVLEVNLQENKILID 163
             + QG+  G+V G+ + GA  IL++   +        L+PF    +  V+    +I++D
Sbjct: 157 VSNEQGELLGEVSGLIDNGAHQILQVAYALPDGKAGERLVPFVDAFLRTVDTAGKRIVVD 216


>gi|226325146|ref|ZP_03800664.1| hypothetical protein COPCOM_02938 [Coprococcus comes ATCC 27758]
 gi|225206494|gb|EEG88848.1| hypothetical protein COPCOM_02938 [Coprococcus comes ATCC 27758]
          Length = 170

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 78/162 (48%), Gaps = 16/162 (9%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNRY------VLYSNDNR---ELRILKMYRKNKRF 60
           +  I +THG+ GEV +    ++P   NR+      VL +   +   E+  +K +++    
Sbjct: 9   VGVITSTHGIKGEVKVFPTTDDP---NRFRALKDVVLDTGKEQIPLEIEGVKFFKQ--YV 63

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           I  F GIDNI+   + R + L   R++    ELEEDE++  D+  M+ +   G+ +G + 
Sbjct: 64  ILKFKGIDNINDIEKYRKMPLLVSRENAV--ELEEDEYYMADIIGMDVYTEDGEKFGVLE 121

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
            +   GA  +  +        L+P     +L+V+ +  K+ +
Sbjct: 122 DIMETGANDVYVVSTEAHTEVLLPAIHDCILDVDTENRKMTV 163


>gi|221213541|ref|ZP_03586515.1| 16S rRNA processing protein RimM [Burkholderia multivorans CGD1]
 gi|221166330|gb|EED98802.1| 16S rRNA processing protein RimM [Burkholderia multivorans CGD1]
          Length = 223

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 77/174 (44%), Gaps = 17/174 (9%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNP------IDLNRYVLYSNDNR-ELRILKMYRKN 57
           D  V +  +   +GL G V + ++A+        +   R+ L     R   RI++     
Sbjct: 47  DDAVEVGAVVDAYGLKGWVKVATHADAGRGGDALLSARRWWLEKGTQRFSARIVQSKTHG 106

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              +A  +G+ +  +A  LR  +++ +R+DF    L  DEF+  DL  ++  + Q    G
Sbjct: 107 DTVVAQPAGVGDRDAALALRGFRVFVRREDFP--ALAADEFYWVDLIGLDVVNEQSATLG 164

Query: 118 QVCGVYNFGAGSILEIK--------NTMEKTFLIPFTKFAVLEVNLQENKILID 163
           +V G+ + GA SI+ ++               LIPF    V  V+    +I++D
Sbjct: 165 KVVGMIDNGAHSIMRVEYPSVGKDGRPAAAERLIPFVGVYVKTVDQTARRIVVD 218


>gi|194288940|ref|YP_002004847.1| 16S rRNA-processing protein rimm [Cupriavidus taiwanensis LMG
           19424]
 gi|209573574|sp|B3R397|RIMM_CUPTR RecName: Full=Ribosome maturation factor rimM
 gi|193222775|emb|CAQ68778.1| 16S rRNA PROCESSING PROTEIN [Cupriavidus taiwanensis LMG 19424]
          Length = 207

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/179 (24%), Positives = 81/179 (45%), Gaps = 22/179 (12%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDL---NRYVLYSNDNREL------------- 48
           + LV +  +G  +G+ G + +  +A++   L    R+ L S     L             
Sbjct: 26  EDLVEVGYVGAAYGIRGWIKVQPHADDASALLHARRWWLLSPPQAGLVAADAARSQPVCV 85

Query: 49  RILKMYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMET 108
           +I +    +   +A  +G+ + + A  LR  +++ +R DF   +  EDEF+  DL     
Sbjct: 86  KIAQSREHSGTVVAQAAGVADRNLAEALRGRRVWIRRADFPAPD--EDEFYWVDLIGCNV 143

Query: 109 FDRQGKYWGQVCGVYNFGAGSILEI----KNTMEKTFLIPFTKFAVLEVNLQENKILID 163
            + QG+  G+V G+ + GA  IL++     +      LIPF    + EV+    +I++D
Sbjct: 144 SNEQGELLGEVSGLIDNGAHQILQVAFVQPDGKAGERLIPFVDAFLREVDTAGKRIVVD 202


>gi|257870307|ref|ZP_05649960.1| ribosome maturation factor rimM [Enterococcus gallinarum EG2]
 gi|257804471|gb|EEV33293.1| ribosome maturation factor rimM [Enterococcus gallinarum EG2]
          Length = 174

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/166 (25%), Positives = 82/166 (49%), Gaps = 9/166 (5%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDL----NRYVLYSNDNRELRI-LKMYRKNKRF-IAT 63
           +  I  THG+ GEV + S  + P +      R  L+  +   L + +  +RK+K F + T
Sbjct: 7   VGKIVNTHGIRGEVRVISQTDFPEERYRKGQRLTLFRENKAPLELTVAGHRKHKNFDLLT 66

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F G   I+    LRD  L   + +    EL E+E++  ++  +   D Q +  G++  + 
Sbjct: 67  FEGYPTINDVEPLRDGILKVSKDELS--ELTENEYYYHEIIGLTVIDEQARELGKIKEIL 124

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           + GA  +  ++   +K  LIP+ +  V +++L + ++ I+ I  GL
Sbjct: 125 SPGANDVWVVQRKGKKDALIPYIESVVKQIDLDKGEVHIE-IPEGL 169


>gi|206561262|ref|YP_002232027.1| 16S rRNA-processing protein RimM [Burkholderia cenocepacia J2315]
 gi|198037304|emb|CAR53226.1| 16S rRNA processing protein [Burkholderia cenocepacia J2315]
          Length = 226

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 82/176 (46%), Gaps = 21/176 (11%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNP------IDLNRYVLYSNDNR-ELRILKMYRKN 57
           D  V +  +   +GL G V + ++A+        ++  R+ L     R  +RI++    +
Sbjct: 50  DDAVEVGAVVDAYGLKGWVKVAAHADAGRGGDALLNARRWWLERGAERLSVRIMQSKTHS 109

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              +A  +G+ +  +A  +R  +++ +R+DF    L  DEF+  DL  +E  + Q    G
Sbjct: 110 DTVVAQPAGVSDRDAALSMRGFRVFVRREDFP--ALAADEFYWVDLIGLEVVNEQSVALG 167

Query: 118 QVCGVYNFGAGSILEIK----------NTMEKTFLIPFTKFAVLEVNLQENKILID 163
           +V G+ + G  SI+ ++           T E+  LIPF    V  V+    +I++D
Sbjct: 168 KVSGMIDNGVHSIMRVEYPATGKDGRPTTDER--LIPFVGVYVKTVDQAARRIVVD 221


>gi|152985572|ref|YP_001346759.1| 16S rRNA-processing protein RimM [Pseudomonas aeruginosa PA7]
 gi|166226466|sp|A6V124|RIMM_PSEA7 RecName: Full=Ribosome maturation factor rimM
 gi|150960730|gb|ABR82755.1| 16S rRNA processing protein RimM [Pseudomonas aeruginosa PA7]
          Length = 175

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/167 (23%), Positives = 80/167 (47%), Gaps = 10/167 (5%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYAN---NPIDLNRYVLYSN-DNRELRILKMYRKNKRF 60
           D LV++  I + +G+ GEV + S+ +   N +D  R+ L  + + R+  +++     K  
Sbjct: 6   DDLVVIGKIVSVYGIRGEVKVYSFTDPLDNLLDYRRWTLRRDGETRQAELVRGRLHGKVL 65

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
            A   G+D+   A      ++   R +     LEE E++   LE ++  D+ G+  G + 
Sbjct: 66  AAKLKGLDDREEARTFTGYEICIPRSELP--SLEEGEYYWYQLEGLKVIDQGGQLLGVID 123

Query: 121 GVYNFGAGSILEIKNTM----EKTFLIPFTKFAVLEVNLQENKILID 163
            +   GA  ++ +K       ++  L+P+T   VL ++L   ++ +D
Sbjct: 124 HLLETGANDVMVVKPCAGSLDDRERLLPYTGQCVLSIDLAAGEMRVD 170


>gi|116689093|ref|YP_834716.1| 16S rRNA-processing protein [Burkholderia cenocepacia HI2424]
 gi|209573547|sp|A0K5P6|RIMM_BURCH RecName: Full=Ribosome maturation factor rimM
 gi|116647182|gb|ABK07823.1| 16S rRNA processing protein RimM [Burkholderia cenocepacia HI2424]
          Length = 225

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 81/174 (46%), Gaps = 17/174 (9%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNP------IDLNRYVLYSNDNR-ELRILKMYRKN 57
           D  V +  +   +GL G V + ++A+        ++  R+ L     R  +RI++    +
Sbjct: 49  DDAVEVGAVVDAYGLKGWVKVATHADAGRGGDALLNARRWWLERGAERLSVRIMQSKTHS 108

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              +A  +G+ +  +A  +R  +++ +R+DF    L  DEF+  DL  +E  + Q    G
Sbjct: 109 DTVVAQPAGVSDRDAALSMRGFRVFVRREDFP--ALAADEFYWVDLIGLEVVNEQSVALG 166

Query: 118 QVCGVYNFGAGSILEI------KNTMEKT--FLIPFTKFAVLEVNLQENKILID 163
           +V G+ + G  SI+ +      K+    T   LIPF    V  V+    +I++D
Sbjct: 167 KVSGMIDNGVHSIMRVEYPATGKDGQPTTDERLIPFVGVYVKTVDQAARRIVVD 220


>gi|319950997|ref|ZP_08024867.1| 16S rRNA-processing protein RimM [Dietzia cinnamea P4]
 gi|319435340|gb|EFV90590.1| 16S rRNA-processing protein RimM [Dietzia cinnamea P4]
          Length = 177

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/158 (23%), Positives = 71/158 (44%), Gaps = 10/158 (6%)

Query: 16  THGLNGEVYIDSYANNPID-------LNRYVLYSN--DNRELRILKMYRKNKRFIATFSG 66
           +HG+ GE+ ++   ++P +       L   V   +   +R++ +      + R +   +G
Sbjct: 11  SHGVRGELVVEVRTDSPEERFAPGARLTGRVGKGDRATDRDVTVEAARSHSGRLLVRLAG 70

Query: 67  IDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFG 126
           + +  +A  LR + L     +  D E + DE+ +  L  +   D  G   G+V  + +  
Sbjct: 71  VSDRDTADALRGMLLLVDSAELPDPE-DPDEYHDHQLVGLRVLDTSGAPLGEVTEIVHTP 129

Query: 127 AGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           AG +L I+ T     L+PF    V EV++     +IDP
Sbjct: 130 AGELLGIRLTDGADALVPFVTEMVPEVDVPGGTCVIDP 167


>gi|270284299|ref|ZP_05965884.2| 16S rRNA processing protein RimM [Bifidobacterium gallicum DSM
           20093]
 gi|270277505|gb|EFA23359.1| 16S rRNA processing protein RimM [Bifidobacterium gallicum DSM
           20093]
          Length = 215

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 87/181 (48%), Gaps = 27/181 (14%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRYV----LYSNDNRELRILKMYRKNK-RFI 61
           L+ +A +G   GL GEV + S+ + P    R+     LY+ D  +  +++  R  K R+I
Sbjct: 22  LLRVARVGRAQGLKGEVTVQSFTDEP--EYRFEPGSELYTKDGEQTFVVERSRSMKNRWI 79

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFD--------RQG 113
             F G+D+  +A  +    LY +  D +D  LEED ++  DL  +E            + 
Sbjct: 80  LKFEGVDDRTAAEAINGTVLYGEADDAEDM-LEEDVWYAKDLVGLEVRMAPDNLLGLEED 138

Query: 114 KYWGQVCGVYNFGAGSILEIK----------NTMEKTFLIPFTKFAVLEVNLQENKILID 163
           +  G+V  V + G   +L+++            +EKT L+PF +  V E++ ++   LI+
Sbjct: 139 RLIGKVVDVID-GPQWLLKVRLAEPVRDADGVVVEKTALVPFVEQIVTEIDPEQQVALIN 197

Query: 164 P 164
           P
Sbjct: 198 P 198


>gi|71275921|ref|ZP_00652204.1| RimM protein:PRC-barrel [Xylella fastidiosa Dixon]
 gi|71900007|ref|ZP_00682152.1| RimM protein:PRC-barrel [Xylella fastidiosa Ann-1]
 gi|170729325|ref|YP_001774758.1| 16S rRNA-processing protein RimM [Xylella fastidiosa M12]
 gi|238687916|sp|B0U289|RIMM_XYLFM RecName: Full=Ribosome maturation factor rimM
 gi|71163298|gb|EAO13017.1| RimM protein:PRC-barrel [Xylella fastidiosa Dixon]
 gi|71730217|gb|EAO32303.1| RimM protein:PRC-barrel [Xylella fastidiosa Ann-1]
 gi|167964118|gb|ACA11128.1| 16S rRNA processing protein [Xylella fastidiosa M12]
          Length = 170

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 79/165 (47%), Gaps = 10/165 (6%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY---VLYSNDNRE--LRILKMYRKNKR 59
           ++ +L+  +    GL GE+ ++S+      + RY   +L S    E  L   + Y   KR
Sbjct: 5   ERRILLGRVVGGFGLRGEIKMESWTEPRDAIFRYQPWLLRSPTGTESMLNGARGYDTGKR 64

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            IATF GI++ ++   +   ++Y  R          DE++  DLE ++    +G   G V
Sbjct: 65  LIATFPGINDRNAVEAICGTEIYVPRSALPPPH--PDEYYWVDLEGLQVHTLEGVVLGSV 122

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKF-AVLEVNLQENKILID 163
             +++ GA  ++ I    E+  LIPF +   V  V+ +  +I++D
Sbjct: 123 SHLFSNGANDVVVIHGERER--LIPFVQPDYVKSVDFEAERIVVD 165


>gi|291524520|emb|CBK90107.1| 16S rRNA processing protein RimM [Eubacterium rectale DSM 17629]
          Length = 168

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 81/170 (47%), Gaps = 7/170 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY--VLYSN--DNRELRILKMYRKNKR 59
           ++ L+ +  I +THG+ GEV +    ++     +   V+  N  + R+L I  +     +
Sbjct: 1   MEDLLQVGVITSTHGIRGEVKVFPTTDDAARFKKLKNVILDNGKERRDLEITSVKFFKNQ 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F GID+I+   + +   L+  R++     LEE+E+F  DL  +     +G+  G +
Sbjct: 61  VILKFKGIDDINDVEKYKKAPLFVTRENAV--PLEENEYFIADLIGLSVTSDEGEELGVI 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
             V   GA  +  +K       LIP  K  +L+V++ EN  +   + AGL
Sbjct: 119 DDVLQTGANDVYVVKKAGANDLLIPAIKDCILDVDV-ENGTMKVHLLAGL 167


>gi|289578451|ref|YP_003477078.1| 16S rRNA processing protein RimM [Thermoanaerobacter italicus Ab9]
 gi|297544727|ref|YP_003677029.1| 16S rRNA processing protein RimM [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
 gi|289528164|gb|ADD02516.1| 16S rRNA processing protein RimM [Thermoanaerobacter italicus Ab9]
 gi|296842502|gb|ADH61018.1| 16S rRNA processing protein RimM [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
          Length = 167

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 79/165 (47%), Gaps = 9/165 (5%)

Query: 10  MATIGTTHGLNGEVYIDSYANNP---IDLNRYVLYSNDNRELRILKMYRK--NKRFIATF 64
           +  + + HG+ GEV +    N P    +L    ++ +  R  +    Y K  +KR     
Sbjct: 7   VGKVTSAHGIKGEVKVYPLTNVPERFYELEYVWVFDDQQRPRKYDIEYVKIISKRVCVKL 66

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
            GIDN   A +L+   L    Q+    +LE+DE+F  DL  M+ +  +G + G +  V  
Sbjct: 67  KGIDNRDEAEKLKGAFLKVDSQNAL--KLEKDEYFIKDLIGMKVYTEEGDFVGTLVEVLQ 124

Query: 125 FGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
            GA  +  IK   E+  LIP  K  V +V++ +NK+++  +  GL
Sbjct: 125 TGANDVYVIKGE-EREILIPAIKEVVKKVDV-DNKVMVVHLLEGL 167


>gi|83944835|ref|ZP_00957201.1| putative 16S rRNA processing protein [Oceanicaulis alexandrii
           HTCC2633]
 gi|83851617|gb|EAP89472.1| putative 16S rRNA processing protein [Oceanicaulis alexandrii
           HTCC2633]
          Length = 176

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/163 (23%), Positives = 77/163 (47%), Gaps = 7/163 (4%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRK---NKRFI 61
           ++LV++A +   HG+ G+  +  + +    +  Y  + + +  + +     K   N   I
Sbjct: 6   EELVVIAAVAGAHGVRGDAKLKPFGDA-AQVCSYGPFLDKSGAVILTPTQAKPGPNGTVI 64

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
                         ++   L+    +    EL+EDEF+ +DL  +   + +G+  G++  
Sbjct: 65  VRLKETLTREQVQAMKGTLLHVPHSNLP--ELDEDEFYYSDLIGLNVENLEGETLGKIKS 122

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           V +FGAG +LEI    +  + +PFTK A   V+L+  K++ +P
Sbjct: 123 VQDFGAGDLLEISGP-DGVWFLPFTKDAAPHVDLKAGKLVANP 164


>gi|301063497|ref|ZP_07204029.1| 16S rRNA processing protein RimM [delta proteobacterium NaphS2]
 gi|300442436|gb|EFK06669.1| 16S rRNA processing protein RimM [delta proteobacterium NaphS2]
          Length = 173

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/166 (22%), Positives = 75/166 (45%), Gaps = 9/166 (5%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDL-NRYVLY----SNDNRELRILKMYRKNKR 59
           D ++L   +   HG+ G + I S++++   L N   ++    +  +R  +++        
Sbjct: 3   DNVILFGRVLRPHGMEGLLRISSFSHSVASLLNAETVFLKLENGKSRHTKVISARPHKNI 62

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
           F+   +G+ NI  A  LR   +Y  +     E    DE+F  +L  +  F   G + G V
Sbjct: 63  FLVKLAGLTNIDQAEALRGADIYISKSTLVRER---DEYFWFELLGLSVFSDDGDFLGVV 119

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPI 165
             +   G+  I  +KN  E+  L+P     V  ++L+  K+++ P+
Sbjct: 120 SQIIPAGSNEIYVVKNK-EREILLPAAHEVVNHIDLKNGKMIVSPV 164


>gi|309389194|gb|ADO77074.1| 16S rRNA processing protein RimM [Halanaerobium praevalens DSM
           2228]
          Length = 170

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/165 (27%), Positives = 80/165 (48%), Gaps = 7/165 (4%)

Query: 10  MATIGTTHGLNGEVYIDSYANNP---IDLNRYVLYSNDN-RELRILKMYRKNKRFIATFS 65
           +  I    G  GEV + +  + P    DL    L   DN +EL I  +  + +  I  F 
Sbjct: 8   IGIITRFQGNKGEVRVKATTDIPERFFDLESVYLKRRDNLKELEIDYIRFQKQFVIIKFF 67

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNF 125
            I++I  A EL++ ++     +     L ED F+ +DL E E + + G+Y G++  V + 
Sbjct: 68  SINSIDEAEELKNYQVLIDESE--KYLLPEDNFYVSDLIESEVYLKTGEYLGKLVDVISN 125

Query: 126 GAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
               I  I    +K ++IP +   ++E+ ++  KI++DPI   L+
Sbjct: 126 TGTDIFLIAGQ-KKEYMIPASHEMIIEIKVEAKKIIVDPIPGILD 169


>gi|168184652|ref|ZP_02619316.1| 16S rRNA processing protein RimM [Clostridium botulinum Bf]
 gi|237795882|ref|YP_002863434.1| 16S rRNA-processing protein RimM [Clostridium botulinum Ba4 str.
           657]
 gi|182672310|gb|EDT84271.1| 16S rRNA processing protein RimM [Clostridium botulinum Bf]
 gi|229261722|gb|ACQ52755.1| 16S rRNA processing protein RimM [Clostridium botulinum Ba4 str.
           657]
          Length = 164

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 75/165 (45%), Gaps = 10/165 (6%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSN---DNRELRILKMYRKNKRF 60
           + + + +  I  THG+ GEV +    +   D+ R+        D  E +IL    +    
Sbjct: 1   MKEFLAVGEIINTHGIKGEVKVFPLTD---DMKRFKKLKEVFIDGEERKILSCKLQPNNV 57

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +    GID+I  A++ R   L  KR++    +L +  +F  DL E    D +G+  GQ+ 
Sbjct: 58  VLKIEGIDSIEEANKYRKKLLEIKREN--SIKLPKGSYFIADLIECRVIDEKGREIGQIS 115

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPI 165
            V   G+  + E+K   E   L+P  K  V  ++++   + I P+
Sbjct: 116 DVIKTGSNDVYEVKGKSE--VLVPAIKDIVTNIDIENKTVTIKPL 158


>gi|167037686|ref|YP_001665264.1| 16S rRNA-processing protein RimM [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|167040347|ref|YP_001663332.1| 16S rRNA-processing protein RimM [Thermoanaerobacter sp. X514]
 gi|256750720|ref|ZP_05491605.1| 16S rRNA processing protein RimM [Thermoanaerobacter ethanolicus
           CCSD1]
 gi|300914431|ref|ZP_07131747.1| 16S rRNA processing protein RimM [Thermoanaerobacter sp. X561]
 gi|307724333|ref|YP_003904084.1| 16S rRNA processing protein RimM [Thermoanaerobacter sp. X513]
 gi|320116101|ref|YP_004186260.1| 16S rRNA processing protein RimM [Thermoanaerobacter brockii subsp.
           finnii Ako-1]
 gi|326389500|ref|ZP_08211067.1| 16S rRNA processing protein RimM [Thermoanaerobacter ethanolicus JW
           200]
 gi|238687582|sp|B0K1U8|RIMM_THEPX RecName: Full=Ribosome maturation factor rimM
 gi|238687661|sp|B0K9W5|RIMM_THEP3 RecName: Full=Ribosome maturation factor rimM
 gi|166854587|gb|ABY92996.1| 16S rRNA processing protein RimM [Thermoanaerobacter sp. X514]
 gi|166856520|gb|ABY94928.1| 16S rRNA processing protein RimM [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|256750303|gb|EEU63322.1| 16S rRNA processing protein RimM [Thermoanaerobacter ethanolicus
           CCSD1]
 gi|300889366|gb|EFK84512.1| 16S rRNA processing protein RimM [Thermoanaerobacter sp. X561]
 gi|307581394|gb|ADN54793.1| 16S rRNA processing protein RimM [Thermoanaerobacter sp. X513]
 gi|319929192|gb|ADV79877.1| 16S rRNA processing protein RimM [Thermoanaerobacter brockii subsp.
           finnii Ako-1]
 gi|325994505|gb|EGD52930.1| 16S rRNA processing protein RimM [Thermoanaerobacter ethanolicus JW
           200]
          Length = 167

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 78/165 (47%), Gaps = 9/165 (5%)

Query: 10  MATIGTTHGLNGEVYIDSYANNP---IDLNRYVLYSNDNRELRILKMYRK--NKRFIATF 64
           +  + + HG+ GEV +    N P    DL    ++ +  R  +    Y K  +K      
Sbjct: 7   VGKVTSAHGIKGEVKVYPLTNVPERFYDLEYVWIFDDQQRPHKYDIEYVKIISKGVCVKL 66

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
            GID    A +L+   L    Q+    ELEE+E+F  DL  M+ +  +G + G +  V  
Sbjct: 67  KGIDTRGDAEKLKGAFLKVDSQNAL--ELEENEYFIKDLVGMKVYTEEGSFLGTLVEVLK 124

Query: 125 FGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
            GA  +  IK T E+  LIP  K  V +V++ +NK+++  +  GL
Sbjct: 125 TGANDVYVIK-TEEREILIPAIKEVVKKVDV-DNKVMVVHLLEGL 167


>gi|297559208|ref|YP_003678182.1| 16S rRNA processing protein RimM [Nocardiopsis dassonvillei subsp.
           dassonvillei DSM 43111]
 gi|296843656|gb|ADH65676.1| 16S rRNA processing protein RimM [Nocardiopsis dassonvillei subsp.
           dassonvillei DSM 43111]
          Length = 170

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 72/163 (44%), Gaps = 10/163 (6%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYV---LYSNDNRE---LRILKMYRKNKRFI 61
           +++  IG  HG+ G+V +D   ++P    R+    + + D  E   L ++   R + R +
Sbjct: 3   LVVGRIGRAHGVRGDVAVDVRTDDPA--ARFADGSVLATDPAEAGPLTVVSTRRHSGRLL 60

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
             F G+ +  +A  LR   L    +D    E + DEF + +L  +       +  G V  
Sbjct: 61  VRFEGVADRDAAEGLRGTALLVDSEDIPPLE-DPDEFHDHELIGLAAVTTGAEPVGTVAD 119

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           V +  A  +L +         +PF    V EV++   +I+IDP
Sbjct: 120 VLHH-AQDLLVVTTPDGAEVYVPFVAALVPEVDVAGGRIVIDP 161


>gi|73662837|ref|YP_301618.1| 16S rRNA-processing protein RimM [Staphylococcus saprophyticus
           subsp. saprophyticus ATCC 15305]
 gi|109893055|sp|Q49X25|RIMM_STAS1 RecName: Full=Ribosome maturation factor rimM
 gi|72495352|dbj|BAE18673.1| RimM protein required for 16S rRNA processing [Staphylococcus
           saprophyticus subsp. saprophyticus ATCC 15305]
          Length = 168

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 81/169 (47%), Gaps = 9/169 (5%)

Query: 8   VLMATIGTTHGLNGEVYIDS---YANNPIDLNRYVLYSNDNRELR--ILKMYRKNKRF-I 61
           V +  I  THG+ GE+ + S   +          V+    N+E     +  YR +K   +
Sbjct: 3   VEIGKIVNTHGIKGEIKVKSNSDFTETRFQPGELVIIERKNKEPLEFTIASYRMHKGLHM 62

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
            TF GI+NI+    L+   +  +R D ++ EL E EF+ +D+     FD      G+V  
Sbjct: 63  LTFEGINNINDIEYLKGETIMQER-DHEEIELGEHEFYYSDIIGCTVFDDDDTPIGRVTE 121

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           ++  GA  +  +K   +K +LIP+    V +++++  +I I P+   L+
Sbjct: 122 IFETGANDVWVVKG--DKEYLIPYIADVVKDIDVEGRRIQITPMEGLLD 168


>gi|34499129|ref|NP_903344.1| 16S rRNA-processing protein RimM [Chromobacterium violaceum ATCC
           12472]
 gi|48474349|sp|Q7NRV6|RIMM_CHRVO RecName: Full=Ribosome maturation factor rimM
 gi|34104980|gb|AAQ61336.1| 16S rRNA processing protein [Chromobacterium violaceum ATCC 12472]
          Length = 169

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 74/161 (45%), Gaps = 6/161 (3%)

Query: 7   LVLMATIGTTHGLNGEVYIDS---YANNPIDLNRYVLYSNDNRELRILK-MYRKNKRFIA 62
           LV+M  +    G+ G V I +   YA+   D   + L  N + +    +    + K   A
Sbjct: 6   LVVMGFVRGAFGIKGWVKIHADTEYADGLFDYPTWWLGKNGSWKPYAFENGAVQPKALAA 65

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
              G+D+  +A  LR  ++   R +    E  + E++  DL  +   ++QG+  G+V  +
Sbjct: 66  KLEGVDDRDAAEALRGTQIAIPRSELP--EAGDGEYYWADLIGLSVVNQQGETLGKVDSL 123

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
              GA  +L +K    +  LIPF    VLEV   E +IL+D
Sbjct: 124 LETGANDVLVVKGGDGQQRLIPFVDQYVLEVVPAEGRILVD 164


>gi|146329006|ref|YP_001209896.1| 16S rRNA processing protein RimM [Dichelobacter nodosus VCS1703A]
 gi|166985943|sp|A5EXZ2|RIMM_DICNV RecName: Full=Ribosome maturation factor rimM
 gi|146232476|gb|ABQ13454.1| 16S rRNA processing protein RimM [Dichelobacter nodosus VCS1703A]
          Length = 175

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 69/143 (48%), Gaps = 7/143 (4%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRFIA 62
           L+ +  I   HG+ G V I S       +  Y ++     +  + L++L   R  K  IA
Sbjct: 7   LIALGRIIGVHGVRGWVKIHSECRPREAIFNYSVFQATRHHHAQTLKLLDARRSGKSLIA 66

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F+ I +  +A +L    L   R D    +L+  +++ TD+  +   +R G++ G+VC +
Sbjct: 67  LFADICDRDAALQLNGFTLNVTRADLP--QLKNGQYYWTDVLGLTVINRSGEHLGKVCDI 124

Query: 123 YNFGAGSILEIKNTMEKTFLIPF 145
           +  GA  +L I N   + +LIPF
Sbjct: 125 FETGANDVLVI-NKDGQEYLIPF 146


>gi|117928766|ref|YP_873317.1| 16S rRNA processing protein RimM [Acidothermus cellulolyticus 11B]
 gi|171460818|sp|A0LV71|RIMM_ACIC1 RecName: Full=Ribosome maturation factor rimM
 gi|117649229|gb|ABK53331.1| 16S rRNA processing protein RimM [Acidothermus cellulolyticus 11B]
          Length = 176

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/161 (24%), Positives = 77/161 (47%), Gaps = 7/161 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNRELRILKMYRKNKRFIAT 63
           V +  I   HG++GEV +    ++P    R+    VL ++    L + +    + R +  
Sbjct: 12  VAVGRITRAHGVHGEVGVQVRTDDPD--RRFAAGAVLTTDTGVTLTVQRTRWHSGRLLVR 69

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F+GID+  +A +LR   L+A+  D +    + +E+++  L  M      G+  G V  V 
Sbjct: 70  FAGIDDRTTAEDLRGRVLFAE-VDERVRPEDPEEYYDYQLIGMRVETVTGQEIGVVREVL 128

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           +     +L I+ + +    +PF    V EV++ + ++ IDP
Sbjct: 129 HLPGQDVLAIERSADGDAFVPFVAALVPEVDVDQRRLRIDP 169


>gi|255281045|ref|ZP_05345600.1| 16S rRNA processing protein RimM [Bryantella formatexigens DSM
           14469]
 gi|255268493|gb|EET61698.1| 16S rRNA processing protein RimM [Bryantella formatexigens DSM
           14469]
          Length = 168

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 75/163 (46%), Gaps = 6/163 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR----YVLYSNDNRELRILKMYRKNKR 59
           +++ + +  + +THG+ GEV +    ++     +    +    + N  L I ++      
Sbjct: 1   MEQYLQVGVVSSTHGIRGEVKVYPTTDDAARFKKLKEVFAETKHGNVPLAIEQVKFFKNM 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F GIDNI+   + R   L   R++    +L   E+F  DL  +      G+  G +
Sbjct: 61  VILKFKGIDNINDVEKYRGCPLLVTREN--AVKLAPGEYFLCDLIGLSVSTDTGEELGTL 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
             V   GA  +  +K   EK  LIP TK  ++EV+L++N + +
Sbjct: 119 TEVIRTGANDVYVVKTKNEKEVLIPNTKECIIEVSLEKNTMTV 161


>gi|114798866|ref|YP_758775.1| 16S rRNA processing protein RimM [Hyphomonas neptunium ATCC 15444]
 gi|123323742|sp|Q0C668|RIMM_HYPNA RecName: Full=Ribosome maturation factor rimM
 gi|114739040|gb|ABI77165.1| 16S rRNA processing protein RimM [Hyphomonas neptunium ATCC 15444]
          Length = 181

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 75/163 (46%), Gaps = 5/163 (3%)

Query: 3   KLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIA 62
           K  +L+ M  +   HG+ GEV + S+  +P  L  Y    ++  ++ +  +  +  +   
Sbjct: 6   KTQRLIPMGVLKGAHGVRGEVRVKSFTADPDALFTYGPLMDEAGKVLLTPITARPGKDHF 65

Query: 63  TFSGIDNIHSAS--ELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
                +N+       LR   L+A R      E +EDEF+  DL  M  +    +   +V 
Sbjct: 66  IVRPKENLQKEDWDALRGCLLHASRDQLP--EADEDEFYFEDLIGMPVYTVGEEPEARVR 123

Query: 121 GVYNFGAGSILEIK-NTMEKTFLIPFTKFAVLEVNLQENKILI 162
            V NFG+G +LEI+      T  +P T+  V  +++  ++I+I
Sbjct: 124 AVQNFGSGDLLEIEIPGAPATIYVPLTRADVPVIDMAAHRIVI 166


>gi|302865889|ref|YP_003834526.1| 16S rRNA processing protein RimM [Micromonospora aurantiaca ATCC
           27029]
 gi|302568748|gb|ADL44950.1| 16S rRNA processing protein RimM [Micromonospora aurantiaca ATCC
           27029]
          Length = 179

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 72/171 (42%), Gaps = 15/171 (8%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNP---------IDLNRYVLYSNDN-----RELRILK 52
           L+++  IG  HG+ GEV ++   + P         +     V+ S          L +  
Sbjct: 2   LLVVGRIGKPHGIRGEVTVEVRTDEPEARFAPGSVLTTEPGVVPSEPGAWRVPPTLTVES 61

Query: 53  MYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQ 112
                 R +  F G+     A  LR+  L     D    E + +EF +  L  +    R 
Sbjct: 62  ARWHQGRLLVAFEGVLERDVAEALRNTLLGVDSADVAPPE-DPEEFHDHQLVGLTVVTRD 120

Query: 113 GKYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
           G++ G+V  + +  A  +L ++    +T L+PF K  V EV+L   ++++D
Sbjct: 121 GEHVGEVARIDHAPASEMLVLRRPEGRTALVPFVKAIVPEVDLAGGRVVVD 171


>gi|325263006|ref|ZP_08129742.1| 16S rRNA processing protein RimM [Clostridium sp. D5]
 gi|324032100|gb|EGB93379.1| 16S rRNA processing protein RimM [Clostridium sp. D5]
          Length = 168

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 81/161 (50%), Gaps = 11/161 (6%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPI---DLNRYVLYSNDNR---ELRILKMYRKN 57
           +++ + +  I +THG+ GEV +    ++      L + +L +       E++ +K +++ 
Sbjct: 1   MEQFLQVGVISSTHGIRGEVKVFPTTDDAARFKSLKQVILDTGKEHIPMEIQGVKFFKQ- 59

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              I  F GIDNI+   + +  +L   R+D     LEEDE++  DL  M+ +  +G++ G
Sbjct: 60  -FVIVKFKGIDNINDVEKYKGKRLLVDREDAVS--LEEDEYYIADLIGMKVYTEEGEF-G 115

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQEN 158
            +  V   GA  +  +++      LIP     +L+VN++E 
Sbjct: 116 MLKDVIETGANEVYVVESPDHGEVLIPAIHDCILDVNVEEQ 156


>gi|225568164|ref|ZP_03777189.1| hypothetical protein CLOHYLEM_04238 [Clostridium hylemonae DSM
           15053]
 gi|225162883|gb|EEG75502.1| hypothetical protein CLOHYLEM_04238 [Clostridium hylemonae DSM
           15053]
          Length = 168

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 76/163 (46%), Gaps = 6/163 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPID---LNRYVL-YSNDNRELRILKMYRKNKR 59
           ++K++ +  I +THG+ GEV +    ++P     L + +L    D  +L I  +    + 
Sbjct: 1   MEKMLKVGVITSTHGIRGEVKVFPTTDDPGRFKVLKQVILDTGKDTLQLEIENVKFFKQF 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F GIDNI+     +   L  +RQD     LE+ E+F  D+  M+     G+ +G +
Sbjct: 61  VILKFKGIDNINDVERYKRCALLVERQDAV--PLEDGEYFVADMLGMKVQTEDGELFGTL 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
             V   GA  +  I +      L+P  +  +  +++++  + I
Sbjct: 119 ADVMETGANDVYVIASPAHGEVLVPAIRECIQNIDIEQGMMTI 161


>gi|148380404|ref|YP_001254945.1| 16S rRNA processing protein RimM [Clostridium botulinum A str. ATCC
           3502]
 gi|168180673|ref|ZP_02615337.1| 16S rRNA processing protein RimM [Clostridium botulinum NCTC 2916]
 gi|226949799|ref|YP_002804890.1| 16S rRNA processing protein RimM [Clostridium botulinum A2 str.
           Kyoto]
 gi|209573571|sp|A5I4M4|RIMM_CLOBH RecName: Full=Ribosome maturation factor rimM
 gi|148289888|emb|CAL83996.1| putative 16S rRNA processing protein RimM [Clostridium botulinum A
           str. ATCC 3502]
 gi|182668387|gb|EDT80366.1| 16S rRNA processing protein RimM [Clostridium botulinum NCTC 2916]
 gi|226843072|gb|ACO85738.1| 16S rRNA processing protein RimM [Clostridium botulinum A2 str.
           Kyoto]
          Length = 164

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 74/165 (44%), Gaps = 10/165 (6%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSN---DNRELRILKMYRKNKRF 60
           + + + +  I  THG+ GEV +    +   D+ R+        D  E +IL    +    
Sbjct: 1   MKEFLAVGEIINTHGIKGEVKVYPLTD---DMKRFKKLKEVFIDGEERKILSCKLQPNNV 57

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +    GID+I  A++ R   L  KR++    +L +  +F  DL E    D  G+  GQ+ 
Sbjct: 58  VLKIEGIDSIEEANKYRKKLLEIKREN--SVKLPKGSYFIADLIECRVIDEDGREIGQIS 115

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPI 165
            V   G+  + E+K   E   L+P  K  V  ++++   + I P+
Sbjct: 116 DVIKTGSNDVYEVKGKSE--VLVPAIKDIVTNIDIENKTVTIKPL 158


>gi|315502433|ref|YP_004081320.1| 16S rRNA processing protein rimm [Micromonospora sp. L5]
 gi|315409052|gb|ADU07169.1| 16S rRNA processing protein RimM [Micromonospora sp. L5]
          Length = 179

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 72/171 (42%), Gaps = 15/171 (8%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNP---------IDLNRYVLYSNDN-----RELRILK 52
           L+++  IG  HG+ GEV ++   + P         +     V+ S          L +  
Sbjct: 2   LLVVGRIGKPHGIRGEVTVEVRTDEPEARFAPGSVLTTEPGVVPSEPGAWRVPPTLTVES 61

Query: 53  MYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQ 112
                 R +  F G+     A  LR+  L     D    E + +EF +  L  +    R 
Sbjct: 62  ARWHQGRLLVAFEGVLERDVAEALRNTLLGVDSADVAPPE-DPEEFHDHQLVGLTVVTRD 120

Query: 113 GKYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
           G++ G+V  + +  A  +L ++    +T L+PF K  V EV+L   ++++D
Sbjct: 121 GEHVGEVARIDHAPASDMLVLRRPEGRTALVPFVKAIVPEVDLAGGRVVVD 171


>gi|107103259|ref|ZP_01367177.1| hypothetical protein PaerPA_01004328 [Pseudomonas aeruginosa PACS2]
 gi|116051742|ref|YP_789419.1| 16S rRNA-processing protein RimM [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|218889978|ref|YP_002438842.1| 16S rRNA-processing protein RimM [Pseudomonas aeruginosa LESB58]
 gi|254236653|ref|ZP_04929976.1| 16S rRNA processing protein [Pseudomonas aeruginosa C3719]
 gi|254242435|ref|ZP_04935757.1| 16S rRNA processing protein [Pseudomonas aeruginosa 2192]
 gi|296387747|ref|ZP_06877222.1| 16S rRNA-processing protein RimM [Pseudomonas aeruginosa PAb1]
 gi|313109151|ref|ZP_07795122.1| 16S rRNA processing protein [Pseudomonas aeruginosa 39016]
 gi|122260885|sp|Q02RL7|RIMM_PSEAB RecName: Full=Ribosome maturation factor rimM
 gi|226734091|sp|B7UYK7|RIMM_PSEA8 RecName: Full=Ribosome maturation factor rimM
 gi|115586963|gb|ABJ12978.1| 16S rRNA processing protein RimM [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126168584|gb|EAZ54095.1| 16S rRNA processing protein [Pseudomonas aeruginosa C3719]
 gi|126195813|gb|EAZ59876.1| 16S rRNA processing protein [Pseudomonas aeruginosa 2192]
 gi|218770201|emb|CAW25963.1| 16S rRNA processing protein [Pseudomonas aeruginosa LESB58]
 gi|310881624|gb|EFQ40218.1| 16S rRNA processing protein [Pseudomonas aeruginosa 39016]
          Length = 175

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/167 (23%), Positives = 79/167 (47%), Gaps = 10/167 (5%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYAN---NPIDLNRYVLYSNDN-RELRILKMYRKNKRF 60
           D LV++  I + +G+ GEV + S+ +   N +D  R+ L  +   R+  +++     K  
Sbjct: 6   DDLVVIGKIVSVYGIRGEVKVYSFTDPLDNLLDYRRWTLRRDGEIRQAELVRGRLHGKVL 65

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
            A   G+D+   A      ++   R +     LEE E++   LE ++  D+ G+  G + 
Sbjct: 66  AAKLKGLDDREEARTFTGYEICIPRSELP--SLEEGEYYWHQLEGLKVIDQGGQLLGVID 123

Query: 121 GVYNFGAGSILEIKNTM----EKTFLIPFTKFAVLEVNLQENKILID 163
            +   GA  ++ +K       ++  L+P+T   VL ++L   ++ +D
Sbjct: 124 HLLETGANDVMVVKPCAGSLDDRERLLPYTGQCVLSIDLAAGEMRVD 170


>gi|209573737|sp|A1AN01|RIMM_PELPD RecName: Full=Ribosome maturation factor rimM
          Length = 173

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/175 (24%), Positives = 82/175 (46%), Gaps = 8/175 (4%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDL---NRYVLYSNDNRELRI--LKMYR 55
           M+  + L+ +  +  THG+ G + + SY+ +   L   +  +L S D    R     +  
Sbjct: 1   MIDSESLIPVGKLVATHGIRGMLKLHSYSGSVESLCTCDSVILRSRDGALNRFEPKPVLP 60

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
           +  +F+  F G+D+I  A  L   ++  +R      E EEDE++  DL  +E    +G  
Sbjct: 61  RPGKFLIGFKGVDHIDQAQTLVGSEICLRRDQLP--EPEEDEYYWCDLIGLEVATVEGMA 118

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
            G +  ++  G+  I  ++    + +LIP     +  V+L+  ++LI P+   L+
Sbjct: 119 LGVLEEIFKAGSSDIYVVRGA-GREYLIPAIADVIHSVDLEMGRMLITPLEGLLD 172


>gi|330504638|ref|YP_004381507.1| 16S rRNA-processing protein RimM [Pseudomonas mendocina NK-01]
 gi|328918924|gb|AEB59755.1| 16S rRNA-processing protein RimM [Pseudomonas mendocina NK-01]
          Length = 178

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 80/165 (48%), Gaps = 10/165 (6%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYAN---NPIDLNRYVLYSN-DNRELRILKMYRKNKRFIA 62
           L+++  I + HG+ GEV + S+ +   N +D   + L  + + +++ +     + K  + 
Sbjct: 11  LIVLGKIVSVHGVRGEVKVYSFTDPIDNVLDYQNWTLKRDGEVKKVELASGRLQGKVLVV 70

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
              G+D+   A      ++   R +  D  LEE EF+   L+ ++  D+ G+  G V  +
Sbjct: 71  KLKGLDDREIARTYAGFEICVPRSELPD--LEEGEFYWYQLQGLKVIDQAGQLLGVVDHL 128

Query: 123 YNFGAGSILEIKNTM----EKTFLIPFTKFAVLEVNLQENKILID 163
           +  GA  ++ +K       ++  L+P+T   VL ++L   ++ +D
Sbjct: 129 FETGANDVMVVKACAGSLDDRERLLPYTDQCVLSIDLAAGEMRVD 173


>gi|153930923|ref|YP_001384621.1| 16S rRNA-processing protein RimM [Clostridium botulinum A str. ATCC
           19397]
 gi|153935028|ref|YP_001388138.1| 16S rRNA-processing protein RimM [Clostridium botulinum A str.
           Hall]
 gi|166226434|sp|A7FW10|RIMM_CLOB1 RecName: Full=Ribosome maturation factor rimM
 gi|152926967|gb|ABS32467.1| 16S rRNA processing protein RimM [Clostridium botulinum A str. ATCC
           19397]
 gi|152930942|gb|ABS36441.1| 16S rRNA processing protein RimM [Clostridium botulinum A str.
           Hall]
          Length = 164

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 74/165 (44%), Gaps = 10/165 (6%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSN---DNRELRILKMYRKNKRF 60
           + + + +  I  THG+ GEV +    +   D+ R+        D  E +IL    +    
Sbjct: 1   MKEFLAVGEIINTHGIKGEVKVYPLTD---DMKRFKKLKEVFIDGEEKKILSCKLQPNNV 57

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +    GID+I  A++ R   L  KR++    +L +  +F  DL E    D  G+  GQ+ 
Sbjct: 58  VLKIEGIDSIEEANKYRKKLLEIKREN--SVKLPKGSYFIADLIECRVIDEDGREIGQIS 115

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPI 165
            V   G+  + E+K   E   L+P  K  V  ++++   + I P+
Sbjct: 116 DVIKTGSNDVYEVKGKSE--VLVPAIKDIVTNIDIENKTVTIKPL 158


>gi|119774027|ref|YP_926767.1| 16S rRNA-processing protein RimM [Shewanella amazonensis SB2B]
 gi|171704647|sp|A1S3Z1|RIMM_SHEAM RecName: Full=Ribosome maturation factor rimM
 gi|119766527|gb|ABL99097.1| 16S rRNA processing protein RimM [Shewanella amazonensis SB2B]
          Length = 176

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 81/167 (48%), Gaps = 14/167 (8%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRKNKRFIAT 63
           V++  IG+T+G+ G + I +Y ++   +  Y  +      + RE+++ +     K  +A 
Sbjct: 8   VVVGKIGSTYGVKGWMKITAYTDSVEGIFDYSPWFLKEHGEWREVKVSQWRFHGKAVVAE 67

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
             G+ N   A  L + ++    +     EL EDEF+  DL   E  + +G   G+V  + 
Sbjct: 68  LEGVSNREQAQMLTNCEIGILAEQMP--ELPEDEFYWRDLIGCEVLNTKGYNLGKVDQIL 125

Query: 124 NFGAGSILEIKNTMEKTF-----LIPFT--KFAVLEVNLQENKILID 163
             G+  +L +K   +  F     +IP+   +F VLEV L E +I++D
Sbjct: 126 ETGSNDVLMVKANAKDAFGKTERMIPYLPDQF-VLEVKLSEKQIIVD 171


>gi|224476353|ref|YP_002633959.1| 16S rRNA-processing protein RimM [Staphylococcus carnosus subsp.
           carnosus TM300]
 gi|222420960|emb|CAL27774.1| 16S rRNA processing protein [Staphylococcus carnosus subsp.
           carnosus TM300]
          Length = 158

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 79/160 (49%), Gaps = 9/160 (5%)

Query: 16  THGLNGEVYIDS---YANNPIDLNRYVLYSNDNRELRI-LKMYRKNKRF-IATFSGIDNI 70
           THG+ GEV + S   + +        +   +D +E  + +  YR +K F + TF GI NI
Sbjct: 3   THGIKGEVRVKSNSDFTDVRFQPGEILTVKHDGKETELTVASYRMHKGFHMLTFEGIHNI 62

Query: 71  HSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFGAGSI 130
           +     +   L  +R D  D EL+E EF+ +D+     F+      G+V  ++  GA  +
Sbjct: 63  NDIEHFKGDVLTQER-DHADIELDEHEFYYSDIIGCTVFEGDTPI-GRVKEIFETGANDV 120

Query: 131 LEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
             +K   +K ++IP+    V EV+++  +I I P+   L+
Sbjct: 121 WVVKG--DKEYMIPYIADVVKEVDVEGRRIQITPLEGMLD 158


>gi|119025225|ref|YP_909070.1| 16S rRNA-processing protein rimM [Bifidobacterium adolescentis ATCC
           15703]
 gi|154486607|ref|ZP_02028014.1| hypothetical protein BIFADO_00424 [Bifidobacterium adolescentis
           L2-32]
 gi|171473022|sp|A0ZZV5|RIMM_BIFAA RecName: Full=Ribosome maturation factor rimM
 gi|118764809|dbj|BAF38988.1| probable 16S rRNA-processing protein rimM [Bifidobacterium
           adolescentis ATCC 15703]
 gi|154084470|gb|EDN83515.1| hypothetical protein BIFADO_00424 [Bifidobacterium adolescentis
           L2-32]
          Length = 195

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 80/181 (44%), Gaps = 25/181 (13%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNRELRILKMYRKNK-RF 60
           +L+ +  IG   GL GEV +  + + P    R+    VLY+ D  E  +++  R  K R+
Sbjct: 10  ELLRVCRIGRAQGLKGEVTVQIFTDEP--EYRFAPGAVLYTKDGEEEYVVESSRTFKNRW 67

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           I  F GID+  ++     + LY +  D  +E LE DE++  DL  +E    +G   G   
Sbjct: 68  IIKFEGIDDRDASEAANGVVLYGEADD-PEEMLEADEWYPKDLISLEARLAEGNTLGLAP 126

Query: 121 GVYNFGAGSILEIKN-----------------TMEKTFLIPFTKFAVLEVNLQENKILID 163
           G        ++E+                    +E + L+PF    V +++L+   + +D
Sbjct: 127 GTVVGKVVDVIEVAQWLLKIRLANPVKDADGVVVENSALVPFVDELVPDIDLEGGYLTLD 186

Query: 164 P 164
           P
Sbjct: 187 P 187


>gi|331081975|ref|ZP_08331103.1| ribosome maturation factor rimM [Lachnospiraceae bacterium
           6_1_63FAA]
 gi|330405570|gb|EGG85100.1| ribosome maturation factor rimM [Lachnospiraceae bacterium
           6_1_63FAA]
          Length = 168

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/163 (26%), Positives = 78/163 (47%), Gaps = 6/163 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNP--IDLNRYVLYSNDNR--ELRILKMYRKNKR 59
           ++ L+ +  I TTHG+ GEV +    ++    D  + VL        EL I ++    + 
Sbjct: 1   MEDLLQVGVITTTHGIRGEVKVFPTTDDAHRFDYLKSVLLDTGKELCELDIERVKYFKQY 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F  +D+I+     +   LY  R+ F    L+E+E++  DL  ME +   GK++G +
Sbjct: 61  VILKFKDVDDINDIEPYKGKSLYVTRE-FA-VPLKENEYYTADLIGMEVYLEDGKHFGTL 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
             V   GA  +  +     K  LIP  K  + EV+++  K+++
Sbjct: 119 MDVMETGANDVYVVHLEAGKEVLIPAIKDCIKEVDVENGKMVV 161


>gi|116873228|ref|YP_850009.1| 16S rRNA processing protein rimM [Listeria welshimeri serovar 6b
           str. SLCC5334]
 gi|123463935|sp|A0AJP8|RIMM_LISW6 RecName: Full=Ribosome maturation factor rimM
 gi|116742106|emb|CAK21230.1| 16S rRNA processing protein rimM [Listeria welshimeri serovar 6b
           str. SLCC5334]
          Length = 169

 Score = 55.8 bits (133), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 78/168 (46%), Gaps = 9/168 (5%)

Query: 10  MATIGTTHGLNGEVYIDSYANNP-----IDLNRYVLYSNDNR-ELRILKMYRKNKRF-IA 62
           +  I  THGL GE+ + +  + P     +    Y+   N  + E  I++ +RK+K F + 
Sbjct: 4   VGKIVNTHGLIGEIRVIATTDFPEERFQVGNTVYLFEKNSKKPEKLIIRSHRKHKNFDLL 63

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F G+  IH    +++  L  K     D  LEE+EF+  ++         G+  G++  +
Sbjct: 64  MFEGLTGIHQVERMKEGVLKIKETQQTD--LEENEFYFHEIIGCTVVTTDGEELGEIIEI 121

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
              GA  +  +K   +K  LIP+    V E+N  + KI I+ +   L+
Sbjct: 122 LTPGANDVWVVKGADKKEKLIPYIADVVKEINTNDKKITIEVMEGLLD 169


>gi|90961609|ref|YP_535525.1| 16S rRNA processing protein [Lactobacillus salivarius UCC118]
 gi|227890696|ref|ZP_04008501.1| 16S rRNA processing protein [Lactobacillus salivarius ATCC 11741]
 gi|301299256|ref|ZP_07205542.1| 16S rRNA processing protein RimM [Lactobacillus salivarius
           ACS-116-V-Col5a]
 gi|122449137|sp|Q1WU93|RIMM_LACS1 RecName: Full=Ribosome maturation factor rimM
 gi|90820803|gb|ABD99442.1| 16S rRNA processing protein [Lactobacillus salivarius UCC118]
 gi|227867634|gb|EEJ75055.1| 16S rRNA processing protein [Lactobacillus salivarius ATCC 11741]
 gi|300214423|gb|ADJ78839.1| Ribosome maturation factor rimM [Lactobacillus salivarius CECT
           5713]
 gi|300853100|gb|EFK80698.1| 16S rRNA processing protein RimM [Lactobacillus salivarius
           ACS-116-V-Col5a]
          Length = 168

 Score = 55.8 bits (133), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 82/161 (50%), Gaps = 11/161 (6%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNRELRI--LKMYRKNKRF-IA 62
           +  I  THG+ GE+ I S  + P D  R+    +LY  DN ++    +K +R +K+F + 
Sbjct: 6   VGKIVNTHGIKGELKIISKTDFPED--RFKPGNILYIRDNGKINSYEIKSHRTHKQFEMI 63

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
           TF G++NI+    L+   L    +  + E L +  +++  +  ++ F     Y G +  +
Sbjct: 64  TFKGLENINLVENLKGKILEISEE--QQENLSDGNYYHHQIIGLDVFSEDNNYIGVIKEI 121

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
            + GA  +  +K       L+P  K  + +++L++NK++I+
Sbjct: 122 MSPGANDVWVVKRKGSSDLLLPAIKDVIKKIDLEQNKVIIE 162


>gi|113866920|ref|YP_725409.1| 16S rRNA-processing protein RimM [Ralstonia eutropha H16]
 gi|123134305|sp|Q0KD80|RIMM_RALEH RecName: Full=Ribosome maturation factor rimM
 gi|113525696|emb|CAJ92041.1| RimM protein required for 16S rRNA processing [Ralstonia eutropha
           H16]
          Length = 222

 Score = 55.8 bits (133), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 79/177 (44%), Gaps = 22/177 (12%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDL---NRYVLYSNDNREL-------------RI 50
           LV +  IG  +G+ G + +  +A++   L    R+ L +     L             +I
Sbjct: 43  LVEVGYIGAAYGIRGWIKVLPHADDASALLHARRWWLLAPPQAGLVAADASRAQPVCVKI 102

Query: 51  LKMYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFD 110
            +    +   +A  SG+ + + A  L+  +++ +R DF   E  EDEF+  DL      +
Sbjct: 103 AQSREHSGTVVAQASGVADRNLAEALKGRRVWIRRADFPAPE--EDEFYWVDLIGCTVSN 160

Query: 111 RQGKYWGQVCGVYNFGAGSILEIKNTME----KTFLIPFTKFAVLEVNLQENKILID 163
            QG+  G+V G+ + GA  IL++   +        LIPF    +  V+    +I++D
Sbjct: 161 EQGELLGEVSGLIDNGAHQILQVACVLPDGKAGERLIPFVDAFLRSVDTAGKRIVVD 217


>gi|115465483|ref|NP_001056341.1| Os05g0566300 [Oryza sativa Japonica Group]
 gi|51854276|gb|AAU10657.1| unknown protein [Oryza sativa Japonica Group]
 gi|113579892|dbj|BAF18255.1| Os05g0566300 [Oryza sativa Japonica Group]
 gi|215704607|dbj|BAG94235.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 304

 Score = 55.8 bits (133), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 84/188 (44%), Gaps = 32/188 (17%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNP-----IDLNRYVLYSNDNR------ELRILKMYR 55
           LV++  +   HG+ G+V +    + P         R++      +      EL   + + 
Sbjct: 76  LVVVGYVSGAHGVRGDVLVSPRTDFPQLRFATPGKRWLRARAAGKQQVKEFELVRGRAHT 135

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDR-QGK 114
             K +I TF G+D++  A ++    +  K  D    ++EEDE ++ DL  M    +  GK
Sbjct: 136 GKKSWIVTFDGVDSVDEARQIVGSAILVKVGD--RPKMEEDEIYSLDLVGMRVIVKDTGK 193

Query: 115 YWGQVCGVYNFGAGSILEI-----KNTMEKT-------------FLIPFTKFAVLEVNLQ 156
             G V  V+NFGAG +L++     ++T+ +                IPF +  V +++++
Sbjct: 194 LVGTVGQVFNFGAGDLLQVMVGGTEDTVSQPNSENQGSTPSGEHVWIPFAEDIVPDIDME 253

Query: 157 ENKILIDP 164
             ++ I P
Sbjct: 254 SREMWITP 261


>gi|284802239|ref|YP_003414104.1| hypothetical protein LM5578_1995 [Listeria monocytogenes 08-5578]
 gi|284995381|ref|YP_003417149.1| hypothetical protein LM5923_1946 [Listeria monocytogenes 08-5923]
 gi|284057801|gb|ADB68742.1| hypothetical protein LM5578_1995 [Listeria monocytogenes 08-5578]
 gi|284060848|gb|ADB71787.1| hypothetical protein LM5923_1946 [Listeria monocytogenes 08-5923]
          Length = 169

 Score = 55.8 bits (133), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/168 (25%), Positives = 78/168 (46%), Gaps = 9/168 (5%)

Query: 10  MATIGTTHGLNGEVYIDSYANNP-----IDLNRYVLYSNDNR-ELRILKMYRKNKRF-IA 62
           +  I  THGL GE+ + +  + P     +    Y+   N  + E  I++ +RK+K F + 
Sbjct: 4   VGKIVNTHGLIGEIRVIATTDFPEERFQVGNTVYLFEKNSKKPEKLIIRSHRKHKNFDLL 63

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F G   IH    +++  L  K     +  LEE+EF+  ++         G+  G++  +
Sbjct: 64  MFEGFTGIHQVERMKEGVLKIKETQLTN--LEENEFYFHEIIGCTVVTTDGEELGEITEI 121

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
              GA  +  +K   +K  LIP+    V E+N+ + KI I+ +   L+
Sbjct: 122 LTPGANDVWVVKGADKKEKLIPYIADVVKEINIDDQKITIEVMEGLLD 169


>gi|146297157|ref|YP_001180928.1| 16S rRNA processing protein RimM [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|166226429|sp|A4XLF2|RIMM_CALS8 RecName: Full=Ribosome maturation factor rimM
 gi|145410733|gb|ABP67737.1| 16S rRNA processing protein RimM [Caldicellulosiruptor
           saccharolyticus DSM 8903]
          Length = 169

 Score = 55.8 bits (133), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 86/169 (50%), Gaps = 6/169 (3%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNP---IDLNRYVLYSNDNRELRILKMYRKNKRFIA 62
           K + +  I  T GL GEV +    ++P    +LN  +L  N +++L I +   K+   I 
Sbjct: 3   KYLQVGKIVNTFGLKGEVKVIPLTDSPDRFSELNYVLLEDNLSQKLTIERYRVKDNIVIM 62

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F  I +I  A +L++  L  +R+  + ++L ED +F  D+  +E +D  G+  G+V  V
Sbjct: 63  KFREISSIDEALKLKNRFLVIERE--RAKKLPEDTYFICDIIGLEVYDLDGRKLGKVKDV 120

Query: 123 YNFGAGSILEIKNTM-EKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
              G+  +   ++ + +K  LIP  K  V EVN+++  + I  I   L+
Sbjct: 121 LQTGSNDVYICQSYIGKKDLLIPALKDIVKEVNIEQGYMKIKVIEGLLD 169


>gi|330894532|gb|EGH27193.1| 16S rRNA-processing protein RimM [Pseudomonas syringae pv. mori
           str. 301020]
          Length = 179

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 85/168 (50%), Gaps = 11/168 (6%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYAN---NPIDLNRYVLYSNDN--RELRILKMYRKNKR 59
           D L+++  I + HG+ GEV + S+ +   N +D   + L    +  ++L ++    ++K 
Sbjct: 9   DDLIVIGKIYSVHGVRGEVKVFSFTDPIGNLLDYKTWTLRREGSVEKQLELVSGRLQSKF 68

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +A   G+D+   A  L   ++   R  F D  L++ E++   LE ++  D+ G+  G++
Sbjct: 69  LVAKLKGLDDREEARLLSGYEICVPRNLFPD--LDDGEYYWYQLEGLKVIDQLGQLLGKI 126

Query: 120 CGVYNFGAGSILEIKNTM----EKTFLIPFTKFAVLEVNLQENKILID 163
             +   G+  ++ +K       ++  L+P+T+  VL +++   ++ +D
Sbjct: 127 DHLLETGSNDVMVVKPCAGSLDDRERLLPYTEQCVLAIDMAAGEMKVD 174


>gi|307264847|ref|ZP_07546409.1| 16S rRNA processing protein RimM [Thermoanaerobacter wiegelii
           Rt8.B1]
 gi|306920105|gb|EFN50317.1| 16S rRNA processing protein RimM [Thermoanaerobacter wiegelii
           Rt8.B1]
          Length = 167

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 78/165 (47%), Gaps = 9/165 (5%)

Query: 10  MATIGTTHGLNGEVYIDSYANNP---IDLNRYVLYSNDNRELRILKMYRK--NKRFIATF 64
           +  + + HG+ GEV +    N P    DL    ++ +  R  +    Y K  +K      
Sbjct: 7   VGKVTSAHGIKGEVKVYPLTNVPERFYDLEYVWIFDDQQRLHKYDIEYVKIISKGVCVKL 66

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
            GID    A +L+   L    Q+    ELEE+E+F  DL  M+ +  +G + G +  V  
Sbjct: 67  KGIDTRGDAEKLKGAFLKVDSQNAL--ELEENEYFIKDLVGMKVYTEEGSFLGTLVEVLK 124

Query: 125 FGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
            GA  +  IK T E+  LIP  K  V +V++ +NK+++  +  GL
Sbjct: 125 TGANDVYVIK-TEEREILIPAIKEVVKKVDV-DNKVMVVHLLEGL 167


>gi|190573385|ref|YP_001971230.1| 16S rRNA-processing protein RimM [Stenotrophomonas maltophilia
           K279a]
 gi|229890156|sp|B2FUB4|RIMM_STRMK RecName: Full=Ribosome maturation factor rimM
 gi|190011307|emb|CAQ44920.1| putative 16S rRNA-processing protein RimM [Stenotrophomonas
           maltophilia K279a]
          Length = 170

 Score = 55.5 bits (132), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 37/169 (21%), Positives = 82/169 (48%), Gaps = 10/169 (5%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY---VLYSNDNRELRI--LKMYR 55
           M  +++ +L+  +    G+ GE+ ++S+      + RY   ++ S    E  I  ++   
Sbjct: 1   MKDIERRILLGRVVGAFGVRGEIKLESWTEPRSAIFRYQPWIVRSPSGVETTIEGVRGRD 60

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
             K  +A F G+++  +   +R  ++Y  R      +   DE++  DLE ++    +G  
Sbjct: 61  SGKHLVARFPGVEDRDTVEAMRGTEIYVARSALPPPK--PDEYYWVDLEGLDVKTTEGVA 118

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFA-VLEVNLQENKILID 163
            GQV  +++ GA  ++ ++   E+  +IPF +   V  V+ + N +++D
Sbjct: 119 LGQVSHLFSTGANDVVVVRGDRER--MIPFVQPDFVKSVDFEANLVVVD 165


>gi|218782475|ref|YP_002433793.1| 16S rRNA processing protein RimM [Desulfatibacillum alkenivorans
           AK-01]
 gi|218763859|gb|ACL06325.1| 16S rRNA processing protein RimM [Desulfatibacillum alkenivorans
           AK-01]
          Length = 169

 Score = 55.5 bits (132), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 75/162 (46%), Gaps = 10/162 (6%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDL----NRYVLYS-NDNRELRILKMYRKNK-RFI 61
           V +  +   HG+ G V + S+A+NP D+     + +L    +N +  IL+  R  K + +
Sbjct: 7   VEVGQVAGVHGIRGAVLLRSFADNP-DIFAKGGKLLLKGPGENIQEYILESSRPYKGKLL 65

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
           A   G+ +   A  L+   +   R      ELE DE++  DL  ME     G   G +  
Sbjct: 66  AELQGVSDRSGAEALKGRMILVHRDALP--ELEPDEYYWFDLIGMEVAAPDGSRLGVLDA 123

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
           +   GA  +  IK+  EK  L P   + VL ++L+   +++D
Sbjct: 124 IIETGANDVYVIKDG-EKEILAPALPWVVLSIDLEAGVMIVD 164


>gi|313637368|gb|EFS02847.1| 16S rRNA processing protein RimM [Listeria seeligeri FSL S4-171]
          Length = 172

 Score = 55.5 bits (132), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 85/174 (48%), Gaps = 9/174 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDS---YANNPIDL-NRYVLYSNDNR--ELRILKMYRKN 57
           ++K+  +  I  THGL GE+ + +   +A+    + N   L+  +++  E  I++ +RK+
Sbjct: 1   MEKMYNVGKIVNTHGLIGEIRVIATTDFADERFQVGNTVXLFEKNSKKPEKLIIRSHRKH 60

Query: 58  KRF-IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           K F +  F G   IH    +++  L    +   D  LEE+E++  ++         G+  
Sbjct: 61  KNFDLLMFEGFTGIHQVERMKEGTLKITEKQLTD--LEENEYYFHEIIGCTVVTTDGEEL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           G++  +   GA  +  +K    K  LIP+ +  V E+N+ + KI I+ +   L+
Sbjct: 119 GEITEILTPGANDVWVVKGKDNKEKLIPYIEEVVKEINISDKKITIEVMEGLLD 172


>gi|293400510|ref|ZP_06644655.1| 16S rRNA processing protein RimM [Erysipelotrichaceae bacterium
           5_2_54FAA]
 gi|291305536|gb|EFE46780.1| 16S rRNA processing protein RimM [Erysipelotrichaceae bacterium
           5_2_54FAA]
          Length = 167

 Score = 55.5 bits (132), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 75/159 (47%), Gaps = 10/159 (6%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDL----NRYVLYSNDNRELRILKMYRK--NKRFIAT 63
           +  +  THGL GEV +     + +D+     +++      + L +   Y K   +  I  
Sbjct: 6   IGILVNTHGLRGEVKVKP-TTDFVDIRFAKGKHIHIQYQQQLLDVCVEYAKWAKQLLIVK 64

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F+G D+I+     +   L    +      LEEDE +  +L++ +  D +G+Y G V  V 
Sbjct: 65  FAGYDDINQVEAWKGSLLSISEEQL--HALEEDEAYFFELQDCQVLDEEGRYLGDVIEVL 122

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
              A +IL ++N  E+ FL+P+ K  V +   +E  I+I
Sbjct: 123 ETNANAILRVRNE-EREFLVPYVKAFVQDFKREEKCIVI 160


>gi|226365998|ref|YP_002783781.1| 16S rRNA-processing protein RimM [Rhodococcus opacus B4]
 gi|254797760|sp|C1B2R9|RIMM_RHOOB RecName: Full=Ribosome maturation factor rimM
 gi|226244488|dbj|BAH54836.1| putative 16S rRNA processing protein RimM [Rhodococcus opacus B4]
          Length = 183

 Score = 55.5 bits (132), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 39/168 (23%), Positives = 75/168 (44%), Gaps = 14/168 (8%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNRE-----LRILKMYRKNK 58
           +++  +  +HG+ GE+ ++   + P D  R+    VL  +  RE      R+      + 
Sbjct: 3   LVVGRVAKSHGIKGEIVVEVRTDEPED--RFAVGAVLRGHKPREQTVNTYRVEAAREHSG 60

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
           R +    G+ +  +A  LR         +    + + DEF++ +LE +      G   G 
Sbjct: 61  RLLLRLEGVPDRTAADALRGTLFVIDSAELVPSD-DPDEFYDHELEGLSVRLADGTELGA 119

Query: 119 VCGVYNFGAGSILEIKNTMEKT--FLIPFTKFAVLEVNLQENKILIDP 164
           V  V +  AG +L I+   E++   L+PF    V  V++ +  ++IDP
Sbjct: 120 VIEVLHSAAGELLSIRRAGEQSGELLVPFVAAIVTSVSVADGVVVIDP 167


>gi|323484789|ref|ZP_08090146.1| hypothetical protein HMPREF9474_01897 [Clostridium symbiosum
           WAL-14163]
 gi|323691862|ref|ZP_08106116.1| 16S rRNA processing protein RimM [Clostridium symbiosum WAL-14673]
 gi|323401895|gb|EGA94236.1| hypothetical protein HMPREF9474_01897 [Clostridium symbiosum
           WAL-14163]
 gi|323504069|gb|EGB19877.1| 16S rRNA processing protein RimM [Clostridium symbiosum WAL-14673]
          Length = 170

 Score = 55.5 bits (132), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 76/166 (45%), Gaps = 12/166 (7%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY------VLYSNDNRELRILKMYRKN 57
           +++ + +  I +THG+ GEV +    +   D+NRY       L +   R L  L+  + +
Sbjct: 1   MEQFLRVGVISSTHGIKGEVKVFPTTD---DVNRYKDLKEVFLDTGKGRILMELEQVKFH 57

Query: 58  KRF-IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           K   I  F G DNI+     +   L   R+      L  DE F  DL  ++    +GK +
Sbjct: 58  KNMVIVKFKGYDNINDIEMYKGKDLLISRE--HAVSLAPDENFIIDLIGLKVVTDEGKDF 115

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
           G V  +   GA  +  I     K +L P  K  +L+VNL+E K+ +
Sbjct: 116 GTVKDILQTGANDVYVIDGNDGKEYLFPSIKECILDVNLEEGKVTV 161


>gi|293189834|ref|ZP_06608548.1| 16S rRNA processing protein RimM [Actinomyces odontolyticus F0309]
 gi|292821249|gb|EFF80194.1| 16S rRNA processing protein RimM [Actinomyces odontolyticus F0309]
          Length = 170

 Score = 55.5 bits (132), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 67/155 (43%), Gaps = 9/155 (5%)

Query: 11  ATIGTTHGLNGEVYIDSYANNP--IDLNRYVLYSNDNRELRILKMYRKNKRFIATFSGID 68
           A +G  HGL GEV +D  +++P  +     +  + D R L +  +     R +A+F    
Sbjct: 6   AIVGPAHGLRGEVIVDVRSDDPEVMAPGSRLDIAGDQRSLTVRTVRVHKDRVLASFEECV 65

Query: 69  NIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFGAG 128
               A  LR  +L        D   EED ++  +L+ ++     G   G V G+   G  
Sbjct: 66  TREDAEALRGARL------LVDAHPEEDAWYPHELKGLQARTPSGDVLGTVSGLTP-GVA 118

Query: 129 SILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
             L +  T   T ++PF    V  V+++   ++ID
Sbjct: 119 QDLLLVATDRGTVMVPFVTALVPTVDVEGGFVVID 153


>gi|268319237|ref|YP_003292893.1| 16S rRNA-processing protein rimM [Lactobacillus johnsonii FI9785]
 gi|262397612|emb|CAX66626.1| 16S rRNA-processing protein rimM [Lactobacillus johnsonii FI9785]
          Length = 173

 Score = 55.5 bits (132), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 80/159 (50%), Gaps = 8/159 (5%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDL----NRYVLYSNDNRELRILKMYRKNKRF-IATF 64
           +  I + HGL GEV +++  + P +     +R  + +N   E  I++  R++K+F +  F
Sbjct: 7   VGKILSPHGLKGEVKVNATTDFPEERLATGSRLFIKNNKQYEELIVENTRRHKQFYLVKF 66

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQ-GKYWGQVCGVY 123
             ID+I  A ++   +LY    D   +EL E  ++  D+     +D + G+  G +  + 
Sbjct: 67  EKIDDIDQAEKICSKELYVAETD--QQELPEGSYYFKDILNCPVYDAETGEKLGVLENIE 124

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
             GA  I EIK+   K+F IP  +  V +V+L   +I +
Sbjct: 125 TPGANDIWEIKSEKGKSFWIPNIESVVKKVDLANKRIEV 163


>gi|320527193|ref|ZP_08028379.1| 16S rRNA processing protein RimM [Solobacterium moorei F0204]
 gi|320132384|gb|EFW24928.1| 16S rRNA processing protein RimM [Solobacterium moorei F0204]
          Length = 169

 Score = 55.5 bits (132), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 47/170 (27%), Positives = 83/170 (48%), Gaps = 12/170 (7%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY-----VLYSNDNRELRI-LKMYRKNKRF- 60
           + +  I  THG+ GEV I+SY++   D  RY     V    D + L + +  YRK+K F 
Sbjct: 4   ICIGKIINTHGIKGEVKIESYSD--FDEERYTKSKQVYICVDEKYLPVTVASYRKHKGFP 61

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           + +F  + NI+   + +  ++Y    D K  +L++ E++  DL  +   D +G   G++ 
Sbjct: 62  LVSFVDLQNINFVEQYKGCEIYIDEADRK--QLKKGEYYRKDLVGLTVVDEEGITVGKII 119

Query: 121 GV-YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
            V    GA + L ++    K  LIP+    V  V+L++  + I  +   L
Sbjct: 120 SVEETLGAQNNLRLQLEDAKEVLIPYIPMIVKNVDLEKKVMTIHRMGGLL 169


>gi|238063307|ref|ZP_04608016.1| ribosome maturation factor rimM [Micromonospora sp. ATCC 39149]
 gi|237885118|gb|EEP73946.1| ribosome maturation factor rimM [Micromonospora sp. ATCC 39149]
          Length = 185

 Score = 55.1 bits (131), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 72/179 (40%), Gaps = 25/179 (13%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNR----------------- 46
           +++  IG  HG+ GEV ++   + P    R+    VL +                     
Sbjct: 3   LIVGRIGKPHGIRGEVTVEVRTDEP--EARFAPGSVLATEPGAVPPANPASGPGVPFRVP 60

Query: 47  -ELRILKMYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEE 105
            EL +        R +  F GI     A  LR   L     D    E + +EF +  L  
Sbjct: 61  AELTVESARWHQGRLLVVFDGILERDVAEALRGTLLGVDSADVAPPE-DPEEFHDHQLVG 119

Query: 106 METFDRQGKYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           +      G++ G+V  + +  A  +L ++    +T LIPF K  V EV+L   +I++DP
Sbjct: 120 LAVVTPAGEHLGEVVKIDHAPASDLLVLRRPEGRTALIPFVKAIVPEVDLAGGRIVVDP 178


>gi|167586558|ref|ZP_02378946.1| 16S rRNA-processing protein [Burkholderia ubonensis Bu]
          Length = 225

 Score = 55.1 bits (131), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 78/174 (44%), Gaps = 17/174 (9%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNP------IDLNRYVLYSNDNRE-LRILKMYRKN 57
           D  V +  +   +GL G V + ++A+        ++  R+ L     R  +RI +     
Sbjct: 49  DDAVEVGAVVDAYGLKGWVKVMTHADAGRGGDALLNACRWWLEKGAERHAVRITQAKTHG 108

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              +A  +G+ +  +A  LR  ++  +R+DF    L+ DEF+  DL  ++  + Q    G
Sbjct: 109 DTVVAHLAGLGDRDAALALRGFRVSVRREDFP--ALDADEFYWVDLIGLDVVNEQSVALG 166

Query: 118 QVCGVYNFGAGSILEIK--------NTMEKTFLIPFTKFAVLEVNLQENKILID 163
           +V G+ + GA SI+ I+               LIPF    V  V+    +I++D
Sbjct: 167 KVIGMIDNGAHSIMRIEYPATGKDGQPAPAERLIPFVGVYVKTVDQAARRIVVD 220


>gi|186682347|ref|YP_001865543.1| 16S rRNA-processing protein RimM [Nostoc punctiforme PCC 73102]
 gi|209573584|sp|B2J3X9|RIMM_NOSP7 RecName: Full=Ribosome maturation factor rimM
 gi|186464799|gb|ACC80600.1| 16S rRNA processing protein RimM [Nostoc punctiforme PCC 73102]
          Length = 235

 Score = 55.1 bits (131), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 84/177 (47%), Gaps = 19/177 (10%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNP----IDLNRYVLY--SNDNRELRILK-MYRK 56
           LD  + +  I +  GL+GE+ +   ++ P    +   R++L+    + + +++L   Y  
Sbjct: 53  LDNWLEIGKIVSPQGLSGELKVYPVSDFPERFEVPGKRWLLHLDGTEPQPIQLLTGRYIS 112

Query: 57  NKR-FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETF-DRQGK 114
           NK  ++   +G++N   A  LR  KL     D    +L EDE+   DL  +E F    G+
Sbjct: 113 NKNLYVIKLAGVENCDQAEALRGCKLMVPASD--RPQLAEDEYHVLDLIGLEVFMQASGE 170

Query: 115 YWGQVCGVYNFGAGSILEIK-------NTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
             G V  +   G   +LE+K       +  +KT LIPF +     V+L+ N+I I P
Sbjct: 171 LVGTVVDIIPAG-NDLLEVKLHPSFTTDKKQKTVLIPFVEAIAPVVDLKSNRIEITP 226


>gi|197119791|ref|YP_002140218.1| 16S rRNA processing protein RimM [Geobacter bemidjiensis Bem]
 gi|197089151|gb|ACH40422.1| 16S rRNA processing protein RimM [Geobacter bemidjiensis Bem]
          Length = 172

 Score = 55.1 bits (131), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 40/162 (24%), Positives = 75/162 (46%), Gaps = 8/162 (4%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY--VLYSNDNRELR---ILKMYRKNKRF 60
           K +L+  I  THG+ G++ +  +A +   +++   V   +    L    ++      KR 
Sbjct: 5   KKLLIGKIQGTHGIKGQLRVIPFAGDASSISQLNEVFVKSPTAALEPFAVVSAKAHGKRV 64

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           I T    DNI+    L   ++YA R      EL +DEF+ +DL  ++     G+  G++ 
Sbjct: 65  ILTLKPFDNINQVLHLVGREIYADRVSLP--ELPDDEFYWSDLLGLQVATSDGEELGELV 122

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
            +   G+  +  +K    +  LIP  +  VL +NL E ++ +
Sbjct: 123 DIIETGSNDVYVVKKGALEV-LIPALEDVVLSINLAEGRMTV 163


>gi|299536771|ref|ZP_07050079.1| 16S rRNA-processing protein [Lysinibacillus fusiformis ZC1]
 gi|298727783|gb|EFI68350.1| 16S rRNA-processing protein [Lysinibacillus fusiformis ZC1]
          Length = 171

 Score = 55.1 bits (131), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 80/160 (50%), Gaps = 8/160 (5%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDL----NRYVLYSNDNRE--LRILKMYRKNKRFIA- 62
           +  I  THG+ GEV + S  +   +     N+   +  D+++     ++  R++K FI  
Sbjct: 6   VGRIVNTHGIRGEVRVLSTTDFEEERFTVGNKLAAFKKDDKKPTWVTIESVRRHKNFILL 65

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
           TF G++NI+    L++  L   +    D+ LEE+EFF  ++        +G+  G V  +
Sbjct: 66  TFEGMNNINLVEPLKEGMLKVTKDQMSDDLLEENEFFFHEIIGCTVISEEGETIGVVADI 125

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
              GA  +  +K T +K   IP+ +  V ++++ + KI+I
Sbjct: 126 LQTGANDVWVVKGT-KKEHYIPYIEDIVKDIDVMDKKIVI 164


>gi|94309694|ref|YP_582904.1| 16S rRNA-processing protein RimM [Cupriavidus metallidurans CH34]
 gi|209573590|sp|Q1LQE1|RIMM_RALME RecName: Full=Ribosome maturation factor rimM
 gi|93353546|gb|ABF07635.1| 16S rRNA processing protein [Cupriavidus metallidurans CH34]
          Length = 220

 Score = 55.1 bits (131), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 79/179 (44%), Gaps = 22/179 (12%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDL---NRYVLY-------------SNDNREL 48
           D LV +  +G  +G+ G + +  +A++   L    R+ L              S +   +
Sbjct: 39  DDLVEVGYVGAAYGIRGWIKVQPHADDASALLHARRWWLLRAPPAGVVSAPAQSAEAVSI 98

Query: 49  RILKMYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMET 108
           +I +    +   +A  +G+ +   A  L+  +++ +R DF     EE EF+  DL     
Sbjct: 99  KISQSREHSGTVVAQPAGVSDRSVAEMLKGRRVWVRRADFP--AAEEGEFYWVDLIGCAV 156

Query: 109 FDRQGKYWGQVCGVYNFGAGSIL----EIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
            + QG+  G+V G+ + GA  IL    E+ +      LIPF    +  V+    +I++D
Sbjct: 157 VNEQGEALGEVTGLIDNGAHQILQVAYELPDGKAAERLIPFVDAFLRTVDTPARRIVVD 215


>gi|322806711|emb|CBZ04280.1| 16s rRNAprocessing protein RimM [Clostridium botulinum H04402 065]
          Length = 164

 Score = 55.1 bits (131), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 73/165 (44%), Gaps = 10/165 (6%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSN---DNRELRILKMYRKNKRF 60
           + + + +  I  THG+ GEV +    +   D+ R+        D  E +IL    +    
Sbjct: 1   MKEFLAVGEIINTHGIKGEVKVYPLTD---DMKRFKKLKEVFIDGEERKILSCKLQPNNV 57

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +    GID+I  A++ R   L  KR++    +L +  +F  DL E    D  G+  GQ+ 
Sbjct: 58  VLKIEGIDSIEEANKYRKKLLEIKREN--SVKLPKGSYFIADLIECRVIDEDGREIGQIS 115

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPI 165
            V   G   + E+K   E   L+P  K  V  ++++   + I P+
Sbjct: 116 DVIKTGNNDVYEVKGKSE--VLVPAIKDIVTNIDIESKTVTIKPL 158


>gi|239617837|ref|YP_002941159.1| 16S rRNA processing protein RimM [Kosmotoga olearia TBF 19.5.1]
 gi|259585646|sp|C5CEB5|RIMM_KOSOT RecName: Full=Ribosome maturation factor rimM
 gi|239506668|gb|ACR80155.1| 16S rRNA processing protein RimM [Kosmotoga olearia TBF 19.5.1]
          Length = 200

 Score = 55.1 bits (131), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 77/168 (45%), Gaps = 12/168 (7%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPI---DLNRYVLYSNDNREL---RILKMYRKN 57
           +D ++ +  +   HGL GEV + S  N       L + +LY      +    I  + R  
Sbjct: 9   IDSMIPVGKVVKPHGLRGEVKMKSLTNQLKVFETLKKVLLYDEKAGTVVRAEIDTIRRAG 68

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
           K +I  F G  ++ +A  +R   +YA         L+E E++   L + E +D +G+Y G
Sbjct: 69  KGYIVHFKGFKSVEAAERIRGFYVYAPLNVLP--PLKEGEYYFYQLLDCEVYDPEGEYIG 126

Query: 118 QVCGVYNFGAGSIL----EIKNTMEKTFLIPFTKFAVLEVNLQENKIL 161
           +V  +   GA  ++    E+ +   +  LIP  K  ++E   ++ KI+
Sbjct: 127 KVTDIIETGANDVIVVTKELPDFTVEEELIPVIKDYIVEFRFKDKKIV 174


>gi|114330464|ref|YP_746686.1| 16S rRNA processing protein RimM [Nitrosomonas eutropha C91]
 gi|122314522|sp|Q0AIV0|RIMM_NITEC RecName: Full=Ribosome maturation factor rimM
 gi|114307478|gb|ABI58721.1| 16S rRNA processing protein RimM [Nitrosomonas eutropha C91]
          Length = 168

 Score = 55.1 bits (131), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 78/165 (47%), Gaps = 10/165 (6%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY--SNDNRELRIL---KMYRKNKRFI 61
           +V++  +   HG+ G++ +  +  +   L  Y ++  SND +  +I+        +   I
Sbjct: 1   MVVLGRVIGPHGIRGQIKVTPFTEHIDGLMEYPVWWLSNDEKSWQIVHPTSFSVHDSLLI 60

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDE---FFNTDLEEMETFDRQGKYWGQ 118
            T     +  +AS L+   +   R      +L ED    ++ +DL  +   + QG++ G 
Sbjct: 61  ITLEEYSDRTNASGLKGWLIAVPRSQLP--QLSEDGKEGYYWSDLIGISVVNTQGEFIGT 118

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
           V G++  GA  +L I+    K  LIPF    V +V+++  +I++D
Sbjct: 119 VAGLFETGANDVLRIQLPGGKEELIPFVDQVVRQVDMRSRQIMVD 163


>gi|226305933|ref|YP_002765893.1| 16S rRNA processing protein RimM [Rhodococcus erythropolis PR4]
 gi|259585650|sp|C0ZXR9|RIMM_RHOE4 RecName: Full=Ribosome maturation factor rimM
 gi|226185050|dbj|BAH33154.1| probable 16S rRNA processing protein RimM [Rhodococcus erythropolis
           PR4]
          Length = 190

 Score = 55.1 bits (131), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 76/169 (44%), Gaps = 16/169 (9%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNRELRILKMYR------KN 57
           +++  +  +HG+ GE+ ++   + P D  R+    VL     RE   LK Y        +
Sbjct: 3   LVVGRVAKSHGIKGELVVEVRTDEPED--RFAVGSVLRGRKPRE-STLKSYTVEAARDHS 59

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
            R +    G+ +   A  LR         + +  + + DEF++ +LE ++     G   G
Sbjct: 60  GRLLLRLEGVSDRGDADALRGTLFVIDSSELEPSD-DPDEFYDHELEGLKVVLTDGTEVG 118

Query: 118 QVCGVYNFGAGSILEIKNTMEKT--FLIPFTKFAVLEVNLQENKILIDP 164
            V  V +  AG +L I+ T E +   LIPF    V  V++ +  ++I+P
Sbjct: 119 SVIEVLHSAAGELLSIRRTGETSGELLIPFVAAIVTSVSIADGVVMIEP 167


>gi|148265781|ref|YP_001232487.1| 16S rRNA processing protein RimM [Geobacter uraniireducens Rf4]
 gi|209573558|sp|A5G7Z6|RIMM_GEOUR RecName: Full=Ribosome maturation factor rimM
 gi|146399281|gb|ABQ27914.1| 16S rRNA processing protein RimM [Geobacter uraniireducens Rf4]
          Length = 173

 Score = 55.1 bits (131), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 71/152 (46%), Gaps = 8/152 (5%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLN--RYVLYSNDNRELRILKMYRK---NKRFIA 62
           VL+  +  THG+ G++ I  ++ +   L   R ++      E+ I  +       K+ I 
Sbjct: 8   VLIGKVSATHGVRGQLRITPFSGDVDSLLTLRSIMVKKPGGEMEIFAVAASKAHGKKVII 67

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
           T    DNI+    L   +LYA R+     EL EDE++  DL  ++    +G+  G++  +
Sbjct: 68  TLKAFDNINQVLHLVGRELYALREQLP--ELPEDEYYWCDLLGLQVVTEEGESLGELVDI 125

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVN 154
              G+  +  ++ +  +  LIP     VL+V+
Sbjct: 126 IVTGSNDVYVVQGS-GREILIPALADVVLDVD 156


>gi|268316591|ref|YP_003290310.1| 16S rRNA processing protein RimM [Rhodothermus marinus DSM 4252]
 gi|262334125|gb|ACY47922.1| 16S rRNA processing protein RimM [Rhodothermus marinus DSM 4252]
          Length = 179

 Score = 55.1 bits (131), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 79/178 (44%), Gaps = 11/178 (6%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR----YVLYSNDN-RELRILKM-YR 55
           V  D+L+LM  +   HG+ G   +    ++P         YV  S +  R +R+ ++ Y+
Sbjct: 4   VDPDELLLMGYVARAHGVRGAFKVVPETDDPTRFETLETIYVGRSPETARPVRLERVQYQ 63

Query: 56  KNKRFIATFSGIDNI---HSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQ 112
             +R +     +  +    +A  LR L++YA+R D     L E EFF  DL  +      
Sbjct: 64  PTRRGLIVLLQVAEVTDRDAAQALRGLRVYARRSDLPP--LAEGEFFLHDLIGLRVETEA 121

Query: 113 GKYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           G+  G V  V    A  I  +        ++P  +  V E++L+  +++I PI   L+
Sbjct: 122 GETVGTVIEVLEMPAHLIYVVGRPGRPHAMVPDVEVFVRELDLEGRRLVIRPIEGLLD 179


>gi|313632802|gb|EFR99758.1| 16S rRNA processing protein RimM [Listeria seeligeri FSL N1-067]
          Length = 172

 Score = 55.1 bits (131), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 85/174 (48%), Gaps = 9/174 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDS---YANNPIDL-NRYVLYSNDNR--ELRILKMYRKN 57
           ++K+  +  I  THGL GE+ + +   +A+    + N   L+  +++  E  I++ +RK+
Sbjct: 1   MEKMYNVGKIVNTHGLIGEIRVIATTDFADERFQVGNTVYLFEKNSKKPEKLIIRSHRKH 60

Query: 58  KRF-IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           K F +  F G   IH    +++  L    +   D  LEE+E++  ++         G+  
Sbjct: 61  KNFDLLMFEGFTGIHQVERMKEGTLKITEKQLTD--LEENEYYFHEIIGCTVVTTDGEEL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           G++  +   GA  +  +K    K  LIP+ +  V E+N+ + KI I+ +   L+
Sbjct: 119 GEITEILTPGANDVWVVKGKDNKEKLIPYIEEVVKEINISDKKITIEVMEGLLD 172


>gi|153938104|ref|YP_001391744.1| 16S rRNA-processing protein RimM [Clostridium botulinum F str.
           Langeland]
 gi|170756645|ref|YP_001781989.1| 16S rRNA-processing protein RimM [Clostridium botulinum B1 str.
           Okra]
 gi|166226435|sp|A7GG34|RIMM_CLOBL RecName: Full=Ribosome maturation factor rimM
 gi|152934000|gb|ABS39498.1| 16S rRNA processing protein RimM [Clostridium botulinum F str.
           Langeland]
 gi|169121857|gb|ACA45693.1| 16S rRNA processing protein RimM [Clostridium botulinum B1 str.
           Okra]
 gi|295319769|gb|ADG00147.1| 16S rRNA processing protein RimM [Clostridium botulinum F str.
           230613]
          Length = 164

 Score = 55.1 bits (131), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 76/167 (45%), Gaps = 14/167 (8%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-----VLYSNDNRELRILKMYRKNK 58
           + + + +  I  THG+ GEV +    +   D+ R+     V    + R++   K+   N 
Sbjct: 1   MKEFLAVGEIINTHGIKGEVKVYPLTD---DMKRFKKLKEVFIDGEGRKILSCKLQPNN- 56

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
             +    GID+I  A++ R   L  KR++    +L +  +F  DL E    D  G+  GQ
Sbjct: 57  -VVLKIEGIDSIEEANKYRKKLLEIKREN--SVKLPKGSYFIADLIECRVIDENGREIGQ 113

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPI 165
           +  V   G+  + E+K   E   L+P  K  V  ++++   + I P+
Sbjct: 114 ISDVIKTGSNDVYEVKGKSE--VLVPAIKDIVTNIDIENKTVTIKPL 158


>gi|300783879|ref|YP_003764170.1| 16S rRNA processing protein RimM [Amycolatopsis mediterranei U32]
 gi|299793393|gb|ADJ43768.1| 16S rRNA processing protein RimM [Amycolatopsis mediterranei U32]
          Length = 170

 Score = 55.1 bits (131), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 70/163 (42%), Gaps = 8/163 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNP---IDLNRYV---LYSNDNRELRILKMYRKNKRFI 61
           V++  I   HG+ GE+ +D   ++P     +   V   L     REL I      + R +
Sbjct: 3   VVVGRIAKAHGIRGELAVDVRTDSPEQRFKIGAAVTTKLRDGSKRELTIAAAREHSGRLL 62

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
             F  +     A  LR   L A        E + DEF++ +L  +      G   G+V  
Sbjct: 63  VRFEEVLTRDVAETLRGALLLADTATLPPTE-DPDEFYDHELAGLRAELTDGTVVGKVVE 121

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           + +  AG +LE+ +   +  L+PF    V  V++   ++++DP
Sbjct: 122 IVHSPAGELLEL-DVEGREVLVPFVHAIVPTVDIAGGRVVLDP 163


>gi|118469073|ref|YP_886777.1| 16S rRNA-processing protein RimM [Mycobacterium smegmatis str. MC2
           155]
 gi|166226453|sp|A0QV39|RIMM_MYCS2 RecName: Full=Ribosome maturation factor rimM
 gi|118170360|gb|ABK71256.1| 16S rRNA processing protein RimM [Mycobacterium smegmatis str. MC2
           155]
          Length = 173

 Score = 55.1 bits (131), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 40/156 (25%), Positives = 67/156 (42%), Gaps = 8/156 (5%)

Query: 16  THGLNGEVYIDSYANNP------IDLNRYVLYSNDNRELRILKMYRKNKRFIATFSGIDN 69
            HG++GEV ++   ++P        + R    S   RE  I  +     R +   +G+ +
Sbjct: 11  AHGISGEVVVEIRTDDPEARFAPGAVLRGRPRSGAEREYTIESVRAHGGRLLVRLAGVAD 70

Query: 70  IHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFGAGS 129
            + A ELR         +    + + DEF++ +LE M          G+V  V +   G 
Sbjct: 71  RNGADELRGTVFLVDTAELPAID-DPDEFYDHELEGMRVVTVDDAPVGKVAEVLHTAGGE 129

Query: 130 ILEIK-NTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           IL +K +   +  L+PF    V  V+ Q   I+IDP
Sbjct: 130 ILAVKADEGGREILVPFVGAIVTSVSRQNATIVIDP 165


>gi|170759832|ref|YP_001787758.1| 16S rRNA-processing protein RimM [Clostridium botulinum A3 str.
           Loch Maree]
 gi|169406821|gb|ACA55232.1| 16S rRNA processing protein RimM [Clostridium botulinum A3 str.
           Loch Maree]
          Length = 164

 Score = 54.7 bits (130), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 73/161 (45%), Gaps = 14/161 (8%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNRY-----VLYSNDNRELRILKMYRKNKRFIATF 64
           +  I  THG+ GEV +    +   D+ R+     VL   + R++   K+   N   +   
Sbjct: 7   VGEIINTHGIKGEVKVYPLTD---DMKRFKKLKEVLIDGEKRKILSCKLQPNN--VVLKI 61

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
            GID+I  A++ R   L  KR++    +L +  +F  DL      D  GK  GQ+  V  
Sbjct: 62  EGIDSIEEANKYRKKLLEIKREN--SVKLPKGSYFIADLIGCRVIDEDGKEIGQISDVIK 119

Query: 125 FGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPI 165
            G+  + E+K   E   L+P  K  V  ++++   + I P+
Sbjct: 120 TGSNDVYEVKGKSE--VLVPAIKDIVTNIDIENKTVTIKPL 158


>gi|325524025|gb|EGD02210.1| 16S rRNA-processing protein RimM [Burkholderia sp. TJI49]
          Length = 225

 Score = 54.7 bits (130), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 77/174 (44%), Gaps = 17/174 (9%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNP------IDLNRYVLYSNDNR-ELRILKMYRKN 57
           D  V +  +   +GL G + + ++A+        +   R+ L     R   RI++     
Sbjct: 49  DDAVEVGAVVDAYGLKGWLKVAAHADAGRGGDALLKARRWWLEKGAQRFSARIMQSKTHG 108

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              +A  +G+ +  +A  LR  +++ +R+DF    L  DEF+  DL  +E  + Q    G
Sbjct: 109 DTVVAQTAGVSDRDAALALRGFRVFVRREDFP--ALAADEFYWVDLIGLEVVNEQSVALG 166

Query: 118 QVCGVYNFGAGSILEIK--------NTMEKTFLIPFTKFAVLEVNLQENKILID 163
           +V G+ +  A SI+ ++          +    LIPF    V  V+    +I++D
Sbjct: 167 KVAGMIDNSAHSIMRVEYPAVGKDGRPVTAERLIPFVGVYVKTVDQAARRIVVD 220


>gi|329120757|ref|ZP_08249419.1| 16S rRNA processing protein RimM [Neisseria bacilliformis ATCC
           BAA-1200]
 gi|327460554|gb|EGF06890.1| 16S rRNA processing protein RimM [Neisseria bacilliformis ATCC
           BAA-1200]
          Length = 169

 Score = 54.7 bits (130), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 77/170 (45%), Gaps = 7/170 (4%)

Query: 1   MVKLDKLVLMATIGTTHGLNG--EVYIDS-YANNPIDLNRYVLYSNDNRELRILKMYRKN 57
           M +  + V M  I    G+ G  +V +D+ YA++ +D   + L  N      +L+  +  
Sbjct: 1   MAQETQWVAMGYIKGAFGIKGWVKVAVDTEYADSLLDYPEWRLSRNGKAVSVVLEAGKTA 60

Query: 58  KRFI-ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
              +   F GI +  +A  LR   +   R DF  EE EE E++  DL  M      G+  
Sbjct: 61  ADGLHVKFQGIGDRDAAQLLRGYTVEINRADF--EETEEGEYYWADLVGMTVITPAGETL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIA 166
           G V G+   GA  IL +++   +T LIPF    V EVN +   I  D  A
Sbjct: 119 GTVSGLMETGAHDILVVRHEGGET-LIPFVAQFVGEVNRETRTITADWAA 167


>gi|323141929|ref|ZP_08076789.1| 16S rRNA processing protein RimM [Phascolarctobacterium sp. YIT
           12067]
 gi|322413596|gb|EFY04455.1| 16S rRNA processing protein RimM [Phascolarctobacterium sp. YIT
           12067]
          Length = 167

 Score = 54.7 bits (130), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 73/157 (46%), Gaps = 3/157 (1%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFI-ATFSG 66
           +++  I   HG+ G++ I    + P            +     +K  R +KR +  T + 
Sbjct: 5   IVIGKIVAPHGVRGDIRILPLTDKPEQFLDLDYLLLPDGRKLTVKAARFHKRMVLVTTAE 64

Query: 67  IDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFG 126
           I +++ +  LR +++    +D    ELEE  F+  DL  +  +D QG+  G      + G
Sbjct: 65  IKSMNESELLRGMEVSINAEDLP--ELEEGRFYVADLIGLPVYDEQGEQIGTFKDALSTG 122

Query: 127 AGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
           +  +  I    +K +L+P  K  V E+NL E +I+++
Sbjct: 123 SNDVYVIAVPGQKDYLLPALKKYVKEINLAEKRIVVE 159


>gi|42519386|ref|NP_965316.1| 16S rRNA processing protein RimM [Lactobacillus johnsonii NCC 533]
 gi|227890251|ref|ZP_04008056.1| 16S rRNA processing protein [Lactobacillus johnsonii ATCC 33200]
 gi|59798804|sp|Q74IQ5|RIMM_LACJO RecName: Full=Ribosome maturation factor rimM
 gi|41583674|gb|AAS09282.1| 16S rRNA processing protein RimM [Lactobacillus johnsonii NCC 533]
 gi|227849065|gb|EEJ59151.1| 16S rRNA processing protein [Lactobacillus johnsonii ATCC 33200]
 gi|329667091|gb|AEB93039.1| 16S rRNA processing protein [Lactobacillus johnsonii DPC 6026]
          Length = 173

 Score = 54.7 bits (130), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 79/159 (49%), Gaps = 8/159 (5%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDL----NRYVLYSNDNRELRILKMYRKNKRF-IATF 64
           +  I + HGL GEV +++  + P +     +R  + +N   E  I++  R++K+F +  F
Sbjct: 7   VGKILSPHGLKGEVKVNATTDFPEERLATGSRLFIKNNKQYEELIVENTRRHKQFYLVKF 66

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQ-GKYWGQVCGVY 123
             ID+I  A ++   +LY    D   +EL E  ++  D+     +D + G+  G +  + 
Sbjct: 67  EKIDDIDQAEKICSKELYVAETD--QQELPEGSYYFKDILNCPVYDAETGEKLGVLENIE 124

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
             GA  I EIK    K+F IP  +  V +V+L   +I +
Sbjct: 125 TPGANDIWEIKPEKGKSFWIPNIESVVKKVDLANKRIEV 163


>gi|224419145|ref|ZP_03657151.1| 16S rRNA processing protein RimM [Helicobacter canadensis MIT
           98-5491]
 gi|253828080|ref|ZP_04870965.1| 16S rRNA processing protein RimM [Helicobacter canadensis MIT
           98-5491]
 gi|313142651|ref|ZP_07804844.1| 16S rRNA processing protein RimM [Helicobacter canadensis MIT
           98-5491]
 gi|253511486|gb|EES90145.1| 16S rRNA processing protein RimM [Helicobacter canadensis MIT
           98-5491]
 gi|313131682|gb|EFR49299.1| 16S rRNA processing protein RimM [Helicobacter canadensis MIT
           98-5491]
          Length = 183

 Score = 54.7 bits (130), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 75/164 (45%), Gaps = 13/164 (7%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIATFSGI 67
           V +A IG   G+ GEV +    + P  L     Y   N  L I    ++N R    F+ I
Sbjct: 12  VSVAKIGRAVGVKGEVLLHLLTDFPESLKIGNTYFTQNGTLTIQNYNKENSR--VKFTQI 69

Query: 68  DNIHSASELRDLKLYAKRQDFKDEE--LEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNF 125
           D+   A ++ +L LY   QDF  E   L++DEFF  D+   +  + + K  G+V  +   
Sbjct: 70  DSPEKAKQITNLILYT-TQDFTKEHCILQKDEFFWFDIIGSQIME-EDKILGEVSEIERL 127

Query: 126 GAGSILEIK-------NTMEKTFLIPFTKFAVLEVNLQENKILI 162
           G    L IK       N + K+FLIP+    +LEV    N  +I
Sbjct: 128 GEKDFLVIKTAKELCKNGLPKSFLIPYESRYILEVETNLNPKII 171


>gi|254519210|ref|ZP_05131266.1| ribosome maturation factor rimM [Clostridium sp. 7_2_43FAA]
 gi|226912959|gb|EEH98160.1| ribosome maturation factor rimM [Clostridium sp. 7_2_43FAA]
          Length = 165

 Score = 54.7 bits (130), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 71/160 (44%), Gaps = 4/160 (2%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIATFSG 66
           ++ +  I  THGL GEV + +  ++P   N       D  E +I     +  R I    G
Sbjct: 4   ILRVGKIVNTHGLKGEVKVIALTDDPKRYNDLDFVLIDGVERKIQGCKFQKDRVIVKIEG 63

Query: 67  IDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFG 126
           ID+I  A + ++  +   R+      LEED ++  D+     +D +GK  G+V  V    
Sbjct: 64  IDSIEEAEKYKNKYMEIPRE--YAVPLEEDTYYIADIIGCNVYDTEGKSLGEVYDVIQTK 121

Query: 127 AGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIA 166
              +  I+    K  LIP     V +++++  KI I P+ 
Sbjct: 122 NNDVYWIRKP--KELLIPVLLDIVTDIDVENRKITIKPVG 159


>gi|260588676|ref|ZP_05854589.1| 16S rRNA processing protein RimM [Blautia hansenii DSM 20583]
 gi|260541151|gb|EEX21720.1| 16S rRNA processing protein RimM [Blautia hansenii DSM 20583]
          Length = 168

 Score = 54.7 bits (130), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 44/163 (26%), Positives = 78/163 (47%), Gaps = 6/163 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNP--IDLNRYVLYSNDNR--ELRILKMYRKNKR 59
           ++ L+ +  I TTHG+ GEV +    ++    D  + VL        EL I ++    + 
Sbjct: 1   MEDLLQVGVITTTHGIRGEVKVFPTTDDAHRFDYLKSVLLDTGKELCELDIERVKYFKQY 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F  +D+I+     +   LY  R+ F    L+E+E++  DL  ME +   GK++G +
Sbjct: 61  VILKFKDVDDINDIEPYKGKSLYVTRE-FA-VPLKENEYYIADLIGMEVYLEDGKHFGTL 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
             V   GA  +  +     K  LIP  K  + EV+++  K+++
Sbjct: 119 MDVMETGANDVYVVHLEAGKEVLIPAIKDCIKEVDVENGKMVV 161


>gi|317052720|ref|YP_004113836.1| 16S rRNA processing protein RimM [Desulfurispirillum indicum S5]
 gi|316947804|gb|ADU67280.1| 16S rRNA processing protein RimM [Desulfurispirillum indicum S5]
          Length = 166

 Score = 54.7 bits (130), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 81/175 (46%), Gaps = 22/175 (12%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNRYV----LYSNDNR----ELRILKMYRKNKRFI 61
           +A I  T GL GE+ + S  N P    R+     L+    R     LRI      ++R +
Sbjct: 4   IARITKTRGLRGELQLFSLFNEP---GRFEGLKHLHIGGVRFAVSRLRI----ADSQRLV 56

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELE--EDEFFNTDLEEMETFDRQGKYWGQV 119
            +  G+D I  A EL       +      +E+   EDE+F+ +L+++   +  G+  G +
Sbjct: 57  VSLKGVDTIEQAEEL-----VGQDACLPVDEIPRYEDEYFDFELQKLRVINDDGEELGSL 111

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTM 174
             + + GA  + EI +   K ++IP     + E+NL+E  +L+ PI   ++   +
Sbjct: 112 TQIIHTGAKDVYEILSPGGKRWMIPANHEFIPEINLEEGYMLVRPIPGMMDEDAL 166


>gi|71733889|ref|YP_273613.1| 16S rRNA-processing protein RimM [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|257487157|ref|ZP_05641198.1| 16S rRNA-processing protein RimM [Pseudomonas syringae pv. tabaci
           ATCC 11528]
 gi|289625895|ref|ZP_06458849.1| 16S rRNA-processing protein RimM [Pseudomonas syringae pv. aesculi
           str. NCPPB3681]
 gi|289646207|ref|ZP_06477550.1| 16S rRNA-processing protein RimM [Pseudomonas syringae pv. aesculi
           str. 2250]
 gi|298488275|ref|ZP_07006308.1| 16S rRNA processing protein RimM [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|109893032|sp|Q48LV9|RIMM_PSE14 RecName: Full=Ribosome maturation factor rimM
 gi|71554442|gb|AAZ33653.1| 16S rRNA processing protein RimM [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|298157214|gb|EFH98301.1| 16S rRNA processing protein RimM [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|320323177|gb|EFW79266.1| 16S rRNA-processing protein RimM [Pseudomonas syringae pv. glycinea
           str. B076]
 gi|320329552|gb|EFW85541.1| 16S rRNA-processing protein RimM [Pseudomonas syringae pv. glycinea
           str. race 4]
 gi|330867525|gb|EGH02234.1| 16S rRNA-processing protein RimM [Pseudomonas syringae pv. aesculi
           str. 0893_23]
 gi|330874829|gb|EGH08978.1| 16S rRNA-processing protein RimM [Pseudomonas syringae pv. glycinea
           str. race 4]
 gi|330985049|gb|EGH83152.1| 16S rRNA-processing protein RimM [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331009222|gb|EGH89278.1| 16S rRNA-processing protein RimM [Pseudomonas syringae pv. tabaci
           ATCC 11528]
          Length = 179

 Score = 54.3 bits (129), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 36/168 (21%), Positives = 85/168 (50%), Gaps = 11/168 (6%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYAN---NPIDLNRYVLYSNDN--RELRILKMYRKNKR 59
           D L+++  I + HG+ GEV + S+ +   N +D   + L    +  +++ ++    ++K 
Sbjct: 9   DDLIVIGKIYSVHGVRGEVKVFSFTDPIGNLLDYKTWTLRREGSVEKQVELVSGRLQSKF 68

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +A   G+D+   A  L   ++   R  F D  L++ E++   LE ++  D+ G+  G++
Sbjct: 69  LVAKLKGLDDREEARLLSGYEICVPRNLFPD--LDDGEYYWYQLEGLKVIDQLGQLLGKI 126

Query: 120 CGVYNFGAGSILEIKNTM----EKTFLIPFTKFAVLEVNLQENKILID 163
             +   G+  ++ +K       ++  L+P+T+  VL +++   ++ +D
Sbjct: 127 DHLLETGSNDVMVVKPCAGSLDDRERLLPYTEQCVLAIDMAAGEMKVD 174


>gi|312962852|ref|ZP_07777339.1| Ribosome maturation factor [Pseudomonas fluorescens WH6]
 gi|311282879|gb|EFQ61473.1| Ribosome maturation factor [Pseudomonas fluorescens WH6]
          Length = 178

 Score = 54.3 bits (129), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 37/167 (22%), Positives = 83/167 (49%), Gaps = 10/167 (5%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRF 60
           D L+++  I + HG+ GEV + S+ +   +L +Y  ++       +++ ++     +K  
Sbjct: 9   DDLIVIGKIYSVHGVRGEVKVYSFTDPTENLLQYKTWTLKREGSVKQVELVSGRGSDKFL 68

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +A   G+D+   A  L   ++   R  F   EL + E++   LE ++  D+ G+  G++ 
Sbjct: 69  VAKLKGLDDREEARLLAGYEICVPRNLFP--ELTDGEYYWYQLEGLKVIDQLGQLLGKID 126

Query: 121 GVYNFGAGSILEIKNTM----EKTFLIPFTKFAVLEVNLQENKILID 163
            +   GA  ++ +K       ++  L+P+T+  VL V+L   ++ ++
Sbjct: 127 HLLETGANDVMVVKPCAGSLDDRERLLPYTEQCVLAVDLAAGEMKVE 173


>gi|82701704|ref|YP_411270.1| 16S rRNA processing protein RimM [Nitrosospira multiformis ATCC
           25196]
 gi|109893025|sp|Q2YBJ3|RIMM_NITMU RecName: Full=Ribosome maturation factor rimM
 gi|82409769|gb|ABB73878.1| 16S rRNA processing protein RimM [Nitrosospira multiformis ATCC
           25196]
          Length = 168

 Score = 54.3 bits (129), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 35/163 (21%), Positives = 78/163 (47%), Gaps = 6/163 (3%)

Query: 7   LVLMATIGTTHGLNGEVYI---DSYANNPIDLNRYVLYSNDNR--ELRILKMYRKNKRFI 61
           +V+M  +   + + G + +     Y +  +D   + L S   +  + ++++        +
Sbjct: 1   MVIMGRVAGPYAVAGWIKVFPYTEYVDGLLDYPDWWLGSEGGKWHKFKVIEGEVHGSVLL 60

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKD-EELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           A+     +  +A+ L+ LK+   R+      E  E+ ++ +DL  +   + QG+  G+V 
Sbjct: 61  ASLEQCADRDAAARLKGLKIAIPRRLLPALPESGEEGYYWSDLIGLAVINLQGEVLGKVA 120

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
           G+   GA  +L+++N  E   LIPF    +++V+L   +I +D
Sbjct: 121 GLLETGANDVLQVQNPEETERLIPFIDQVIIKVDLAAGRITVD 163


>gi|331091005|ref|ZP_08339847.1| ribosome maturation factor rimM [Lachnospiraceae bacterium
           2_1_46FAA]
 gi|330405227|gb|EGG84763.1| ribosome maturation factor rimM [Lachnospiraceae bacterium
           2_1_46FAA]
          Length = 168

 Score = 54.3 bits (129), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 41/166 (24%), Positives = 88/166 (53%), Gaps = 12/166 (7%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNRELRILKM--YRKN 57
           +++L+ +  I +THG+ GEV +    +   D+NR+     +  +  RE  +L++   +  
Sbjct: 1   MEQLLQVGIISSTHGVRGEVKVFPTTD---DINRFKKLKQVILDTGREKMVLEVQGVKFF 57

Query: 58  KRF-IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           K+F I  F GIDNI+   + +   L+  R+     +L+++E+F  D+  M  +  + +++
Sbjct: 58  KQFAILKFKGIDNINDIEKYKGKSLFVDRE--HAVKLKKNEYFIADMIGMNVYTEEDEFF 115

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
           G +  V   GA  +  I +      L+P  +  +L V+++++K++I
Sbjct: 116 GVLKDVIETGANDVYVISSEKHGEVLVPAIRQCILNVDIEKSKMVI 161


>gi|152980656|ref|YP_001352282.1| 16S rRNA processing protein RimM [Janthinobacterium sp. Marseille]
 gi|209573563|sp|A6SVI5|RIMM_JANMA RecName: Full=Ribosome maturation factor rimM
 gi|151280733|gb|ABR89143.1| 16S rRNA processing protein RimM [Janthinobacterium sp. Marseille]
          Length = 179

 Score = 54.3 bits (129), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 73/170 (42%), Gaps = 15/170 (8%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKR---FIAT 63
           LVL+  I   +GLNG V +  Y+ +   L     +  D  E   ++M +        +A 
Sbjct: 7   LVLVGYISGAYGLNGWVRVRPYSADADALLTAKTWWLDKPEFHDVEMMQSKIHTGDVVAK 66

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
             G+    +A  L+   +   R  F    L ++EF+  DL  +E  + QG++ GQV  + 
Sbjct: 67  LMGVAGRDAAEALKGATVQIPRSHFP--ALSDNEFYWVDLIGLEVENLQGEHLGQVSDMM 124

Query: 124 NFGAGSILEI----------KNTMEKTFLIPFTKFAVLEVNLQENKILID 163
           + GA  IL +               +  LIPF +  V+ V+    KI +D
Sbjct: 125 DNGAHPILRVAVPQAAETTDPKAAPQELLIPFVEQFVITVDRTAKKITVD 174


>gi|17230304|ref|NP_486852.1| 16S rRNA-processing protein RimM [Nostoc sp. PCC 7120]
 gi|21362862|sp|Q8YTB1|RIMM_ANASP RecName: Full=Probable 16S rRNA-processing protein rimM
 gi|17131905|dbj|BAB74511.1| alr2812 [Nostoc sp. PCC 7120]
          Length = 246

 Score = 54.3 bits (129), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 51/176 (28%), Positives = 77/176 (43%), Gaps = 19/176 (10%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNP----IDLNRYVLYSNDNRELRILKM---YRKN 57
           D+ + +  I +  GL+GEV +   ++ P    +   R++L         I  +   Y +N
Sbjct: 63  DEWLQIGKIVSAQGLSGEVRVYPDSDFPERFEVPGTRWLLRPGQTEPQPIELLHGRYLEN 122

Query: 58  KR-FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETF-DRQGKY 115
           K  ++   +G++N   + ELR   L+    D    EL EDE+   DL  ME F    G  
Sbjct: 123 KNLYVLQLAGVENRSQSEELRGCMLFVPASDRP--ELGEDEYHVVDLIGMEVFLQASGDL 180

Query: 116 WGQVCGVYNFGAGSILEIK-------NTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
            G V  V   G   +LE+        +   KT LIPF K     V+LQ  +I I P
Sbjct: 181 VGAVVDVIPAG-NDLLEVSLHEPVTSDKKPKTVLIPFVKAIAPVVDLQTRRIEITP 235


>gi|154249335|ref|YP_001410160.1| 16S rRNA processing protein RimM [Fervidobacterium nodosum Rt17-B1]
 gi|171769331|sp|A7HKS0|RIMM_FERNB RecName: Full=Ribosome maturation factor rimM
 gi|154153271|gb|ABS60503.1| 16S rRNA processing protein RimM [Fervidobacterium nodosum Rt17-B1]
          Length = 177

 Score = 54.3 bits (129), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 38/159 (23%), Positives = 78/159 (49%), Gaps = 9/159 (5%)

Query: 11  ATIGTTHGLNGEVYIDSYANNPI---DLNRYVLYSNDNRELRILKMYRKNKR---FIATF 64
             +  THGLNG++ +  ++N P     +   V Y+   ++  I+K  +  K    FI   
Sbjct: 16  GILSNTHGLNGDLKLYLFSNMPELVEKITEAVAYNESQKKFVIVKFSKVRKASDYFIVHL 75

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
           +GID I  A +L+   +Y  +  F     ++ E++  ++   E +D  G++ G V  +  
Sbjct: 76  TGIDTISEAEKLKGFIIYLDKSFFPKS--KDGEYYFFEILNAEVYDNAGEFIGIVEDIIE 133

Query: 125 FGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
            G   ++ +K   E+  LIP  +  +L+++ +  KI+++
Sbjct: 134 TGNNDVIVVKKEKEEV-LIPVIERYILKIDKEAKKIIVN 171


>gi|238852594|ref|ZP_04643004.1| 16S rRNA processing protein RimM [Lactobacillus gasseri 202-4]
 gi|238834740|gb|EEQ26967.1| 16S rRNA processing protein RimM [Lactobacillus gasseri 202-4]
          Length = 173

 Score = 54.3 bits (129), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 79/159 (49%), Gaps = 8/159 (5%)

Query: 10  MATIGTTHGLNGEVYIDSYANNP----IDLNRYVLYSNDNRELRILKMYRKNKRF-IATF 64
           +  I + HGL GEV +++  + P     + +R  + ++D  +  I+   R++K+F +  F
Sbjct: 7   VGKILSPHGLKGEVKVNATTDFPEERLANGSRLFIKNSDQYQELIVDGARRHKQFYLVKF 66

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQ-GKYWGQVCGVY 123
             ID+I  A ++   +LY    D   +EL E  ++  D+     +D + G+  G +  + 
Sbjct: 67  EEIDDIDQAEKVCGKELYVAETD--QQELPEGSYYFKDILNCPVYDAETGEKLGVLANIE 124

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
             GA  I EIK    K+F IP  +  V +V+L   +I +
Sbjct: 125 TPGANDIWEIKPERGKSFWIPNIESVVNKVDLANKRIEV 163


>gi|229525222|ref|ZP_04414627.1| 16S rRNA processing protein RimM [Vibrio cholerae bv. albensis
           VL426]
 gi|229338803|gb|EEO03820.1| 16S rRNA processing protein RimM [Vibrio cholerae bv. albensis
           VL426]
          Length = 184

 Score = 54.3 bits (129), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 83/173 (47%), Gaps = 12/173 (6%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNR----ELRILKMYRK 56
           M K ++ +++  +G+++G+ G + + SY +NP  +  Y  +  D +    E ++    R 
Sbjct: 9   MSKQNEKLVVGKLGSSYGIRGWLKVFSYTDNPESIFDYSPWYIDQKGEWVEYKVEGWKRH 68

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           NK ++    G+D    A+ L + ++          EL EDEF+  +L  M+     G   
Sbjct: 69  NKGWVVKLQGLDVREDANLLTNFEIAIDPASLP--ELSEDEFYWRELFGMQVVTTNGYDL 126

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTF-----LIPFTKFAVLE-VNLQENKILID 163
           G V  +   G+  +L +K  ++  F     LIPF +  V++ V+ Q  +I +D
Sbjct: 127 GVVTDMMETGSNDVLVVKANLKDAFGQKERLIPFLEEQVIKVVDRQAQRIEVD 179


>gi|154147973|ref|YP_001406147.1| 16S rRNA processing protein RimM [Campylobacter hominis ATCC
           BAA-381]
 gi|166226430|sp|A7I0V6|RIMM_CAMHC RecName: Full=Ribosome maturation factor rimM
 gi|153803982|gb|ABS50989.1| 16S rRNA processing protein RimM [Campylobacter hominis ATCC
           BAA-381]
          Length = 176

 Score = 54.3 bits (129), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 45/165 (27%), Positives = 81/165 (49%), Gaps = 11/165 (6%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYV-LYSNDNRELRILKMYRKNKRFIAT 63
           D ++ +A +G T GL G + + + ++ P    +    Y  D   L IL   + N  F+A 
Sbjct: 4   DDMLEVALLGKTIGLKGAIKLHNRSDFPSQFKKGAKFYLTDGEILEILSFNKTN--FVAV 61

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDE-ELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
           F   +NI  A++L +  LY  ++  K   +L +DEFF  ++  +E F+ + K  G+V  +
Sbjct: 62  FKNYENIECAAKLTNKILYQSKEITKKTCKLGKDEFFYFEILGLEVFENEEK-LGKVADI 120

Query: 123 YNFG------AGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKIL 161
           +  G      A     IK    K F +P+T   + +++++E KI 
Sbjct: 121 FEAGNFVFEIATDEKLIKKGFPKIFYLPYTDHFIDKISIEEGKIF 165


>gi|302554428|ref|ZP_07306770.1| 16S rRNA processing protein RimM [Streptomyces viridochromogenes
           DSM 40736]
 gi|302472046|gb|EFL35139.1| 16S rRNA processing protein RimM [Streptomyces viridochromogenes
           DSM 40736]
          Length = 180

 Score = 53.9 bits (128), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 75/163 (46%), Gaps = 9/163 (5%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNP-IDLNRYVLYSND---NRELRILKMYRKNKRFIAT 63
           +++A IG  HG+ GEV ++   + P + L    + + D      L I      + R +  
Sbjct: 3   LVVARIGRAHGIKGEVTVEVRTDEPELRLAPGAVLTTDPAATGPLTIETGRVHSGRLLLR 62

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEE--DEFFNTDLEEMETFDRQGKYWGQVCG 121
           F G+ +   A  LR+  L A+      +EL E  DE+++  L +++     G   G++  
Sbjct: 63  FEGVSDRTGAEALRNTLLIAE---IDPDELPEGEDEYYDHQLIDLDVVTADGTEVGRITE 119

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           + +     +  ++       LIPF +  V E++L+E K +I P
Sbjct: 120 ISHLPTQDLFIVERPDGSEVLIPFVEEIVAEIDLEEQKAVITP 162


>gi|189184234|ref|YP_001938019.1| 16S rRNA-processing protein RimM [Orientia tsutsugamushi str.
           Ikeda]
 gi|238692020|sp|B3CTT8|RIMM_ORITI RecName: Full=Ribosome maturation factor rimM
 gi|189181005|dbj|BAG40785.1| 16S rRNA processing protein RimM [Orientia tsutsugamushi str.
           Ikeda]
          Length = 164

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 69/142 (48%), Gaps = 2/142 (1%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIATF 64
            KL+L+  I + +G+ G+V I S+ +   ++  Y L       ++I      +K+ I   
Sbjct: 5   SKLILIGIISSPYGIRGQVAIKSFTDPASNILNYELKDYRKNIIKIHSAKILSKKIICNI 64

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
             I    +A +L   KLY  + +    +L + E++  +L  ++  + +G+  G++  + N
Sbjct: 65  DQIVTRTAAEQLTRTKLYIYKHEL--PQLPDSEYYVANLNGIKVKNLEGEIIGKINNICN 122

Query: 125 FGAGSILEIKNTMEKTFLIPFT 146
           + AG I+E+     K  + PFT
Sbjct: 123 YNAGDIIEVVYNDGKKIMYPFT 144


>gi|220928162|ref|YP_002505071.1| 16S rRNA-processing protein RimM [Clostridium cellulolyticum H10]
 gi|254797746|sp|B8I7T4|RIMM_CLOCE RecName: Full=Ribosome maturation factor rimM
 gi|219998490|gb|ACL75091.1| 16S rRNA processing protein RimM [Clostridium cellulolyticum H10]
          Length = 169

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/160 (26%), Positives = 79/160 (49%), Gaps = 12/160 (7%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKN-----KRFI 61
           +++  +  THG+ GE+   S  ++P    +   +Y + N     L+ Y  N     K+FI
Sbjct: 5   LIVGQLINTHGVKGELKATSQTDDPQRFKKLKWVYIDKNGS---LEKYDINGVKFFKQFI 61

Query: 62  AT-FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
              F G+D+I  A +L+    Y K       +L E+ FF +D+  ++ +D   +  G++ 
Sbjct: 62  IIKFQGVDSIEEAEKLKG--FYIKVDRANAVKLPENSFFISDIIGLKVYDENNQLLGELK 119

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKI 160
            V   G+  +  ++++  K  LIP  K  V EV+++E KI
Sbjct: 120 DVIQTGSNDVYVVRDSDSKEILIPALKSVVKEVSIEEGKI 159


>gi|241889523|ref|ZP_04776822.1| 16S rRNA processing protein RimM [Gemella haemolysans ATCC 10379]
 gi|241863830|gb|EER68213.1| 16S rRNA processing protein RimM [Gemella haemolysans ATCC 10379]
          Length = 169

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/166 (25%), Positives = 80/166 (48%), Gaps = 9/166 (5%)

Query: 10  MATIGTTHGLNGEVYIDS---YANNPIDLNRYVLYSNDNRELR--ILKMYRKNKR-FIAT 63
           +  I  TH L GEV + S   +          +L +  N+ ++  +++ YR +K   +  
Sbjct: 5   VGKIVNTHSLKGEVKVISSTDFEEQRFKKGSELLITRGNQVVKEVVVESYRTHKNNLLVK 64

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F GID I  A + ++L++     +    ELEE+EF+  ++   + FD   K  G++  + 
Sbjct: 65  FVGIDTIEEAEKFKNLQIKIDSDNIG--ELEENEFYFHEIIGCKVFDENNKILGEIAEIL 122

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
             GA  +  IK    K  LIP+ +  V ++++   +I I+ +  GL
Sbjct: 123 TPGANDVWVIKAETGKEILIPYIEDVVKKIDVTNKRIDIE-VMEGL 167


>gi|14423897|sp|Q9KUF9|RIMM_VIBCH RecName: Full=Ribosome maturation factor rimM
          Length = 182

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 82/173 (47%), Gaps = 12/173 (6%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNR----ELRILKMYRK 56
           M K ++ +++  +G+++G+ G + + SY +NP  +  Y  +  D +    E ++    R 
Sbjct: 7   MSKQNEKLVVGKLGSSYGIRGWLKVFSYTDNPESIFDYSPWYIDQKGEWVEYKVEGWKRH 66

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           NK ++    G+D    A  L + ++          EL EDEF+  +L  M+     G   
Sbjct: 67  NKGWVVKLQGLDVREDAHLLTNFEIAIDPASLP--ELSEDEFYWRELFGMQVVTTNGYDL 124

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTF-----LIPFTKFAVLE-VNLQENKILID 163
           G V  +   G+  +L +K  ++  F     LIPF +  V++ V+ Q  +I +D
Sbjct: 125 GVVTDMMETGSNDVLVVKANLKDAFGQKERLIPFLEEQVIKVVDRQAQRIEVD 177


>gi|15640584|ref|NP_230213.1| 16S rRNA-processing protein RimM [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|147674058|ref|YP_001216061.1| 16S rRNA-processing protein RimM [Vibrio cholerae O395]
 gi|153216300|ref|ZP_01950390.1| 16S rRNA processing protein RimM [Vibrio cholerae 1587]
 gi|153823559|ref|ZP_01976226.1| 16S rRNA processing protein RimM [Vibrio cholerae B33]
 gi|153827344|ref|ZP_01980011.1| 16S rRNA processing protein RimM [Vibrio cholerae MZO-2]
 gi|227080745|ref|YP_002809296.1| 16S rRNA processing protein [Vibrio cholerae M66-2]
 gi|229507173|ref|ZP_04396679.1| 16S rRNA processing protein RimM [Vibrio cholerae BX 330286]
 gi|229509158|ref|ZP_04398643.1| 16S rRNA processing protein RimM [Vibrio cholerae B33]
 gi|229519632|ref|ZP_04409075.1| 16S rRNA processing protein RimM [Vibrio cholerae RC9]
 gi|229520858|ref|ZP_04410280.1| 16S rRNA processing protein RimM [Vibrio cholerae TM 11079-80]
 gi|229530375|ref|ZP_04419763.1| 16S rRNA processing protein RimM [Vibrio cholerae 12129(1)]
 gi|229606149|ref|YP_002876797.1| 16S rRNA-processing protein RimM [Vibrio cholerae MJ-1236]
 gi|254292065|ref|ZP_04962841.1| 16S rRNA processing protein RimM [Vibrio cholerae AM-19226]
 gi|254850799|ref|ZP_05240149.1| 16S rRNA-processing protein [Vibrio cholerae MO10]
 gi|255744213|ref|ZP_05418166.1| 16S rRNA processing protein RimM [Vibrio cholera CIRS 101]
 gi|262147227|ref|ZP_06028029.1| 16S rRNA processing protein RimM [Vibrio cholerae INDRE 91/1]
 gi|262169871|ref|ZP_06037561.1| 16S rRNA processing protein RimM [Vibrio cholerae RC27]
 gi|297580695|ref|ZP_06942621.1| 16S rRNA-processing protein [Vibrio cholerae RC385]
 gi|298500686|ref|ZP_07010489.1| 16S rRNA processing protein RimM [Vibrio cholerae MAK 757]
 gi|172047728|sp|A5F9A8|RIMM_VIBC3 RecName: Full=Ribosome maturation factor rimM
 gi|254797770|sp|C3LS52|RIMM_VIBCM RecName: Full=Ribosome maturation factor rimM
 gi|9654992|gb|AAF93730.1| 16S rRNA processing protein RimM [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|124114342|gb|EAY33162.1| 16S rRNA processing protein RimM [Vibrio cholerae 1587]
 gi|126518913|gb|EAZ76136.1| 16S rRNA processing protein RimM [Vibrio cholerae B33]
 gi|146315941|gb|ABQ20480.1| 16S rRNA processing protein RimM [Vibrio cholerae O395]
 gi|149738739|gb|EDM53081.1| 16S rRNA processing protein RimM [Vibrio cholerae MZO-2]
 gi|150422013|gb|EDN13984.1| 16S rRNA processing protein RimM [Vibrio cholerae AM-19226]
 gi|227008633|gb|ACP04845.1| 16S rRNA processing protein [Vibrio cholerae M66-2]
 gi|227012388|gb|ACP08598.1| 16S rRNA processing protein [Vibrio cholerae O395]
 gi|229332148|gb|EEN97636.1| 16S rRNA processing protein RimM [Vibrio cholerae 12129(1)]
 gi|229342091|gb|EEO07087.1| 16S rRNA processing protein RimM [Vibrio cholerae TM 11079-80]
 gi|229344321|gb|EEO09296.1| 16S rRNA processing protein RimM [Vibrio cholerae RC9]
 gi|229353730|gb|EEO18666.1| 16S rRNA processing protein RimM [Vibrio cholerae B33]
 gi|229355918|gb|EEO20838.1| 16S rRNA processing protein RimM [Vibrio cholerae BX 330286]
 gi|229368804|gb|ACQ59227.1| 16S rRNA processing protein RimM [Vibrio cholerae MJ-1236]
 gi|254846504|gb|EET24918.1| 16S rRNA-processing protein [Vibrio cholerae MO10]
 gi|255738153|gb|EET93545.1| 16S rRNA processing protein RimM [Vibrio cholera CIRS 101]
 gi|262021605|gb|EEY40316.1| 16S rRNA processing protein RimM [Vibrio cholerae RC27]
 gi|262031324|gb|EEY49936.1| 16S rRNA processing protein RimM [Vibrio cholerae INDRE 91/1]
 gi|297535111|gb|EFH73946.1| 16S rRNA-processing protein [Vibrio cholerae RC385]
 gi|297540467|gb|EFH76525.1| 16S rRNA processing protein RimM [Vibrio cholerae MAK 757]
          Length = 184

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 82/173 (47%), Gaps = 12/173 (6%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNR----ELRILKMYRK 56
           M K ++ +++  +G+++G+ G + + SY +NP  +  Y  +  D +    E ++    R 
Sbjct: 9   MSKQNEKLVVGKLGSSYGIRGWLKVFSYTDNPESIFDYSPWYIDQKGEWVEYKVEGWKRH 68

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           NK ++    G+D    A  L + ++          EL EDEF+  +L  M+     G   
Sbjct: 69  NKGWVVKLQGLDVREDAHLLTNFEIAIDPASLP--ELSEDEFYWRELFGMQVVTTNGYDL 126

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTF-----LIPFTKFAVLE-VNLQENKILID 163
           G V  +   G+  +L +K  ++  F     LIPF +  V++ V+ Q  +I +D
Sbjct: 127 GVVTDMMETGSNDVLVVKANLKDAFGQKERLIPFLEEQVIKVVDRQAQRIEVD 179


>gi|116629444|ref|YP_814616.1| RimM protein, required for 16S rRNA processing [Lactobacillus
           gasseri ATCC 33323]
 gi|282850845|ref|ZP_06260219.1| 16S rRNA processing protein RimM [Lactobacillus gasseri 224-1]
 gi|311110908|ref|ZP_07712305.1| 16S rRNA processing protein RimM [Lactobacillus gasseri MV-22]
 gi|122273618|sp|Q044E4|RIMM_LACGA RecName: Full=Ribosome maturation factor rimM
 gi|116095026|gb|ABJ60178.1| 16S rRNA processing protein RimM [Lactobacillus gasseri ATCC 33323]
 gi|282557797|gb|EFB63385.1| 16S rRNA processing protein RimM [Lactobacillus gasseri 224-1]
 gi|311066062|gb|EFQ46402.1| 16S rRNA processing protein RimM [Lactobacillus gasseri MV-22]
          Length = 173

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 78/159 (49%), Gaps = 8/159 (5%)

Query: 10  MATIGTTHGLNGEVYIDSYANNP----IDLNRYVLYSNDNRELRILKMYRKNKRF-IATF 64
           +  I + HGL GEV +++  + P     + +R  + ++D  +  I+   R++K+F +  F
Sbjct: 7   VGKILSPHGLKGEVKVNATTDFPEERLANGSRLFIKNSDQYQELIVDGARRHKQFYLVKF 66

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQ-GKYWGQVCGVY 123
             ID I  A ++   +LY    D   +EL E  ++  D+     +D + G+  G +  + 
Sbjct: 67  EEIDGIDQAEKVCGKELYVAETD--QQELPEGSYYFKDILNCPVYDAETGEKLGVLANIE 124

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
             GA  I EIK    K+F IP  +  V +V+L   +I +
Sbjct: 125 TPGANDIWEIKPEHGKSFWIPNIESVVNKVDLANKRIEV 163


>gi|209573740|sp|A9WEK5|RIMM_CHLAA RecName: Full=Ribosome maturation factor rimM
          Length = 174

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 81/173 (46%), Gaps = 6/173 (3%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY---VLYSNDNRELRILKMY-RKN 57
           V +D L+ +  +G   G+ G++ + S +++P  L R+   V         ++ ++Y  K 
Sbjct: 4   VVMDDLLYIGALGAPFGVRGQIRLHSISSHPEHLIRHLRTVFIGPKRVPHQVSRLYMHKP 63

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              I     I +  +A++LR  ++Y          L  DEFF  D+  M+     G+  G
Sbjct: 64  GLLIIQLQTITDRDAAADLRGEEVYIAAA--DAAPLAADEFFYHDVIGMQAVTDSGEDIG 121

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           +V  +   GAG I+ I        L+P  +  ++ +++ E +++I PIA  L+
Sbjct: 122 EVRDILETGAGEIVVITRRGRPDALVPMVRDFIVAIDVGERRLVIRPIAGLLD 174


>gi|325919892|ref|ZP_08181881.1| 16S rRNA processing protein RimM [Xanthomonas gardneri ATCC 19865]
 gi|325549601|gb|EGD20466.1| 16S rRNA processing protein RimM [Xanthomonas gardneri ATCC 19865]
          Length = 170

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 36/169 (21%), Positives = 79/169 (46%), Gaps = 10/169 (5%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY-----SNDNRELRILKMYR 55
           M + ++ +L+  +    G+ GE+ I+S+      + RY  +     S +   L   +   
Sbjct: 1   MKQTERRILLGRVAGAFGVKGELKIESWTEPRSAIFRYQPWILRTPSGEESTLSGARGRD 60

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
           + K  +ATF  + +  +   +  +++Y  R      +   DE++  DLEE++    +G  
Sbjct: 61  QGKHLVATFPSVSDRDTVEAMHGIEIYVSRSVLPPPK--PDEYYWVDLEELQVETVEGVK 118

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFT-KFAVLEVNLQENKILID 163
            G V  +++ G+  ++ ++   E+  L+PF     V  V+ + N I++D
Sbjct: 119 LGTVSHLFSTGSNDVMVVRGDRER--LVPFVLPDFVKSVDFEANLIVVD 165


>gi|326803874|ref|YP_004321692.1| 16S rRNA processing protein RimM [Aerococcus urinae
           ACS-120-V-Col10a]
 gi|326650986|gb|AEA01169.1| 16S rRNA processing protein RimM [Aerococcus urinae
           ACS-120-V-Col10a]
          Length = 179

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 83/170 (48%), Gaps = 8/170 (4%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDL----NRYVLYSNDNRELRI-LKMYRKNKRF-IAT 63
           +  I  T GL GEV + +  + P       ++ V++ + N E  + +  +R++K F I +
Sbjct: 8   VGKIVNTQGLKGEVRVIATTDFPEKRFQPGSQLVIFDHKNIEAWVEVVSHRQHKNFHILS 67

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F G+ +I+     + +++    ++   ++L E EFF   +  +  +D  GK  G+V  + 
Sbjct: 68  FKGMTSINDVEGFKGMEIMVAAKERHSDDLAEGEFFYDQIIGLVVYDLTGKELGKVKTIT 127

Query: 124 NFGAGSILEIKNTM--EKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN 171
             G   +  I+     +K  LIP+    V  ++L + KI+ID +   +++
Sbjct: 128 QLGPNDVWTIQRNQPGKKDVLIPYIDDVVKSIDLDDKKIVIDALEGLIDD 177


>gi|297156874|gb|ADI06586.1| 16S rRNA-processing protein RimM [Streptomyces bingchenggensis
           BCW-1]
          Length = 182

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/167 (23%), Positives = 76/167 (45%), Gaps = 5/167 (2%)

Query: 10  MATIGTTHGLNGEVYIDSYANNP-IDLNRYVLYSNDNRE---LRILKMYRKNKRFIATFS 65
           MA IG  HG+ GEV ++   + P + L    + + +      L I      + R +  F+
Sbjct: 1   MARIGRAHGIKGEVTVEVRTDEPELRLAPGAVLATEPASAGPLTIETGRVHSGRLLLRFA 60

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNF 125
           G  +  +A  LR   L A+  D +D   + +E+++  L +++     G   G++  + + 
Sbjct: 61  GFADRTAAETLRGTLLIAE-VDPEDTPEDPEEYYDHQLIDLDVVTVDGTEVGRISEISHL 119

Query: 126 GAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNT 172
               +L ++       +IPF    V E++L+  + +IDP    L+ T
Sbjct: 120 PYQDLLIVRRPDGSEVMIPFVSEVVPEIDLEAQRAVIDPPPGLLDET 166


>gi|218438369|ref|YP_002376698.1| 16S rRNA-processing protein RimM [Cyanothece sp. PCC 7424]
 gi|218171097|gb|ACK69830.1| 16S rRNA processing protein RimM [Cyanothece sp. PCC 7424]
          Length = 207

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 85/200 (42%), Gaps = 42/200 (21%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDL----NRYVLYSN--DNRELRIL--KMYR 55
           +D  + + TI    GL GEV + S ++ P        R++L  N    +E+ +L  +   
Sbjct: 1   MDDWLEIGTIVAPQGLKGEVRVASESDFPERFEQPGKRWLLPPNSVQVQEVELLNGRYIP 60

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDR-QGK 114
             K ++   +GID+I  A ELR  K+  K+ D    +LEEDE+   DL  +E + +  G+
Sbjct: 61  GKKIYVVQLAGIDHIDRAEELRGYKILVKKSDRP--QLEEDEYHVADLVNLEVYHQLTGE 118

Query: 115 YWGQVCGVYNFGAGSILEI------------------------------KNTMEKTFLIP 144
             G V  + + G   +LE+                              K     T LIP
Sbjct: 119 NLGIVTDILSAG-NDLLEVTLHQQPEREEKPEPDLSKVSRKSKLRKLKPKQRKPATLLIP 177

Query: 145 FTKFAVLEVNLQENKILIDP 164
           F K  V  V+L+  +I I P
Sbjct: 178 FVKEIVPIVDLKTGRIEIKP 197


>gi|91776685|ref|YP_546441.1| 16S rRNA processing protein RimM [Methylobacillus flagellatus KT]
 gi|91710672|gb|ABE50600.1| 16S rRNA processing protein RimM [Methylobacillus flagellatus KT]
          Length = 164

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 74/163 (45%), Gaps = 13/163 (7%)

Query: 10  MATIGTTHGLNGEVYIDS---YANNPIDLNRYVLYSNDNRE------LRILKMYRKNKRF 60
           M  I   +G+ G V +     Y ++  D  R++L   D ++        + K    N   
Sbjct: 1   MGRIVAPYGVYGWVKVQPATEYVDSLFDYGRWMLGRGDPKQPEQWQSCEVEKAKVHNDLL 60

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +    GID+   A   + + +   R +    E EE E++ +DL  ++  ++Q   +GQV 
Sbjct: 61  LVKLQGIDDRDQAFSCKGMYVAVYRDELP--EPEEGEYYWSDLIGLQVRNQQEVDFGQVV 118

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
            V+  GA  +L +K   E+  L+PF    VLEV+     +L+D
Sbjct: 119 DVFATGANDVLVVKGDRER--LVPFIGQVVLEVDTDGKTMLVD 159


>gi|302537191|ref|ZP_07289533.1| 16S rRNA processing protein RimM [Streptomyces sp. C]
 gi|302446086|gb|EFL17902.1| 16S rRNA processing protein RimM [Streptomyces sp. C]
          Length = 208

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/163 (23%), Positives = 77/163 (47%), Gaps = 9/163 (5%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNP-IDLNRYVLYSNDNRE---LRILKMYRKNKRFIAT 63
           +++A IG  HG+ GEV ++   + P + L+   +   +      L I      + R +  
Sbjct: 3   LVVARIGRAHGIKGEVTVEVRTDEPELRLSPGAVLRTEPASAGPLTIETGRVHSSRLLLR 62

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEEL--EEDEFFNTDLEEMETFDRQGKYWGQVCG 121
           F G+ +  +A  LR+  L A   D    EL  EEDE+++  L +++     G   G++  
Sbjct: 63  FEGVKDRTAAEALRNTLLIA---DVDPAELPEEEDEYYDHQLMDLDVVLEDGTEIGRITE 119

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           + +  +  +  ++       +IPF +  V E++L+E + +I P
Sbjct: 120 ISHLPSQDLFIVERPDGTEVMIPFVEEIVAEIDLEEQRCVITP 162


>gi|254382008|ref|ZP_04997370.1| 16S rRNA processing protein [Streptomyces sp. Mg1]
 gi|194340915|gb|EDX21881.1| 16S rRNA processing protein [Streptomyces sp. Mg1]
          Length = 196

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/161 (22%), Positives = 76/161 (47%), Gaps = 5/161 (3%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNP-IDLNRYVLYSNDNRE---LRILKMYRKNKRFIAT 63
           +++A IG  HG+ GEV ++   + P + L    +   +      L I      + R +  
Sbjct: 3   LVVARIGRAHGIKGEVTVEVRTDEPELRLGPGAVLETEPASAGPLTIETGRVHSGRLLLR 62

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F G+ +   A  LR++ L A+    +  E EEDE+++  L +++     G   G++  + 
Sbjct: 63  FEGVKDRTGAEALRNILLIAEVDPTELPE-EEDEYYDHQLMDLDVVLEDGTEIGRITEIS 121

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           +  +  +  ++       +IPF +  V E++L+E + +I P
Sbjct: 122 HLPSQDLFIVERPDGTEVMIPFVEEIVAEIDLEEQRCVITP 162


>gi|134093875|ref|YP_001098950.1| 16S rRNA-processing protein RimM [Herminiimonas arsenicoxydans]
 gi|209573562|sp|A4G2T6|RIMM_HERAR RecName: Full=Ribosome maturation factor rimM
 gi|133737778|emb|CAL60823.1| 16S rRNA processing protein [Herminiimonas arsenicoxydans]
          Length = 177

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 46/168 (27%), Positives = 74/168 (44%), Gaps = 13/168 (7%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRK---NKRFIAT 63
           LVL+  I   +GLNG V +  Y+ +   L     +  D  E R + M +    +   +A 
Sbjct: 7   LVLVGYISGAYGLNGWVRVRPYSADADALLNAKTWWLDKPEFRDVAMMQSKIHSGDVVAQ 66

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
             G+    +A  L+   +   R  F    L ++EF+  DL  +E  + QG   GQV  + 
Sbjct: 67  LMGVAGRDAAEALKGATVQIPRSHFP--ALSDNEFYWVDLIGLEVENLQGVRLGQVSDMM 124

Query: 124 NFGAGSILE--IKNTME------KTFLIPFTKFAVLEVNLQENKILID 163
           + GA  IL   +  T E      +  LIPF +  V+ ++    KI +D
Sbjct: 125 DNGAHPILRVAVPQTSEADPKAAQELLIPFVEQFVITIDQTAKKITVD 172


>gi|294788701|ref|ZP_06753942.1| 16S rRNA processing protein RimM [Simonsiella muelleri ATCC 29453]
 gi|294483183|gb|EFG30869.1| 16S rRNA processing protein RimM [Simonsiella muelleri ATCC 29453]
          Length = 169

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/167 (26%), Positives = 75/167 (44%), Gaps = 7/167 (4%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYID---SYANNPIDLNRY-VLYSNDNRELRILKMYRK 56
           M  +   V M  I    G+ G V +     Y ++ +D +++ ++  ND     +L  +  
Sbjct: 1   MNNMQNWVAMGYIKGAFGVKGWVKVQPSTEYTDSLLDYSQWRLVQGNDVMMATLLNGHVA 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           N      F  I +  SA+ LR   +Y  R+ F   E +E+EF+ TDL  M+  +R     
Sbjct: 61  NGELHVKFEQIQDRDSAALLRGYTIYIPREQFA--EPDENEFYWTDLMGMQVHNRDNACL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
           G+V  +   GA  +L +K    +  LIPF    + +VN     I +D
Sbjct: 119 GEVINIMETGAHDVLVVKGEFGEK-LIPFVSQFIDDVNELTQTITVD 164


>gi|300933898|ref|ZP_07149154.1| 16S rRNA-processing protein RimM [Corynebacterium resistens DSM
           45100]
          Length = 199

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 77/180 (42%), Gaps = 38/180 (21%)

Query: 17  HGLNGEVYIDSYANNPIDLNRYV-------LYSNDNRELRILKMYRKNKRFIATFSGIDN 69
           HG+ GEV +++  + P +L R+V       + +  +R L I K+     R + TF  + +
Sbjct: 18  HGVRGEVVVEATTDQP-EL-RFVVGHELTGIQAGKSRTLTIAKIRPHQGRLLMTFEEVPD 75

Query: 70  IHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETF-----DRQGKYW-------- 116
              A  LR ++ +A   +  DEE     +++  LE +        D Q  Y         
Sbjct: 76  RTQAESLRGVRFFADPIEDPDEE----SYYDHQLEGLRVLNCGNVDEQTAYARAYEGAQP 131

Query: 117 -----GQVCGVYNFGAGSILEIK-------NTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
                G+V GV +  AG+ LE+         T   T LIPF    V  V+L  + ++I P
Sbjct: 132 EPTDIGEVTGVMHSPAGTTLEVTIDEDTELPTAGHTILIPFRHAIVPIVDLDNDALVITP 191


>gi|229512831|ref|ZP_04402298.1| 16S rRNA processing protein RimM [Vibrio cholerae TMA 21]
 gi|229350080|gb|EEO15033.1| 16S rRNA processing protein RimM [Vibrio cholerae TMA 21]
          Length = 184

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 82/173 (47%), Gaps = 12/173 (6%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNR----ELRILKMYRK 56
           M K ++ +++  +G+++G+ G + + SY +NP  +  Y  +  D +    E ++    R 
Sbjct: 9   MSKQNEKLVVGKLGSSYGIRGWLKVFSYTDNPESIFDYSPWYIDQKGEWVEYKVEGWKRH 68

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           NK ++    G+D    A  L + ++          EL EDEF+  +L  M+     G   
Sbjct: 69  NKGWVVKLQGLDLREDAHLLTNFEIAIDPASLP--ELSEDEFYWRELFGMQVVTTNGYDL 126

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTF-----LIPFTKFAVLE-VNLQENKILID 163
           G V  +   G+  +L +K  ++  F     LIPF +  V++ V+ Q  +I +D
Sbjct: 127 GVVTDMMETGSNDVLVVKANLKDAFGQKERLIPFLEEQVIKVVDRQAQRIEVD 179


>gi|218887969|ref|YP_002437290.1| 16S rRNA processing protein RimM [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218758923|gb|ACL09822.1| 16S rRNA processing protein RimM [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 210

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 74/179 (41%), Gaps = 9/179 (5%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRKNKRF 60
           D  + +  +G  HGL GEV +D +A +P DL R  L+        R   +  + R   R 
Sbjct: 4   DSFIEIGLVGRPHGLRGEVGVDFWAESP-DLLRGTLWLRPGRGAPRPHTVAAVRRHQGRP 62

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMET-FDRQGKYWGQV 119
           +  F GI +  +A  LR + +   +      E  EDE +  +L  +       G   G +
Sbjct: 63  LVLFEGIADRSAAETLRGMHVLVPKDRLP--EPAEDEVYLHELLGLRVLLHDTGAALGTL 120

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQ 178
             V   G   +  I+    K  L+P  +  V  ++L   ++ I P   GL    ++ P+
Sbjct: 121 DDVQMPGGQEVWSIRTADGKEVLLPAVEEFVASIDLDAREVRITP-PPGLMELYLEAPE 178


>gi|330466289|ref|YP_004404032.1| 16S rRNA-processing protein RimM [Verrucosispora maris AB-18-032]
 gi|328809260|gb|AEB43432.1| 16S rRNA-processing protein RimM [Verrucosispora maris AB-18-032]
          Length = 187

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/180 (22%), Positives = 72/180 (40%), Gaps = 23/180 (12%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNP--------IDLNRYVLYSNDNRE----------- 47
           L+++  IG  HG+ GEV ++   + P        +      +     +E           
Sbjct: 2   LLIVGRIGKPHGIRGEVTVEVRTDEPDTRFAPGVVLATMPGVVPRGGQEPAAEPGERYEV 61

Query: 48  ---LRILKMYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLE 104
              L +  +     R +  F G+ +   A  LR   L     D    E + +EF +  L 
Sbjct: 62  PDALTVEAVRWHQGRLLVAFEGVLDRDVAEALRGTLLTVDSADVAPPE-DPEEFHDHQLV 120

Query: 105 EMETFDRQGKYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
            +      G+  G+V  + +  A  +L ++    +T LIPF K  V EV+L   ++++DP
Sbjct: 121 GLAVVTPSGERLGEVARIDHAPASDLLVLRRPEGRTALIPFVKAIVPEVDLAGGRVVVDP 180


>gi|261210131|ref|ZP_05924429.1| 16S rRNA processing protein RimM [Vibrio sp. RC341]
 gi|260840896|gb|EEX67438.1| 16S rRNA processing protein RimM [Vibrio sp. RC341]
          Length = 176

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 82/173 (47%), Gaps = 12/173 (6%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNR----ELRILKMYRK 56
           M K ++ +++  +G+++G+ G + + SY +NP  +  Y  +  D +    E ++    R 
Sbjct: 1   MGKQNERLVVGKLGSSYGIRGWLKVFSYTDNPESIFDYSPWFIDQKGEWVEHKVEGWKRH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           NK ++    G+D    A  L + ++          EL EDEF+  +L  M+     G   
Sbjct: 61  NKGWVVKLQGLDVREDAHLLTNFEIAIDPASLP--ELSEDEFYWRELFGMQVVTSSGYDL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTF-----LIPFTKFAVLE-VNLQENKILID 163
           G V  +   G+  +L +K  ++  F     LIPF +  V++ V+ Q  +I +D
Sbjct: 119 GVVTDMMETGSNDVLVVKANLKDAFGQKERLIPFLEEQVIKVVDRQAQRIEVD 171


>gi|121533793|ref|ZP_01665620.1| 16S rRNA processing protein RimM [Thermosinus carboxydivorans Nor1]
 gi|121307784|gb|EAX48699.1| 16S rRNA processing protein RimM [Thermosinus carboxydivorans Nor1]
          Length = 303

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 78/160 (48%), Gaps = 6/160 (3%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKRFIA-TF 64
           LV +  I   HG+ G+V I    + P    +    Y +D   L + +  R++K+FI   F
Sbjct: 143 LVAIGKIVAPHGVRGDVRIIPLTDFPERFQQLKTAYFDDGTRLSV-ESARQHKQFILLKF 201

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
            G+ + ++   LR   +   R+D     L E  ++  ++  ++ +D  G Y G+V  V  
Sbjct: 202 KGLQDRNAVENLRGKLVKVPRKDLV--PLPEGHYYIFEIIGLKVYDIDGAYLGKVTDVMQ 259

Query: 125 FGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
            G+  +  +++  ++  LIP  K  V E++L + +++I P
Sbjct: 260 TGSNDVYVVEDC-DRPLLIPAIKEVVKEIDLAQGRMVIKP 298


>gi|262401734|ref|ZP_06078300.1| 16S rRNA processing protein RimM [Vibrio sp. RC586]
 gi|262352151|gb|EEZ01281.1| 16S rRNA processing protein RimM [Vibrio sp. RC586]
          Length = 184

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 82/173 (47%), Gaps = 12/173 (6%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNR----ELRILKMYRK 56
           M K ++ +++  +G+++G+ G + + SY +NP  +  Y  +  D +    E ++    R 
Sbjct: 9   MGKQNERLVVGKLGSSYGIRGWLKVFSYTDNPESIFDYSPWFIDQKGEWVEYKVEGWKRH 68

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           NK ++    G+D    A  L + ++          EL EDEF+  +L  M+     G   
Sbjct: 69  NKGWVVKLQGLDVREDAHLLTNFEIAIDPASLP--ELSEDEFYWRELFGMQVVTTNGYDL 126

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTF-----LIPFTKFAVLE-VNLQENKILID 163
           G V  +   G+  +L +K  ++  F     LIPF +  V++ V+ Q  +I +D
Sbjct: 127 GVVTDMMETGSNDVLVVKANLKDAFGQKERLIPFLEEQVIKVVDRQAQRIEVD 179


>gi|326204804|ref|ZP_08194658.1| 16S rRNA processing protein RimM [Clostridium papyrosolvens DSM
           2782]
 gi|325985016|gb|EGD45858.1| 16S rRNA processing protein RimM [Clostridium papyrosolvens DSM
           2782]
          Length = 169

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/157 (24%), Positives = 78/157 (49%), Gaps = 6/157 (3%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKM--YRKNKRF-IAT 63
           +++  +  THG+ GE+   +  ++P    +   +Y + N  L    +   +  K+F I  
Sbjct: 5   LIVGQLVNTHGVKGELKATAQTDDPQRFRKLKWVYIDKNGSLEKCNISGVKFFKQFVIIK 64

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F GID+I  A +L+   L   R +    +L E+ FF  D+  ++ +D   +  G++  V 
Sbjct: 65  FEGIDSIEEAEKLKGFYLKVDRAN--AVKLPENSFFIADILGLKVYDENNQLLGELKDVI 122

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKI 160
             G+  +  ++++  K  L+P  K  V E++++E KI
Sbjct: 123 QTGSNDVYVVRDSEAKEILVPALKSVVKEISIEEGKI 159


>gi|114564083|ref|YP_751597.1| 16S rRNA-processing protein [Shewanella frigidimarina NCIMB 400]
 gi|122299044|sp|Q07Z06|RIMM_SHEFN RecName: Full=Ribosome maturation factor rimM
 gi|114335376|gb|ABI72758.1| 16S rRNA processing protein RimM [Shewanella frigidimarina NCIMB
           400]
          Length = 176

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 82/168 (48%), Gaps = 12/168 (7%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNP---IDLNRYVLYSND-NRELRILKMYRKNKRFI 61
           +LV++  +G++HG+ G + I SY ++     D + +++      RE+++ +   + K  +
Sbjct: 6   ELVVLGKLGSSHGIKGWLKITSYTDSVEGIFDYSPWLIKEQGVWREVKVAQWRFQGKAVV 65

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
           A   G+     A  L + ++    +  KD  L++ EF++ DL   E  +  G   G V  
Sbjct: 66  AELEGVATREHAQMLTNCEIAIMPEQMKD--LDDSEFYHRDLIGCEVTNINGYNMGIVDQ 123

Query: 122 VYNFGAGSILEIKNTMEKTF-----LIPFTKFAVL-EVNLQENKILID 163
           +   G+  +L IK   +  F     +IPF     + +V+LQ  +IL+D
Sbjct: 124 IVETGSNDVLLIKANAKDAFGKAERMIPFVPEQFIKQVDLQGKQILVD 171


>gi|291288181|ref|YP_003504997.1| 16S rRNA processing protein RimM [Denitrovibrio acetiphilus DSM
           12809]
 gi|290885341|gb|ADD69041.1| 16S rRNA processing protein RimM [Denitrovibrio acetiphilus DSM
           12809]
          Length = 169

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/166 (24%), Positives = 79/166 (47%), Gaps = 9/166 (5%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNP--IDLNRYVLYS---NDNRELRILKMYRKNKRF 60
           KL+ +  +  THGL+GE+ +     +P   D  +Y++ +   N    L I  M       
Sbjct: 2   KLIRVGRLINTHGLDGELVLQVLTESPEVFDDMQYMMLAVKGNVQASLEIEYMQEYKGNI 61

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +  F+G+++I +A + + +++    +   + +    E +  +LE    FD+ G+  G + 
Sbjct: 62  LVGFAGVEDIDTAKKYKGMEVVIPEEMLPELD---GEIYWHELEGCPVFDKNGELVGALA 118

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIA 166
                G   I  IK   ++ +LI      VLE+N++E K++ID I 
Sbjct: 119 DYMEAGGADIFRIKCE-DEYYLISNNTDHVLEINVKEKKLVIDRIG 163


>gi|289435136|ref|YP_003465008.1| 16S rRNA processing protein [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|289171380|emb|CBH27924.1| 16S rRNA processing protein [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
          Length = 172

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 84/174 (48%), Gaps = 9/174 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDS---YANNPIDL-NRYVLYSNDNR--ELRILKMYRKN 57
           ++K+  +  I  THGL GE+ + +   +A+    + N   L+  +++  E  I++ +RK+
Sbjct: 1   MEKMYNVGKIVNTHGLIGEIRVIATTDFADERFQVGNTVYLFEKNSKKPEKLIIRSHRKH 60

Query: 58  KRF-IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           K F +  F G   IH    +++  L    +   D  LEE+E++  ++         G+  
Sbjct: 61  KNFDLLMFEGFTGIHQVERMKEGTLKITEKQLTD--LEENEYYFHEIIGCIVVTTDGEEL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           G++  +   GA  +  +K    K  LIP+ +  V E+N+ + KI I  +   L+
Sbjct: 119 GEITEILTPGANDVWVVKGKDNKEKLIPYIEEVVKEINISDKKITIKVMEGLLD 172


>gi|314936599|ref|ZP_07843946.1| 16S rRNA processing protein RimM [Staphylococcus hominis subsp.
           hominis C80]
 gi|313655218|gb|EFS18963.1| 16S rRNA processing protein RimM [Staphylococcus hominis subsp.
           hominis C80]
          Length = 166

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 84/167 (50%), Gaps = 9/167 (5%)

Query: 8   VLMATIGTTHGLNGEVYIDS---YANNPIDLNRYVLYSNDNRELRI-LKMYRKNKRF-IA 62
           V +  I  THG+ GEV + S   + +        ++ ++ + E+ + +  YR +K F + 
Sbjct: 3   VEVGQIVNTHGIKGEVKVKSNSDFTDTRFQPGEVLIVNHHHNEIEMTITSYRIHKGFHML 62

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F GI++I+   + +   L+ +R D +D EL E+EF+ +D+     F+      G+V  +
Sbjct: 63  KFEGINHINDVEQYKGDYLFQER-DHEDIELNENEFYYSDIIGCTVFNNDTPI-GRVINI 120

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           +  GA  +  +K   +K +LIP+    V EV+++   I I  +   L
Sbjct: 121 FETGANDVWVVKG--DKEYLIPYIADVVKEVDVEHKTIRITSMEGLL 165


>gi|163847612|ref|YP_001635656.1| 16S rRNA processing protein RimM [Chloroflexus aurantiacus J-10-fl]
 gi|222525468|ref|YP_002569939.1| 16S rRNA processing protein RimM [Chloroflexus sp. Y-400-fl]
 gi|163668901|gb|ABY35267.1| 16S rRNA processing protein RimM [Chloroflexus aurantiacus J-10-fl]
 gi|222449347|gb|ACM53613.1| 16S rRNA processing protein RimM [Chloroflexus sp. Y-400-fl]
          Length = 169

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 80/171 (46%), Gaps = 6/171 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY---VLYSNDNRELRILKMY-RKNKR 59
           +D L+ +  +G   G+ G++ + S +++P  L R+   V         ++ ++Y  K   
Sbjct: 1   MDDLLYIGALGAPFGVRGQIRLHSISSHPEHLIRHLRTVFIGPKRVPHQVSRLYMHKPGL 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I     I +  +A++LR  ++Y          L  DEFF  D+  M+     G+  G+V
Sbjct: 61  LIIQLQTITDRDAAADLRGEEVYIAAA--DAAPLAADEFFYHDVIGMQAVTDSGEDIGEV 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
             +   GAG I+ I        L+P  +  ++ +++ E +++I PIA  L+
Sbjct: 119 RDILETGAGEIVVITRRGRPDALVPMVRDFIVAIDVGERRLVIRPIAGLLD 169


>gi|229829007|ref|ZP_04455076.1| hypothetical protein GCWU000342_01092 [Shuttleworthia satelles DSM
           14600]
 gi|229792170|gb|EEP28284.1| hypothetical protein GCWU000342_01092 [Shuttleworthia satelles DSM
           14600]
          Length = 172

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 72/159 (45%), Gaps = 8/159 (5%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPI---DLNRYVLYSNDN---RELRILKMYRKNKRFIAT 63
           +  I +THGL GEV +           DL    +Y+  +    EL I+ +    K+ I  
Sbjct: 7   VGVITSTHGLKGEVKVYPTTEESRRFDDLCGQKVYAGRDGSLEELTIVSVRYFKKQVILR 66

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F+  +NI   S LR  +L   R+  +   LEE E++  DL  ++     G+  G +  V 
Sbjct: 67  FAEKNNIDEVSSLRQARLLISRE--QALPLEEGEYYVADLLGLKVVADDGRELGILTDVL 124

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
             GA  +  I    +   +IP  +  VL+ +L+  +IL+
Sbjct: 125 TTGANDVYVIGRQGQSDLMIPAIRQCVLKTDLEAGEILV 163


>gi|262164014|ref|ZP_06031753.1| 16S rRNA processing protein RimM [Vibrio mimicus VM223]
 gi|262027542|gb|EEY46208.1| 16S rRNA processing protein RimM [Vibrio mimicus VM223]
          Length = 182

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 83/173 (47%), Gaps = 12/173 (6%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNR----ELRILKMYRK 56
           M K ++ +++  +G+++G+ G + + SY +NP  +  Y  +  + +    E ++    R 
Sbjct: 7   MSKQNEKLVVGKLGSSYGIRGWLKVFSYTDNPESIFDYSPWFIEQKGEWVEYKVEGWKRH 66

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           NK ++    G+D    A  L + ++    +     EL EDEF+  +L  M+     G   
Sbjct: 67  NKGWVVKLQGLDVREDAHLLTNFEIAIDPESLP--ELSEDEFYWRELFGMQVVTTSGYNL 124

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTF-----LIPFTKFAVLE-VNLQENKILID 163
           G V  +   G+  +L +K  ++  F     LIPF +  V++ V+ Q  +I +D
Sbjct: 125 GVVTDMMETGSNDVLVVKANLKDAFGQKERLIPFLEEQVIKVVDRQAQRIEVD 177


>gi|296139336|ref|YP_003646579.1| 16S rRNA processing protein RimM [Tsukamurella paurometabola DSM
           20162]
 gi|296027470|gb|ADG78240.1| 16S rRNA processing protein RimM [Tsukamurella paurometabola DSM
           20162]
          Length = 173

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/164 (21%), Positives = 68/164 (41%), Gaps = 8/164 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNP-------IDLNRYVLYSNDNRELRILKMYRKNKRF 60
           +++  +  +HG+ GE+ +D   ++P         L      + D +   +      + R 
Sbjct: 3   LVVGRVAKSHGIRGEIVVDVRTDSPELRFADGAVLTGRRPRAKDTQTYTVAASREHSGRL 62

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +    G+ +  +A ELR         D +  + + DEF++ +LE +      G   G + 
Sbjct: 63  LVRLEGVTDRTAADELRGTLFVIDSADVQPSD-DPDEFYDHELEGLAVRTADGTEVGVIA 121

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
            V +   G +L +K    +  LIPF    V  V++    I IDP
Sbjct: 122 EVLHPPGGELLSVKAPDGREILIPFVTAIVPVVDVAGGFIEIDP 165


>gi|229821021|ref|YP_002882547.1| 16S rRNA processing protein RimM [Beutenbergia cavernae DSM 12333]
 gi|229566934|gb|ACQ80785.1| 16S rRNA processing protein RimM [Beutenbergia cavernae DSM 12333]
          Length = 182

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/166 (22%), Positives = 74/166 (44%), Gaps = 15/166 (9%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRE------LRILKMYRKNK 58
           D  V++A +G   GL GEV +    +   D NR    +    +      L I ++ R   
Sbjct: 7   DDDVVLARLGAALGLRGEVRLTVRTD---DENRLAPGTKVRTDPPAAGPLTIARLRRTGA 63

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
            ++  F+ I +  +A  LR ++L A+ +      +++D ++  +L  +E     G   G+
Sbjct: 64  GYVIAFAEIADRTAAEALRGVELVAEPR------VDDDAWYPRELVGLEAVTPDGHVLGE 117

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           V  V +  A  +L +        L+PF    V  V++   ++++DP
Sbjct: 118 VVAVEHPPAHDVLVVVEPSGAHALVPFVTALVPSVDVAAGRVVVDP 163


>gi|256832219|ref|YP_003160946.1| 16S rRNA processing protein RimM [Jonesia denitrificans DSM 20603]
 gi|256685750|gb|ACV08643.1| 16S rRNA processing protein RimM [Jonesia denitrificans DSM 20603]
          Length = 184

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 67/159 (42%), Gaps = 8/159 (5%)

Query: 10  MATIGTTHGLNGEVYIDSYANNP----IDLNRYVLYSNDNRELRILKMYRKNKRFIATFS 65
           + TIG  HGL+GEV +    + P    +  ++      D   L + +      R+  TF 
Sbjct: 5   IGTIGKAHGLHGEVSVIVTTDVPQERFVPGHKIATQPADRGPLTVTRQRAHQDRWYVTFE 64

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNF 125
            I +   A   R ++L  +     D   E+D ++  +LE +E     G   G+V G+   
Sbjct: 65  EIPDRTVAESYRGVELVIE----VDHSDEDDAWYPHELEGLEVRRLSGARVGRVAGLEPL 120

Query: 126 GAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
            A   L I     +   +PF K  V  V++    ++IDP
Sbjct: 121 PAQDALIIDEDGGERVYLPFLKIFVPTVDVAGGYVVIDP 159


>gi|258623028|ref|ZP_05718041.1| 16S rRNA-processing protein [Vibrio mimicus VM573]
 gi|258623818|ref|ZP_05718775.1| 16S rRNA-processing protein [Vibrio mimicus VM603]
 gi|258583941|gb|EEW08733.1| 16S rRNA-processing protein [Vibrio mimicus VM603]
 gi|258584641|gb|EEW09377.1| 16S rRNA-processing protein [Vibrio mimicus VM573]
          Length = 184

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 83/173 (47%), Gaps = 12/173 (6%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNR----ELRILKMYRK 56
           M K ++ +++  +G+++G+ G + + SY +NP  +  Y  +  + +    E ++    R 
Sbjct: 9   MSKQNEKLVVGKLGSSYGIRGWLKVFSYTDNPESIFDYSPWFIEQKGEWVEYKVEGWKRH 68

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           NK ++    G+D    A  L + ++    +     EL EDEF+  +L  M+     G   
Sbjct: 69  NKGWVVKLQGLDVREDAHLLTNFEIAIDPESLP--ELSEDEFYWRELFGMQVVTTSGYDL 126

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTF-----LIPFTKFAVLE-VNLQENKILID 163
           G V  +   G+  +L +K  ++  F     LIPF +  V++ V+ Q  +I +D
Sbjct: 127 GVVTDMMETGSNDVLVVKANLKDAFGQKERLIPFLEEQVIKVVDRQAQRIEVD 179


>gi|330959142|gb|EGH59402.1| 16S rRNA-processing protein RimM [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 179

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 83/168 (49%), Gaps = 11/168 (6%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYAN---NPIDLNRYVLYSNDNRELRI-LKMYRKNKRF 60
           D L+++  I + HG+ GEV + S+ +   N +D   + L    + E ++ L   R   +F
Sbjct: 9   DDLIVIGKIYSVHGVRGEVKVYSFTDPIGNLLDYKTWTLRREGSVEKQVELVSGRLQSKF 68

Query: 61  IAT-FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
           + T   G+D+   A  L    +   R  F D  L++ E++   LE ++  D+ G+  G++
Sbjct: 69  LVTKLKGLDDREEARLLSGYDICVPRNLFPD--LDDGEYYWYQLEGLKVIDQLGQLLGKI 126

Query: 120 CGVYNFGAGSILEIKNTM----EKTFLIPFTKFAVLEVNLQENKILID 163
             +   G+  ++ +K       ++  L+P+T+  VL V++   ++ +D
Sbjct: 127 DHLLETGSNDVMVVKPCAGSLDDRERLLPYTEQCVLAVDMGAGEMKVD 174


>gi|254776207|ref|ZP_05217723.1| 16S rRNA-processing protein RimM [Mycobacterium avium subsp. avium
           ATCC 25291]
          Length = 175

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/159 (22%), Positives = 66/159 (41%), Gaps = 11/159 (6%)

Query: 16  THGLNGEVYIDSYANNPI-------DLNRYVLYSNDNRELRILKMYRKNKRFIATFSGID 68
            HG++GE+ ++   ++P         L          R   I        R +   +G+ 
Sbjct: 11  AHGISGEIVVEIRTDDPAARLAPGNTLRAKPSRGGPERSCVIESAREHGGRLLVRLAGVT 70

Query: 69  NIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFGAG 128
           +  +A  LR         +  D + E D +++  LE ++     G+  G V  V +  AG
Sbjct: 71  DRDAADALRGTLFVVDSAELPDID-EPDTYYDHQLEGLQVRTTGGRRVGAVAEVLHTAAG 129

Query: 129 SILEIKNTME---KTFLIPFTKFAVLEVNLQENKILIDP 164
            +L +++  +   +  L+PF    V  V+L++  I IDP
Sbjct: 130 ELLAVRDDADGAPREVLVPFVSAIVTAVSLEDGLIEIDP 168


>gi|153954029|ref|YP_001394794.1| 16S rRNA-processing protein RimM [Clostridium kluyveri DSM 555]
 gi|229485583|sp|A5N815|RIMM_CLOK5 RecName: Full=Ribosome maturation factor rimM
 gi|146346910|gb|EDK33446.1| Hypothetical protein CKL_1404 [Clostridium kluyveri DSM 555]
          Length = 162

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 81/169 (47%), Gaps = 24/169 (14%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELR------ILK----MYRK 56
            + +  I  THGL GE+ +    +   D+NR+       +EL+      ILK       +
Sbjct: 4   FITVGQIINTHGLKGELKVYPLTD---DINRF-------KELKSVYVEGILKNITGCKLQ 53

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           +K+ I    GID+I  A E +   L   R++    +LEE  +F  D+      D +G ++
Sbjct: 54  SKKVILKIEGIDSIEKALEYKGKYLEVSRENAV--KLEEGRYFIVDIVGCRVIDEEGVFY 111

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPI 165
           G++  V +     +  IK   E   LIP  +  VL+V++++ +I+I P+
Sbjct: 112 GKISEVIHTHRNDVYWIKGDNE--LLIPAIENVVLKVDVEKQEIIIKPV 158


>gi|262172353|ref|ZP_06040031.1| 16S rRNA processing protein RimM [Vibrio mimicus MB-451]
 gi|261893429|gb|EEY39415.1| 16S rRNA processing protein RimM [Vibrio mimicus MB-451]
          Length = 176

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 83/173 (47%), Gaps = 12/173 (6%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNR----ELRILKMYRK 56
           M K ++ +++  +G+++G+ G + + SY +NP  +  Y  +  + +    E ++    R 
Sbjct: 1   MSKQNEKLVVGKLGSSYGIRGWLKVFSYTDNPESIFDYSPWFIEQKGEWVEYKVEGWKRH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           NK ++    G+D    A  L + ++    +     EL EDEF+  +L  M+     G   
Sbjct: 61  NKGWVVKLQGLDVREDAHLLTNFEIAIDPESLP--ELSEDEFYWRELFGMQVVTTSGYDL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTF-----LIPFTKFAVLE-VNLQENKILID 163
           G V  +   G+  +L +K  ++  F     LIPF +  V++ V+ Q  +I +D
Sbjct: 119 GVVTDMMETGSNDVLVVKANLKDAFGQKERLIPFLEEQVIKVVDRQAQRIEVD 171


>gi|285017747|ref|YP_003375458.1| 16s rrna-processing protein [Xanthomonas albilineans GPE PC73]
 gi|283472965|emb|CBA15470.1| probable 16s rrna-processing protein [Xanthomonas albilineans]
          Length = 170

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 76/164 (46%), Gaps = 10/164 (6%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY---VLYSNDNRE--LRILKMYRKNKRF 60
           + +L+  +    G+ GE  ++S+    + + RY   ++   D  E  L  ++     K  
Sbjct: 6   RRILLGRVLGAFGIRGEAKLESWTEPRLAIFRYQPWIVRKPDGSESTLTGVRGRASGKSL 65

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           IA+   + +  +   LR  ++Y  R          DE++  DLE ++    +G   GQV 
Sbjct: 66  IASLPEVSDRDAVEALRGTEIYVTRSSLPPPH--PDEYYWVDLEGLDVRTVEGVALGQVS 123

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKF-AVLEVNLQENKILID 163
            +++ GA  +L ++   E+  L+PF +   V  V+ + N I++D
Sbjct: 124 HLFSTGANDVLVVRGERER--LVPFVQPDYVRSVDFEANLIVVD 165


>gi|220905064|ref|YP_002480376.1| 16S rRNA processing protein RimM [Desulfovibrio desulfuricans
           subsp. desulfuricans str. ATCC 27774]
 gi|219869363|gb|ACL49698.1| 16S rRNA processing protein RimM [Desulfovibrio desulfuricans
           subsp. desulfuricans str. ATCC 27774]
          Length = 168

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 73/161 (45%), Gaps = 11/161 (6%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS---NDNRELRILKMYRKNKRFIATFSG 66
           M T+   HG+ GE+ ID YA++P+ L   +       + R +R + +     R +    G
Sbjct: 1   MGTLARPHGIKGEICIDWYADSPLLLTTPLWIQAGDGEPRRVRQVAVRSHKGRPLLQLEG 60

Query: 67  IDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFG 126
           + + ++   LR  KL  KR+     E E+DE +  DL   + F   GK  G +   + + 
Sbjct: 61  VVDRNAVEGLRGCKLLTKREALP--EPEDDEVYLEDLLGGDVFLPDGKRLGTL-DHFEYP 117

Query: 127 AGSILEIKNTME---KTFLIPFTKFAVLEVNLQENKILIDP 164
           AG  LE+   M    +  L P     +   +L+   ++IDP
Sbjct: 118 AG--LEMWVIMTDDNREVLFPARPEFIAGFDLEGPAVIIDP 156


>gi|66044531|ref|YP_234372.1| 16S rRNA-processing protein RimM [Pseudomonas syringae pv. syringae
           B728a]
 gi|75503052|sp|Q4ZWY8|RIMM_PSEU2 RecName: Full=Ribosome maturation factor rimM
 gi|63255238|gb|AAY36334.1| RimM protein:PRC-barrel [Pseudomonas syringae pv. syringae B728a]
 gi|330969026|gb|EGH69092.1| 16S rRNA-processing protein RimM [Pseudomonas syringae pv. aceris
           str. M302273PT]
          Length = 179

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/168 (20%), Positives = 85/168 (50%), Gaps = 11/168 (6%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYAN---NPIDLNRYVLY--SNDNRELRILKMYRKNKR 59
           D L+++  I + HG+ GEV + S+ +   N +D   + L    + ++++ ++    ++K 
Sbjct: 9   DDLIVIGKIYSVHGVRGEVKVYSFTDPIGNLLDYKTWTLRREGSVDKQVELVSGRLQSKF 68

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +    G+D+   A  L   ++   R  F D  L++ E++   LE ++  D+ G+  G++
Sbjct: 69  LVTKLKGLDDREEARLLSGYEICVPRNLFPD--LDDGEYYWYQLEGLKVIDQLGQLLGKI 126

Query: 120 CGVYNFGAGSILEIKNTM----EKTFLIPFTKFAVLEVNLQENKILID 163
             +   G+  ++ +K       ++  L+P+T+  VL +++   ++ +D
Sbjct: 127 DHLLETGSNDVMVVKPCAGSLDDRERLLPYTEQCVLAIDMAAGEMKVD 174


>gi|323526928|ref|YP_004229081.1| 16S rRNA processing protein RimM [Burkholderia sp. CCGE1001]
 gi|323383930|gb|ADX56021.1| 16S rRNA processing protein RimM [Burkholderia sp. CCGE1001]
          Length = 244

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 76/171 (44%), Gaps = 17/171 (9%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNP------IDLNRYVLYSNDNRE-LRILKMYRKNKRF 60
           V +  I   +GL G V + ++A+        +   R+ L     R+    L+    +   
Sbjct: 71  VEVGAIVDAYGLKGWVKVAAHADAGRGGDALLSAKRWWLMKGRERQSAPSLQAKLHSDSV 130

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +A   G+ +  +A  LR  ++Y  R +F    LE DEF+  DL  +E  +  G   G+V 
Sbjct: 131 VAHLGGVADRDAALALRGSRVYISRSEFP--ALEADEFYWVDLIGLEVVNLAGANLGKVA 188

Query: 121 GVYNFGAGSILEIK-NTMEKTF-------LIPFTKFAVLEVNLQENKILID 163
           G+ + GA S+L ++    +KT        LIPF    V  V+    +I +D
Sbjct: 189 GMIDNGAHSVLRVEYPAADKTGKPVAAERLIPFVGVFVKAVDQAAKQITVD 239


>gi|209694241|ref|YP_002262169.1| 16S rRNA-processing protein RimM [Aliivibrio salmonicida LFI1238]
 gi|238058947|sp|B6EGC0|RIMM_ALISL RecName: Full=Ribosome maturation factor rimM
 gi|208008192|emb|CAQ78335.1| 16S rRNA processing protein RimM [Aliivibrio salmonicida LFI1238]
          Length = 175

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/161 (23%), Positives = 75/161 (46%), Gaps = 10/161 (6%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNP---IDLNRYVLYSNDNRELRILKMYRKN 57
           M K D+++++   G ++G+ G + + S+ + P    D    ++   D      ++ ++++
Sbjct: 1   MSKQDEVIVVGKFGASYGIRGWLKVVSFTDQPESIFDYKPLLIKVKDEWVEFSVESWKRH 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
           K  +    G++    A    +L++  K       EL EDEF+  +L  ME    QG   G
Sbjct: 61  KGLVCKLEGLEVREEAQAYTNLEIAVKADALP--ELSEDEFYWRELFGMEVVTSQGYGLG 118

Query: 118 QVCGVYNFGAGSILEIKNTMEKTF-----LIPFTKFAVLEV 153
            V  ++  G+  +L +K  ++  F     LIPF    V++V
Sbjct: 119 IVDDIFETGSNDVLVVKANLKDAFGKKERLIPFIDEQVIKV 159


>gi|330895931|gb|EGH28215.1| 16S rRNA-processing protein RimM [Pseudomonas syringae pv. japonica
           str. M301072PT]
 gi|330950743|gb|EGH51003.1| 16S rRNA-processing protein RimM [Pseudomonas syringae Cit 7]
 gi|330975466|gb|EGH75532.1| 16S rRNA-processing protein RimM [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 179

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/168 (20%), Positives = 85/168 (50%), Gaps = 11/168 (6%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYAN---NPIDLNRYVLY--SNDNRELRILKMYRKNKR 59
           D L+++  I + HG+ GEV + S+ +   N +D   + L    + ++++ ++    ++K 
Sbjct: 9   DDLIVIGKIYSVHGVRGEVKVYSFTDPIGNLLDYKTWTLRREGSVDKQVELVSGRLQSKF 68

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +    G+D+   A  L   ++   R  F D  L++ E++   LE ++  D+ G+  G++
Sbjct: 69  LVTKLKGLDDREEARLLSGYEICVPRNLFPD--LDDGEYYWYQLEGLKVIDQLGQLLGKI 126

Query: 120 CGVYNFGAGSILEIKNTM----EKTFLIPFTKFAVLEVNLQENKILID 163
             +   G+  ++ +K       ++  L+P+T+  VL +++   ++ +D
Sbjct: 127 DHLLETGSNDVMVVKPCAGSLDDRERLLPYTEQCVLAIDMAAGEMKVD 174


>gi|227543209|ref|ZP_03973258.1| 16S rRNA-processing protein [Corynebacterium glucuronolyticum ATCC
           51866]
 gi|227181018|gb|EEI61990.1| 16S rRNA-processing protein [Corynebacterium glucuronolyticum ATCC
           51866]
          Length = 227

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 71/159 (44%), Gaps = 17/159 (10%)

Query: 16  THGLNGEVYIDSYANNPIDLNRYV-------LYSNDNRELRILKMYRKNKRFIATFSGID 68
           THG+ GEV +D   ++ +D   YV             ++L I  M     R +  F  I 
Sbjct: 69  THGIKGEVVVDPTTDD-LDQRFYVGAVLTGRAGGGKEQQLTIQSMRPHQGRLLVKFEEIP 127

Query: 69  NIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFGAG 128
           +  +   LR ++ +A   +    + EED +++ +LE +     +G   G+V  + +  A 
Sbjct: 128 DRTAGESLRGMQFFAPPLEH---DPEEDGYYDHELEGLAVI-HEGTRVGEVTDITHGPAA 183

Query: 129 SILEIKNTM---EKTFLIPFTKFAVLEVNLQENKILIDP 164
           ++L +  TM   E+  LIP     V E+NL E    I P
Sbjct: 184 TLLTV--TMDEDERDVLIPLVDAIVPEINLGEKTATITP 220


>gi|254522928|ref|ZP_05134983.1| 16S rRNA processing protein RimM [Stenotrophomonas sp. SKA14]
 gi|219720519|gb|EED39044.1| 16S rRNA processing protein RimM [Stenotrophomonas sp. SKA14]
          Length = 173

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/169 (21%), Positives = 81/169 (47%), Gaps = 10/169 (5%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY---VLYSNDNRELRI--LKMYR 55
           M  +++ +L+  +    G+ GE+ ++S+      + RY   ++ S    E  I  ++   
Sbjct: 4   MKDIERRILLGRVVGAFGVRGEIKLESWTEPRSAIFRYQPWIVRSPSGVETTIEGVRGRD 63

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
             K  +A F G+++  +   +   ++Y  R      +   DE++  DLE ++    +G  
Sbjct: 64  SGKHLVARFPGVEDRDTVEAMHGTEVYVARSALPPPK--PDEYYWVDLEGLDVKTTEGVA 121

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFA-VLEVNLQENKILID 163
            GQV  +++ GA  ++ ++   E+  +IPF +   V  V+ + N +++D
Sbjct: 122 LGQVSHLFSTGANDVVVVRGDRER--MIPFVQPDFVKSVDFEANLVVVD 168


>gi|227488606|ref|ZP_03918922.1| 16S rRNA-processing protein [Corynebacterium glucuronolyticum ATCC
           51867]
 gi|227091500|gb|EEI26812.1| 16S rRNA-processing protein [Corynebacterium glucuronolyticum ATCC
           51867]
          Length = 172

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 70/157 (44%), Gaps = 13/157 (8%)

Query: 16  THGLNGEVYIDSYANNPIDLNRYV-------LYSNDNRELRILKMYRKNKRFIATFSGID 68
           THG+ GEV +D   ++ +D   YV             ++L I  M     R +  F  I 
Sbjct: 14  THGIKGEVVVDPTTDD-LDQRFYVGAVLTGRAGGGKEQQLTIQSMRPHQGRLLVKFEEIP 72

Query: 69  NIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFGAG 128
           +  +   LR ++ +A   +    + EED +++ +LE +     +G   G+V  + +  A 
Sbjct: 73  DRTAGESLRGMQFFAPPLEH---DPEEDGYYDHELEGLAVI-HEGTRVGEVTDITHGPAA 128

Query: 129 SILEIK-NTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           ++L +  +  E+  LIP     V E+NL E    I P
Sbjct: 129 TLLTVTMDEDERDVLIPLVDAIVPEINLGEKTATITP 165


>gi|126173449|ref|YP_001049598.1| 16S rRNA-processing protein RimM [Shewanella baltica OS155]
 gi|152999788|ref|YP_001365469.1| 16S rRNA-processing protein RimM [Shewanella baltica OS185]
 gi|160874407|ref|YP_001553723.1| 16S rRNA-processing protein RimM [Shewanella baltica OS195]
 gi|217974259|ref|YP_002359010.1| 16S rRNA-processing protein RimM [Shewanella baltica OS223]
 gi|304409372|ref|ZP_07390992.1| 16S rRNA processing protein RimM [Shewanella baltica OS183]
 gi|307303730|ref|ZP_07583483.1| 16S rRNA processing protein RimM [Shewanella baltica BA175]
 gi|171704554|sp|A6WKR7|RIMM_SHEB8 RecName: Full=Ribosome maturation factor rimM
 gi|171769975|sp|A3D1W6|RIMM_SHEB5 RecName: Full=Ribosome maturation factor rimM
 gi|189040852|sp|A9L5P6|RIMM_SHEB9 RecName: Full=Ribosome maturation factor rimM
 gi|254797761|sp|B8EBP2|RIMM_SHEB2 RecName: Full=Ribosome maturation factor rimM
 gi|125996654|gb|ABN60729.1| 16S rRNA processing protein RimM [Shewanella baltica OS155]
 gi|151364406|gb|ABS07406.1| 16S rRNA processing protein RimM [Shewanella baltica OS185]
 gi|160859929|gb|ABX48463.1| 16S rRNA processing protein RimM [Shewanella baltica OS195]
 gi|217499394|gb|ACK47587.1| 16S rRNA processing protein RimM [Shewanella baltica OS223]
 gi|304351890|gb|EFM16288.1| 16S rRNA processing protein RimM [Shewanella baltica OS183]
 gi|306912628|gb|EFN43051.1| 16S rRNA processing protein RimM [Shewanella baltica BA175]
 gi|315266642|gb|ADT93495.1| 16S rRNA processing protein RimM [Shewanella baltica OS678]
          Length = 176

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 80/166 (48%), Gaps = 12/166 (7%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNP---IDLNRYVLYSN-DNRELRILKMYRKNKRFIAT 63
           V++  +G+ HG+ G + I +Y ++     D + +++  N + RE+++ +   + K  +A 
Sbjct: 8   VVLGKLGSCHGIKGWLKITAYTDSVEGIFDYSPWLIKENGEWREIKVTQWRYQGKAVVAL 67

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
             G++    A  L + ++    +   D  L  DEF+  DL   E  +  G   G V  + 
Sbjct: 68  LDGVETREQAQMLTNCEIAILPEQMND--LPADEFYWRDLIGCEVVNTTGYNMGIVDQIV 125

Query: 124 NFGAGSILEIKNTMEKTF-----LIPFTKFAVLE-VNLQENKILID 163
             G+  +L +K   + +F     +IPF     ++ V+LQ  +IL+D
Sbjct: 126 ETGSNDVLLVKANAKDSFGKVERMIPFVPEQFIKTVDLQGKQILVD 171


>gi|302185526|ref|ZP_07262199.1| 16S rRNA-processing protein RimM [Pseudomonas syringae pv. syringae
           642]
          Length = 179

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/168 (20%), Positives = 85/168 (50%), Gaps = 11/168 (6%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYAN---NPIDLNRYVLY--SNDNRELRILKMYRKNKR 59
           D L+++  I + HG+ GEV + S+ +   N +D   + L    + ++++ ++    ++K 
Sbjct: 9   DDLIVIGKIYSVHGVRGEVKVFSFTDPIGNLLDYKTWTLRREGSVDKQVELVSGRLQSKF 68

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +    G+D+   A  L   ++   R  F D  L++ E++   LE ++  D+ G+  G++
Sbjct: 69  LVTKLKGLDDREEARLLSGYEICVPRNLFPD--LDDGEYYWYQLEGLKVIDQLGQLLGKI 126

Query: 120 CGVYNFGAGSILEIKNTM----EKTFLIPFTKFAVLEVNLQENKILID 163
             +   G+  ++ +K       ++  L+P+T+  VL +++   ++ +D
Sbjct: 127 DHLLETGSNDVMVVKPCAGSLDDRERLLPYTEQCVLAIDMAAGEMKVD 174


>gi|217076195|ref|YP_002333911.1| 16S rRNA processing protein RimM [Thermosipho africanus TCF52B]
 gi|226734093|sp|B7IEQ6|RIMM_THEAB RecName: Full=Ribosome maturation factor rimM
 gi|217036048|gb|ACJ74570.1| 16S rRNA processing protein RimM [Thermosipho africanus TCF52B]
          Length = 178

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/163 (23%), Positives = 77/163 (47%), Gaps = 12/163 (7%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPI---DLNRYVLYSNDNRELRILKMYRKNKR----- 59
           V +A +G THGL GE+ +  + N P     L    LY+   ++  +  +  +N R     
Sbjct: 13  VAVAILGKTHGLKGELKLHPFTNFPEIIESLEEIFLYNEKTKQFMVATV--ENLRLADGY 70

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
           +I   +G++N+ +A +    K+Y  + +  +  L +DE++  ++   +  D  GK  G V
Sbjct: 71  YIIKLNGVENVENARKFVGSKVYINKDELPN--LSKDEYYFFEIVGSQVIDESGKVLGVV 128

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
             V   G+  ++ +    E   LIP     ++ ++ +  KI++
Sbjct: 129 DEVIQTGSNDVIVVNKNKEDEILIPVIYDYIITLDKENKKIVV 171


>gi|118594350|ref|ZP_01551697.1| 16S rRNA processing protein RimM [Methylophilales bacterium
           HTCC2181]
 gi|118440128|gb|EAV46755.1| 16S rRNA processing protein RimM [Methylophilales bacterium
           HTCC2181]
          Length = 167

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/164 (22%), Positives = 80/164 (48%), Gaps = 9/164 (5%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY--VLYSNDNREL---RILKMYRKNKR 59
           D +V+M  I   HG+ G + +  +      L+ Y   L S D +     ++     K+K 
Sbjct: 3   DDVVIMGKIVGPHGIKGWLKVHPFTEEIGTLSNYPQWLISKDEKHWVGHKVETATVKDKT 62

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +    GID+ + +  +    +   +++    +L+ D ++ +DL  ++  +  G Y+G +
Sbjct: 63  LLVKLVGIDDRNGSDSVNKNMVGILKEELP--KLDADTYYWSDLIGLDVQNEAGYYFGSI 120

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
             +   G+  ++ IK   E+ FLIP+    +++V+L+  K+L+D
Sbjct: 121 QTMMETGSNDVMVIKG--EREFLIPYLPDVIIKVDLEAKKVLVD 162


>gi|49081574|gb|AAT50187.1| PA3744 [synthetic construct]
          Length = 176

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/167 (22%), Positives = 78/167 (46%), Gaps = 10/167 (5%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYAN---NPIDLNRYVLYSNDN-RELRILKMYRKNKRF 60
           D LV++  I + +G+ GEV + S+ +   N +D  R+ L  +   R+  +++     K  
Sbjct: 6   DDLVVIGKIVSVYGIRGEVKVYSFTDPLDNLLDYRRWTLRRDGEIRQAELVRGRLHGKVL 65

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
            A   G+D+   A      ++   R +     LEE E++   LE ++  D+  +  G + 
Sbjct: 66  AAKLKGLDDREEARTFTGYEICIPRSELP--SLEEGEYYWHQLEGLKVIDQGRQLLGVID 123

Query: 121 GVYNFGAGSILEIKNTM----EKTFLIPFTKFAVLEVNLQENKILID 163
            +   GA  ++ +K       ++  L+P+T   VL ++L   ++ +D
Sbjct: 124 HLLETGANDVMVVKPCAGSLDDRERLLPYTGQCVLSIDLAAGEMRVD 170


>gi|219854643|ref|YP_002471765.1| hypothetical protein CKR_1300 [Clostridium kluyveri NBRC 12016]
 gi|219568367|dbj|BAH06351.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 166

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 81/169 (47%), Gaps = 24/169 (14%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELR------ILK----MYRK 56
            + +  I  THGL GE+ +    +   D+NR+       +EL+      ILK       +
Sbjct: 8   FITVGQIINTHGLKGELKVYPLTD---DINRF-------KELKSVYVEGILKNITGCKLQ 57

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           +K+ I    GID+I  A E +   L   R++    +LEE  +F  D+      D +G ++
Sbjct: 58  SKKVILKIEGIDSIEKALEYKGKYLEVSREN--AVKLEEGRYFIVDIVGCRVIDEEGVFY 115

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPI 165
           G++  V +     +  IK   E   LIP  +  VL+V++++ +I+I P+
Sbjct: 116 GKISEVIHTHRNDVYWIKGDNE--LLIPAIENVVLKVDVEKQEIIIKPV 162


>gi|78224065|ref|YP_385812.1| 16S rRNA processing protein RimM [Geobacter metallireducens GS-15]
 gi|109893018|sp|Q39RN7|RIMM_GEOMG RecName: Full=Ribosome maturation factor rimM
 gi|78195320|gb|ABB33087.1| 16S rRNA processing protein RimM [Geobacter metallireducens GS-15]
          Length = 173

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/169 (23%), Positives = 79/169 (46%), Gaps = 8/169 (4%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYA---NNPIDLNRYVLYSNDNRE--LRILKMYR 55
           M+    LVL+  +  THG+ G++ +  ++   +  + +    L   DNR+    + +   
Sbjct: 1   MLGSTDLVLLGKVVATHGIRGQLSVVPFSGEFSTILSMQTVYLSGPDNRKESFEVDRAAV 60

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
              R + T  G  NI+    L   +L+A+R  F    L+E EF+  DL  +     +G  
Sbjct: 61  HRNRVLLTLKGFANINEVLHLVGRELFARRDQFP--PLDEGEFYWCDLIGLSVTTSEGLS 118

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
            G++  +   G+  +  +++  E+ +LIP  +  V+ V+L +  + + P
Sbjct: 119 LGRIEEIIATGSNDVYVVRDG-EREYLIPALEDIVVGVDLDKGIMTVSP 166


>gi|53802419|ref|YP_112924.1| 16S rRNA processing protein RimM [Methylococcus capsulatus str.
           Bath]
 gi|59798629|sp|Q60BS2|RIMM_METCA RecName: Full=Ribosome maturation factor rimM
 gi|53756180|gb|AAU90471.1| 16S rRNA processing protein RimM [Methylococcus capsulatus str.
           Bath]
          Length = 172

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/164 (22%), Positives = 73/164 (44%), Gaps = 9/164 (5%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRF 60
           D+ V++  +    G+ G V   S+ + P++L  Y  ++    +  R   +L+        
Sbjct: 8   DRSVVVGRVSGAFGVRGWVKAVSFTDPPVNLVGYRPWTLRRGDAERRADVLEGREHGNAV 67

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           I    G+D    A  L+  ++  +R           E++  DL  ++  +      G+V 
Sbjct: 68  IVRLQGVDTREQAEALKGFEVTVRRSQLPPPA--PGEYYRVDLVGLKVVNLGETVLGEVV 125

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFA-VLEVNLQENKILID 163
            V   GA  +L ++   E+  L+PF +   V  VNL+E++I++D
Sbjct: 126 DVMETGANDVLVVQGDRER--LLPFVQGVFVKSVNLEESRIVVD 167


>gi|15598939|ref|NP_252433.1| 16S rRNA-processing protein RimM [Pseudomonas aeruginosa PAO1]
 gi|14423891|sp|Q9HXQ0|RIMM_PSEAE RecName: Full=Ribosome maturation factor rimM
 gi|9949912|gb|AAG07131.1|AE004793_8 16S rRNA processing protein [Pseudomonas aeruginosa PAO1]
          Length = 175

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/167 (22%), Positives = 78/167 (46%), Gaps = 10/167 (5%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYAN---NPIDLNRYVLYSNDN-RELRILKMYRKNKRF 60
           D LV++  I + +G+ GEV + S+ +   N +D  R+ L  +   R+  +++     K  
Sbjct: 6   DDLVVIGKIVSVYGIRGEVKVYSFTDPLDNLLDYRRWTLRRDGEIRQAELVRGRLHGKVL 65

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
            A   G+D+   A      ++   R +     LEE E++   LE ++  D+  +  G + 
Sbjct: 66  AAKLKGLDDREEARTFTGYEICIPRSELP--SLEEGEYYWHQLEGLKVIDQGRQLLGVID 123

Query: 121 GVYNFGAGSILEIKNTM----EKTFLIPFTKFAVLEVNLQENKILID 163
            +   GA  ++ +K       ++  L+P+T   VL ++L   ++ +D
Sbjct: 124 HLLETGANDVMVVKPCAGSLDDRERLLPYTGQCVLSIDLAAGEMRVD 170


>gi|229491346|ref|ZP_04385170.1| 16S rRNA processing protein RimM [Rhodococcus erythropolis SK121]
 gi|229321631|gb|EEN87428.1| 16S rRNA processing protein RimM [Rhodococcus erythropolis SK121]
          Length = 190

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/169 (24%), Positives = 75/169 (44%), Gaps = 16/169 (9%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNRELRILKMYR------KN 57
           +++  +  +HG+ GE+ ++   + P D  R+    VL     RE   LK Y        +
Sbjct: 3   LVVGRVAKSHGIKGELVVEVRTDEPED--RFAVGSVLRGRKPRE-STLKSYTVEAARDHS 59

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
            R +    G+ +   A  LR         + +  + + DEF++ +LE ++     G   G
Sbjct: 60  GRLLLRLEGVSDRGDADALRGTLFVIDSSELEPSD-DPDEFYDHELEGLKVVLTDGAEVG 118

Query: 118 QVCGVYNFGAGSILEIKNTMEKT--FLIPFTKFAVLEVNLQENKILIDP 164
            V  V +  AG +L I+   E +   LIPF    V  V++ +  ++I+P
Sbjct: 119 SVIEVLHSAAGELLSIRRAGETSGELLIPFVAAIVTSVSIADGVVVIEP 167


>gi|73748405|ref|YP_307644.1| 16S rRNA processing protein RimM [Dehalococcoides sp. CBDB1]
 gi|147669185|ref|YP_001214003.1| 16S rRNA processing protein RimM [Dehalococcoides sp. BAV1]
 gi|289432453|ref|YP_003462326.1| 16S rRNA processing protein RimM [Dehalococcoides sp. GT]
 gi|109893012|sp|Q3ZZT5|RIMM_DEHSC RecName: Full=Ribosome maturation factor rimM
 gi|189040133|sp|A5FRP5|RIMM_DEHSB RecName: Full=Ribosome maturation factor rimM
 gi|73660121|emb|CAI82728.1| 16S rRNA processing protein RimM [Dehalococcoides sp. CBDB1]
 gi|146270133|gb|ABQ17125.1| 16S rRNA processing protein RimM [Dehalococcoides sp. BAV1]
 gi|288946173|gb|ADC73870.1| 16S rRNA processing protein RimM [Dehalococcoides sp. GT]
          Length = 166

 Score = 52.8 bits (125), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 57/115 (49%), Gaps = 3/115 (2%)

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
           +  + I   SGID+I +A EL+D  +       K  EL E  +++  L  +E  D  G  
Sbjct: 55  QKAQVIVHLSGIDDIDTALELKDALVEIPASALK--ELPEGVYYDFQLIGLEVVDLSGVK 112

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
            GQ+  + +  +  I  + +   K  LIP  K  V E+NL+  KI+IDPI   L+
Sbjct: 113 IGQIKEILHMPSNDIY-VSSYGVKEALIPAIKDVVKEINLKTGKIIIDPIPGLLD 166


>gi|152991244|ref|YP_001356966.1| 16S rRNA processing protein RimM [Nitratiruptor sp. SB155-2]
 gi|172048734|sp|A6Q550|RIMM_NITSB RecName: Full=Ribosome maturation factor rimM
 gi|151423105|dbj|BAF70609.1| 16S rRNA processing protein RimM [Nitratiruptor sp. SB155-2]
          Length = 173

 Score = 52.4 bits (124), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 76/163 (46%), Gaps = 11/163 (6%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIATFS 65
           K + +A +G T GL+G++ +    + P    +   + +D   L I  +     R    F 
Sbjct: 2   KKLTVARLGRTVGLHGDMKLHILTDFPEQFQKGSTFESDRGSLTIESV--NPARGTVKFQ 59

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDE-ELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
           GID++  A +  +  LY+  +  K    L EDE+F  D+   + F+ +GK  G+V  +  
Sbjct: 60  GIDSVDEAKKYTNAYLYSDEETTKKSFPLGEDEYFWFDILGCDVFE-EGKRLGKVVDIQR 118

Query: 125 FGAGSILEIKNTME-------KTFLIPFTKFAVLEVNLQENKI 160
             AG  L ++           K+FLIPF    + +V+L + +I
Sbjct: 119 LPAGDYLLVETDKSFVDMKKAKSFLIPFLDMFIEDVHLDQKRI 161


>gi|330831189|ref|YP_004394141.1| ribosome maturation factor rimM [Aeromonas veronii B565]
 gi|328806325|gb|AEB51524.1| Ribosome maturation factor rimM [Aeromonas veronii B565]
          Length = 173

 Score = 52.4 bits (124), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 80/170 (47%), Gaps = 12/170 (7%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSY---ANNPIDLNRYVLYSNDN-RELRILKMYRKNKR 59
           ++K V++ T+GT +G+ G + ++S+   A    D N +++  N   RE+R+    R NK 
Sbjct: 1   MEKPVVLGTLGTVYGIKGWLKVNSFTDVAEAIFDYNPWLINQNGAWREIRVSSWKRHNKG 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I    GID    A  L ++++           L E EF+  DL        +G   G+V
Sbjct: 61  LICKLDGIDVREDALALTNVEIGVPADLLP--ALPEGEFYWRDLIGCSVVTTKGYDLGKV 118

Query: 120 CGVYNFGAGSILEIKNTMEKTF-----LIPFTKFAVLE-VNLQENKILID 163
             +   G+  +L ++  ++  F     LIPF +  V++ ++L    I +D
Sbjct: 119 TELMETGSNDVLVVEANVKDAFGAKERLIPFLEEQVIKNIDLTVRTIEVD 168


>gi|159036842|ref|YP_001536095.1| 16S rRNA-processing protein RimM [Salinispora arenicola CNS-205]
 gi|209573593|sp|A8M679|RIMM_SALAI RecName: Full=Ribosome maturation factor rimM
 gi|157915677|gb|ABV97104.1| 16S rRNA processing protein RimM [Salinispora arenicola CNS-205]
          Length = 180

 Score = 52.4 bits (124), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/177 (20%), Positives = 73/177 (41%), Gaps = 23/177 (12%)

Query: 7   LVLMATIGTTHGLNGEVYID-------------------SYANNPIDLNRYVLYSNDNRE 47
           ++++  IG  HG+ GEV ++                     AN P     Y + S    E
Sbjct: 1   MLVVGRIGKPHGIRGEVTVEVRTDEPETRFAPGSVLRTEPGANVPASPGAYRVPSELTVE 60

Query: 48  LRILKMYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEME 107
                 + + +  +  F G+ + + A  LR   +   R D      + +EF +  L  + 
Sbjct: 61  T---ARWHQGRLLLVAFEGVLDRNVAEALRGTFVGVDRADVT-APTDPEEFHDHQLVGLA 116

Query: 108 TFDRQGKYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
                G+  G++  + +  A  +L ++   ++  LIPF +  V EV+L   ++++DP
Sbjct: 117 VVTSAGERLGEIVRIDHAPAADLLVLRRPGDRDVLIPFVRAIVPEVDLAGGRVVVDP 173


>gi|320161004|ref|YP_004174228.1| putative 16S rRNA-processing protein RimM [Anaerolinea thermophila
           UNI-1]
 gi|319994857|dbj|BAJ63628.1| putative 16S rRNA-processing protein RimM [Anaerolinea thermophila
           UNI-1]
          Length = 187

 Score = 52.4 bits (124), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/149 (19%), Positives = 71/149 (47%), Gaps = 4/149 (2%)

Query: 16  THGLNGEVYIDSYANNP--IDLNRYVLYSNDNRELRILKMYRKNKRFIATFSGIDNIHSA 73
            HG++GE+ +D   + P  +  +R +   + +  +RI K+   ++  +  F G+D+  + 
Sbjct: 35  PHGIHGEMLMDVLTDFPERMKPHRQLFLGDSHEPVRIEKVRWADQSMLIKFEGMDDAEAL 94

Query: 74  SELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFGAGSILEI 133
              R+  +Y          L E ++++  L  +     +G++ G +  +   GA  +  +
Sbjct: 95  GRFRNTVVYVLADQLPP--LPEGQYYHHQLLGLRVVSDEGQFLGVLEQILETGANDVYLV 152

Query: 134 KNTMEKTFLIPFTKFAVLEVNLQENKILI 162
               +K  L+P  +  +L VNL++ ++++
Sbjct: 153 HTPEDKEILLPAIEEVILSVNLEDGEMVV 181


>gi|227549005|ref|ZP_03979054.1| 16S rRNA-processing protein [Corynebacterium lipophiloflavum DSM
           44291]
 gi|227078915|gb|EEI16878.1| 16S rRNA-processing protein [Corynebacterium lipophiloflavum DSM
           44291]
          Length = 182

 Score = 52.4 bits (124), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 78/164 (47%), Gaps = 14/164 (8%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVL-------YSNDNRELRILKMYRKNKRF 60
           +L+  +  +HG+ GEV ++   ++P    R+ +            REL I  +     R 
Sbjct: 19  LLIGKVVKSHGIKGEVAVEVLTDDPD--QRFAVGEVLTGRQPGKERELTIKTLRPHQNRL 76

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           + +F  + +   A  LR ++ +A   + +D   + +EF++ +L  ++    +G+  G+V 
Sbjct: 77  LMSFEEVPDRTQADSLRGMQFFAPPLERED---DSEEFYDHELIGLKVI-HEGREVGEVT 132

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           GV +     ILEI +   +  L+PF    V E++L E  + I P
Sbjct: 133 GVMDTPNRKILEI-DYDGREVLVPFVIDFVPEIDLGEQTLTITP 175


>gi|77165722|ref|YP_344247.1| 16S rRNA processing protein RimM [Nitrosococcus oceani ATCC 19707]
 gi|254433785|ref|ZP_05047293.1| 16S rRNA processing protein RimM [Nitrosococcus oceani AFC27]
 gi|109893026|sp|Q3J8X9|RIMM_NITOC RecName: Full=Ribosome maturation factor rimM
 gi|76884036|gb|ABA58717.1| 16S rRNA processing protein RimM [Nitrosococcus oceani ATCC 19707]
 gi|207090118|gb|EDZ67389.1| 16S rRNA processing protein RimM [Nitrosococcus oceani AFC27]
          Length = 175

 Score = 52.4 bits (124), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 75/163 (46%), Gaps = 9/163 (5%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYA---NNPIDLNRYVLYSNDNRELRILKMYR-KNKRFI 61
           + VL+  I   +G+ G + + SY    NN +D   + L  N   + R L+  R + K  +
Sbjct: 12  RYVLVGRISGLYGVQGWLRVYSYTQPRNNILDYEPWYLQQNGAWQARRLRKGRVQGKGIV 71

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               GID    A+     ++   R      +  E E++ +DL  ++    QG+  GQV  
Sbjct: 72  VALEGIDERDVAALWVGCEIAVHRDQLPPPQ--EGEYYWSDLIGLQVITLQGEVLGQVDR 129

Query: 122 VYNFGAGSILEIKNTMEKTFLIPF-TKFAVLEVNLQENKILID 163
           +   GA  +L ++   E+  L+PF     V +V+LQ+  + +D
Sbjct: 130 LLETGANDVLVVRGERER--LLPFLMGMIVKQVDLQQGLLTVD 170


>gi|296268965|ref|YP_003651597.1| 16S rRNA processing protein RimM [Thermobispora bispora DSM 43833]
 gi|296091752|gb|ADG87704.1| 16S rRNA processing protein RimM [Thermobispora bispora DSM 43833]
          Length = 171

 Score = 52.4 bits (124), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 39/163 (23%), Positives = 73/163 (44%), Gaps = 10/163 (6%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSN--DNRELRILKMYRKNKRFI 61
           +++  IG  HG+ GEV ++   + P    R+    VL ++  D   L + +        +
Sbjct: 3   LVVGRIGRPHGVRGEVTVEVRTDEP--EARFAPGSVLATDPADAGPLTVERARWHRGILL 60

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
             F+G+ + ++A  LR   L     D      + DEF + +L  +      G+  G+V  
Sbjct: 61  VAFAGVPDRNAAERLRGTLLVIDSADIPPSG-DPDEFHDHELLGLAVVTTDGQRVGEVAD 119

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           V + G   +L ++    +   +PF K  V EV+    +++IDP
Sbjct: 120 VLHHGQ-DLLVVRRPSGEEVYVPFVKAIVPEVDPGAGRLVIDP 161


>gi|108804228|ref|YP_644165.1| 16S rRNA processing protein RimM [Rubrobacter xylanophilus DSM
           9941]
 gi|122381804|sp|Q1AW75|RIMM_RUBXD RecName: Full=Ribosome maturation factor rimM
 gi|108765471|gb|ABG04353.1| 16S rRNA processing protein RimM [Rubrobacter xylanophilus DSM
           9941]
          Length = 163

 Score = 52.4 bits (124), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 76/165 (46%), Gaps = 6/165 (3%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRF 60
           M +L   V++ TI   HG+ G V +   A     L   +      R  RIL+  R  K F
Sbjct: 1   MGELADPVVIGTITAPHGVRGTVRVRP-AGEGRHLREGLSPLVGGRRRRILRARRTPKGF 59

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +    G+ +   A+ELR   L   R +   +  EEDEF+  DL  +E  D +G   G+V 
Sbjct: 60  LVDLEGVPDRFRAAELRGEDLLLDRSEL--DAPEEDEFYVADLVGLEAVDERGGALGEVI 117

Query: 121 GVYNFGAGSILEIKNTMEKTFL-IPFTKFAVLEVNLQENKILIDP 164
             +   A  +L ++   E   L +PFT+  V EV+ +  + ++ P
Sbjct: 118 ETFPTPAHEVLVVRG--EGGLLYVPFTREHVPEVDPRAGRAVVRP 160


>gi|145593858|ref|YP_001158155.1| 16S rRNA-processing protein RimM [Salinispora tropica CNB-440]
 gi|209573594|sp|A4X4H7|RIMM_SALTO RecName: Full=Ribosome maturation factor rimM
 gi|145303195|gb|ABP53777.1| 16S rRNA processing protein RimM [Salinispora tropica CNB-440]
          Length = 180

 Score = 52.4 bits (124), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/177 (20%), Positives = 72/177 (40%), Gaps = 23/177 (12%)

Query: 7   LVLMATIGTTHGLNGEVYID-------------------SYANNPIDLNRYVLYSNDNRE 47
           ++++  IG  HG+ GEV ++                     AN P     Y +      E
Sbjct: 1   MLVVGRIGKPHGIRGEVTVEVRTDEPETRFAPGSVLRTEPGANVPAHPGAYRVPGELTVE 60

Query: 48  LRILKMYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEME 107
                 + + +  + TF G+ + + A  LR   +   R D      + +EF +  L  + 
Sbjct: 61  A---ARWHQGRVLLVTFEGVLDRNVAEALRGTLVGVDRADVA-PPTDPEEFHDHQLVGLA 116

Query: 108 TFDRQGKYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
                G+  G++  + +  A  +L ++    +  LIPF +  V E++L   ++++DP
Sbjct: 117 VVTSAGERLGEIARIDHAPAADLLVLRRPGRRDVLIPFVQAIVPEIDLAGGRVVVDP 173


>gi|169827101|ref|YP_001697259.1| 16S rRNA-processing protein [Lysinibacillus sphaericus C3-41]
 gi|209573567|sp|B1HQI2|RIMM_LYSSC RecName: Full=Ribosome maturation factor rimM
 gi|168991589|gb|ACA39129.1| Probable 16S rRNA-processing protein [Lysinibacillus sphaericus
           C3-41]
          Length = 171

 Score = 52.0 bits (123), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 79/160 (49%), Gaps = 8/160 (5%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDL----NRYVLYSNDNRELR--ILKMYRKNKRFIA- 62
           +  I  THG+ GEV I S  +   +     N+   +  D+++     ++  R++K FI  
Sbjct: 6   VGRIVNTHGIRGEVRILSTTDFEKERFAVGNKLAAFKKDDKKPTGVTIQSVRRHKNFILL 65

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
           TF G++NI+     ++  L   +    D+ LEE+EFF  ++        +G+  G V  +
Sbjct: 66  TFEGMNNINLVEPFKEGLLKVTKDQMTDDLLEENEFFFHEIIGCTVVSEEGETIGVVNDI 125

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
              GA  +  +K + +K   IP+ +  V ++++ E KI+I
Sbjct: 126 LQTGANDVWVVKGS-KKEHYIPYIEDIVKDIDVDEKKIVI 164


>gi|59711157|ref|YP_203933.1| 16S rRNA-processing protein [Vibrio fischeri ES114]
 gi|75354502|sp|Q5E7F1|RIMM_VIBF1 RecName: Full=Ribosome maturation factor rimM
 gi|59479258|gb|AAW85045.1| 16S rRNA processing protein [Vibrio fischeri ES114]
          Length = 175

 Score = 52.0 bits (123), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 38/172 (22%), Positives = 81/172 (47%), Gaps = 11/172 (6%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNP---IDLNRYVLYSNDNRELRILKMYRKN 57
           M K D+++++   G ++G+ G + + S+ + P    D   +++          ++ ++++
Sbjct: 1   MSKQDEVIVVGKFGASYGIRGWLKVVSFTDQPESIFDYKPWLIQVKGEWVEFSVESWKRH 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
           K  +    G+D    A    +L++  K       EL EDEF+  +L  ME    +G   G
Sbjct: 61  KGLVCKLKGLDVREEAQTYTNLEIAVKADALP--ELSEDEFYWRELFGMEVVTTKGYALG 118

Query: 118 QVCGVYNFGAGSILEIKNTMEKTF-----LIPFTKFAVLE-VNLQENKILID 163
            V  ++  G+  +L +K  ++  F     LIPF    V++ ++ +  +I +D
Sbjct: 119 VVDDIFETGSNDVLVVKANLKDAFGKKERLIPFIDEQVIKLIDREAQRIEVD 170


>gi|78065656|ref|YP_368425.1| 16S rRNA-processing protein [Burkholderia sp. 383]
 gi|109893004|sp|Q39ID5|RIMM_BURS3 RecName: Full=Ribosome maturation factor rimM
 gi|77966401|gb|ABB07781.1| 16S rRNA processing protein RimM [Burkholderia sp. 383]
          Length = 225

 Score = 52.0 bits (123), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 79/174 (45%), Gaps = 17/174 (9%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNP------IDLNRYVLYSNDNR-ELRILKMYRKN 57
           D  V +  +   +GL G V + ++A+        +    + L     R  +RI++    +
Sbjct: 49  DDAVEVGAVVDAYGLKGWVKVATHADAGRGGDALLKARHWWLERGAERLSVRIMQSKAHS 108

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              +A  +G+ +  +A  +R  +++ +R+DF    L  DEF+  DL  ++  + Q    G
Sbjct: 109 DTVVAQPAGVSDRDAAFAMRGFRVFVRREDFP--ALAADEFYWVDLIGLDVVNEQSVALG 166

Query: 118 QVCGVYNFGAGSILEI------KNTMEKT--FLIPFTKFAVLEVNLQENKILID 163
           +V G+ + G  SI+ +      K+    T   LIPF    V  V+    +I++D
Sbjct: 167 KVSGMIDNGVHSIMRVEYPATGKDGQPTTDERLIPFVGVYVKTVDQAARRIVVD 220


>gi|228992570|ref|ZP_04152497.1| Ribosome maturation factor rimM [Bacillus pseudomycoides DSM 12442]
 gi|228767204|gb|EEM15840.1| Ribosome maturation factor rimM [Bacillus pseudomycoides DSM 12442]
          Length = 188

 Score = 52.0 bits (123), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 42/176 (23%), Positives = 82/176 (46%), Gaps = 10/176 (5%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNP-----IDLNRYVLYSNDNRELRI-LKMY 54
           M+ + K   +  I  THG+ GE+ + S  + P     +    Y+ +      L + +  +
Sbjct: 15  MLFMTKWFNVGKIVNTHGVRGEIRVISRTDFPEERYKVGNTLYIWHDKGTEPLSVKVASH 74

Query: 55  RKNKRF-IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQG 113
           R++K F + TF G +N+    +L+   +    +     EL E E++  ++   +    +G
Sbjct: 75  RQHKTFDLLTFEGYNNVDEVEKLKGSSIKVPEEQLG--ELAEGEYYYHEIIGCKVVTEEG 132

Query: 114 KYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           +  G +  + + GA  +  IK    +  LIP+    VL+VN+ ENK++   +  GL
Sbjct: 133 EDLGTIKEILSPGANDVWVIKRPKGQDLLIPYIDDVVLQVNI-ENKLVTIHVMEGL 187


>gi|167747200|ref|ZP_02419327.1| hypothetical protein ANACAC_01914 [Anaerostipes caccae DSM 14662]
 gi|317473599|ref|ZP_07932888.1| 16S rRNA processing protein RimM [Anaerostipes sp. 3_2_56FAA]
 gi|167654160|gb|EDR98289.1| hypothetical protein ANACAC_01914 [Anaerostipes caccae DSM 14662]
 gi|316898889|gb|EFV20914.1| 16S rRNA processing protein RimM [Anaerostipes sp. 3_2_56FAA]
          Length = 170

 Score = 52.0 bits (123), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 82/164 (50%), Gaps = 12/164 (7%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNP---IDLNRYVLYSNDNRELRILKM----YRK 56
           ++ ++ +  I +THG+ GEV +    ++     DL   +L  +  RE+++L +    + K
Sbjct: 1   MEDILQVGAIASTHGVRGEVKVYPMTDDVERFKDLKEVLL--DTGREMKLLHVKSCKFFK 58

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           N+  I  F   DNI+   + +   L+  R++    +LEE+EFF  D+   + +   GK  
Sbjct: 59  NQP-ILKFEEFDNINDIEQYKRCGLFVTRENAV--KLEENEFFIADIIGFDVYRETGKKL 115

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKI 160
           G +  V   GA  +  +K    K  L+P  +  + +V+L+E +I
Sbjct: 116 GILDDVLQTGANDVYVVKMDDGKEVLLPAIRDCIKKVSLEEKRI 159


>gi|111023496|ref|YP_706468.1| 16S rRNA-processing protein [Rhodococcus jostii RHA1]
 gi|122955113|sp|Q0S2C6|RIMM_RHOSR RecName: Full=Ribosome maturation factor rimM
 gi|110823026|gb|ABG98310.1| 16S rRNA processing protein [Rhodococcus jostii RHA1]
          Length = 183

 Score = 52.0 bits (123), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 39/168 (23%), Positives = 77/168 (45%), Gaps = 14/168 (8%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNRELRI----LKMYRKNK- 58
           +++  +  +HG+ GE+ ++   + P D  R+    VL  +  RE  +    ++  R +  
Sbjct: 3   LVVGRVAKSHGIKGEIVVEVRTDEPED--RFAVGAVLRGHKPREQTVSTYTVEAARDHSG 60

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
           R +    G+ +  +A  LR         + +  + + DEF++ +LE +      G   G 
Sbjct: 61  RLLLRLEGVSDRTAADALRGTLFVIDSAELEPSD-DPDEFYDHELEGLSVRLADGTEVGT 119

Query: 119 VCGVYNFGAGSILEIKNTMEKT--FLIPFTKFAVLEVNLQENKILIDP 164
           V  V +  AG +L I+   +++   L+PF    V  V++ +   LIDP
Sbjct: 120 VIEVLHSAAGELLSIRRAGDQSGELLVPFVAAIVTSVSVADGVALIDP 167


>gi|166031987|ref|ZP_02234816.1| hypothetical protein DORFOR_01689 [Dorea formicigenerans ATCC
           27755]
 gi|166028440|gb|EDR47197.1| hypothetical protein DORFOR_01689 [Dorea formicigenerans ATCC
           27755]
          Length = 168

 Score = 52.0 bits (123), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 75/165 (45%), Gaps = 10/165 (6%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPI---DLNRYVLYSNDNR---ELRILKMYRKN 57
           +++L+ +  I   HG+ GEV +    ++P+    L + +L +   +   E+  +K +++ 
Sbjct: 1   MEQLLQVGVITQPHGVRGEVKVFPTTDDPVRFKKLKKVILDTGKEKLDLEVEHVKFFKQ- 59

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              I  F   DNI+     +   L   R++     LEEDE+F  D+  M+     G  +G
Sbjct: 60  -FVIVKFKEFDNINDIERYKRCPLLVTRENAV--PLEEDEYFVADMIGMKVITEDGTEFG 116

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
            +  V   GA  +  I +      L+P  K  VL V+++   I +
Sbjct: 117 TLSDVMETGANDVYVIDSKEHGEVLMPAIKECVLNVDMESGIITV 161


>gi|307244387|ref|ZP_07526498.1| 16S rRNA processing protein RimM [Peptostreptococcus stomatis DSM
           17678]
 gi|306492206|gb|EFM64248.1| 16S rRNA processing protein RimM [Peptostreptococcus stomatis DSM
           17678]
          Length = 172

 Score = 52.0 bits (123), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 76/168 (45%), Gaps = 12/168 (7%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNRELRIL---KMYRKNKRFIA 62
           +  I TT GL GE+ I  + +    ++R+      +  ++RE + L    +   N   + 
Sbjct: 10  LGKIVTTRGLKGEIKIYPHTDK---IDRFKDLEYFFIGNDREKKYLVERAVTASNNSIVV 66

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
              G D I S   L    ++  R+     +L+EDEFF  D+  M+    +G+  G++  V
Sbjct: 67  KLKGYDTIESVQALIGKFIFVDRE--MSYQLDEDEFFIADMIGMDVETIEGQKIGKLVDV 124

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
             + A  +  +K    K +LIP T   V +++ +   + I PI   L+
Sbjct: 125 LQYAANDVYVVKGEDSKEYLIPATYEIVPDIDTENRLMKIKPIPGLLD 172


>gi|282861373|ref|ZP_06270438.1| 16S rRNA processing protein RimM [Streptomyces sp. ACTE]
 gi|282564031|gb|EFB69568.1| 16S rRNA processing protein RimM [Streptomyces sp. ACTE]
          Length = 207

 Score = 52.0 bits (123), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 37/161 (22%), Positives = 77/161 (47%), Gaps = 5/161 (3%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNP-IDLNRYVLYSNDNRE---LRILKMYRKNKRFIAT 63
           +++A IG  HG+ GEV ++   + P + L    + + D  E   L I      + R +  
Sbjct: 3   LVVARIGRAHGIKGEVTVEVRTDEPELRLGPGAVLATDPAEKGPLTIESGRVHSGRLLLR 62

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F  + +   A  LR++ L A+    +  E +E+EF++  L +++     G   G++  + 
Sbjct: 63  FENVRDRTGAEALRNILLIAEVDPAQLPE-DEEEFYDHQLIDLDVVLADGTEIGRITEIS 121

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           +  +  +  ++       +IPF +  V E++L+E + +I P
Sbjct: 122 HLPSQDLFIVERPDGSEVMIPFVEEIVTEIDLEEQRAVITP 162


>gi|41409073|ref|NP_961909.1| 16S rRNA-processing protein [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|59798798|sp|Q73VN8|RIMM_MYCPA RecName: Full=Ribosome maturation factor rimM
 gi|41397432|gb|AAS05292.1| RimM [Mycobacterium avium subsp. paratuberculosis K-10]
          Length = 175

 Score = 52.0 bits (123), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/159 (22%), Positives = 65/159 (40%), Gaps = 11/159 (6%)

Query: 16  THGLNGEVYIDSYANNPI-------DLNRYVLYSNDNRELRILKMYRKNKRFIATFSGID 68
            HG++GE+ ++   ++P         L          R   I        R +   +G+ 
Sbjct: 11  AHGISGEIVVEIRTDDPAARFAPGNTLRAKPSRGGPERSCVIESAREHGGRLLVRLAGVT 70

Query: 69  NIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFGAG 128
           +  +A  LR         +  D + E D +++  LE ++     G+  G V  V +  AG
Sbjct: 71  DRDAADALRGTLFVVDSAELPDID-EPDTYYDHQLEGLQVRTTGGRRVGAVAEVLHTAAG 129

Query: 129 SILEIKNTME---KTFLIPFTKFAVLEVNLQENKILIDP 164
            +L +++  +   +  L+PF    V  V+L +  I IDP
Sbjct: 130 ELLAVRDDADGAPREVLVPFVSAIVTAVSLDDGLIEIDP 168


>gi|71281652|ref|YP_270723.1| 16S rRNA-processing protein RimM [Colwellia psychrerythraea 34H]
 gi|109893008|sp|Q47WU9|RIMM_COLP3 RecName: Full=Ribosome maturation factor rimM
 gi|71147392|gb|AAZ27865.1| 16S rRNA processing protein RimM [Colwellia psychrerythraea 34H]
          Length = 176

 Score = 52.0 bits (123), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 77/169 (45%), Gaps = 12/169 (7%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRF 60
           +K +++  +G  +G+ G + I S+ +    +  Y  +S    N+ + + I    + NK  
Sbjct: 5   EKKIILGKVGAVYGIKGWLKIHSFTDETEAILDYFPWSLKLGNNTQTVEITDWRKHNKVL 64

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           I   +GID+   A  L   ++          EL ED+F+  DL  M     +G   G V 
Sbjct: 65  IVKVAGIDDRDEAQALVGSEILTNEAALP--ELSEDDFYWRDLIGMSVVTNKGYDLGVVT 122

Query: 121 GVYNFGAGSILEIKNTMEKTF-----LIPFTKFAVLE-VNLQENKILID 163
            +   GA  +L +K  ++  F     LIP+    V+E V+++  +I +D
Sbjct: 123 DMMETGANDVLVVKANLKDGFSKKERLIPYLFEQVIESVSIENKQICVD 171


>gi|269795666|ref|YP_003315121.1| 16S rRNA processing protein RimM [Sanguibacter keddieii DSM 10542]
 gi|269097851|gb|ACZ22287.1| 16S rRNA processing protein RimM [Sanguibacter keddieii DSM 10542]
          Length = 214

 Score = 52.0 bits (123), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 73/159 (45%), Gaps = 8/159 (5%)

Query: 10  MATIGTTHGLNGEVYIDSYANNP----IDLNRYVLYSNDNRELRILKMYRKNKRFIATFS 65
           +ATIG  HGL GEV +D   ++P     D             L ++    +N R+   F+
Sbjct: 5   VATIGRAHGLRGEVALDLRTDDPEARLADGQVLRTVPASAGPLTVVSTRIQNGRWHVAFA 64

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNF 125
            + +  +A + R ++L        D   EED ++  +L  +    + G   G+V G+ + 
Sbjct: 65  ELGDRTAAEQARGIELVVD----VDASDEEDAWYPHELAGLRAELQDGTVVGEVVGLDHL 120

Query: 126 GAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
            A  +L ++ T     L+PF +  V  V++   ++++DP
Sbjct: 121 PAYDMLVVRETDGTRTLVPFVRVMVPVVDVAGGRVVLDP 159


>gi|300780919|ref|ZP_07090773.1| 16S rRNA processing protein RimM [Corynebacterium genitalium ATCC
           33030]
 gi|300532626|gb|EFK53687.1| 16S rRNA processing protein RimM [Corynebacterium genitalium ATCC
           33030]
          Length = 169

 Score = 52.0 bits (123), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 42/157 (26%), Positives = 80/157 (50%), Gaps = 13/157 (8%)

Query: 16  THGLNGEVYIDSYANNPIDL---NRYVLY---SNDNRELRILKMYRKNKRFIATFSGIDN 69
           +HG+ GEV ++  A++  D+      VL+   +   R+L I  +    KR + TF  + +
Sbjct: 11  SHGVRGEVVVEPLADDE-DIFFAEGEVLHGRQTGKERDLTIKSVRPHQKRLLVTFEEVAD 69

Query: 70  IHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETF--DRQGKYWGQVCGVYNFGA 127
             +A  LR ++ +A+  + +DE  + DE+++ +L  ++       G + G+V GV     
Sbjct: 70  RTAADSLRGMQFFAEPLE-RDE--DSDEYYDHELIGLKVLLDHAGGTHIGEVTGVMTMPN 126

Query: 128 GSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
             +LE+ +   K  L+PF    V E++L E  ++I P
Sbjct: 127 RKLLEV-DYHGKEVLVPFVMDIVPEIDLDEGYLVITP 162


>gi|194364932|ref|YP_002027542.1| 16S rRNA-processing protein RimM [Stenotrophomonas maltophilia
           R551-3]
 gi|238693461|sp|B4SPH2|RIMM_STRM5 RecName: Full=Ribosome maturation factor rimM
 gi|194347736|gb|ACF50859.1| 16S rRNA processing protein RimM [Stenotrophomonas maltophilia
           R551-3]
          Length = 170

 Score = 52.0 bits (123), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 39/166 (23%), Positives = 80/166 (48%), Gaps = 12/166 (7%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY---VLYSNDNRE--LRILKMYRKNKR 59
           ++ +L+  I    G+ GE+ ++S+      + RY   +L S + +E  L   +     K 
Sbjct: 5   ERRILLGRIVGAFGVRGEIKLESWTEPRSAIFRYQPWILRSPNGQESTLEGARGRDSGKH 64

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +A F GI++  +   +   ++Y  R          DE++  DLE ++    +G   GQV
Sbjct: 65  LVARFPGIEDRDTVEAMHGTEVYVARSALPPPN--ADEYYWVDLEGLDVKTTEGVALGQV 122

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFT--KFAVLEVNLQENKILID 163
             +++ GA  ++ ++   E+  +IPF   +F V  V+ + N +++D
Sbjct: 123 SHLFSTGANDVVVVRGDRER--MIPFVLPEF-VKSVDFEANLVVVD 165


>gi|85712461|ref|ZP_01043510.1| RimM [Idiomarina baltica OS145]
 gi|85693739|gb|EAQ31688.1| RimM [Idiomarina baltica OS145]
          Length = 181

 Score = 52.0 bits (123), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 78/170 (45%), Gaps = 16/170 (9%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDL---NRYVLYSNDNRE-----LRILKMYRKNKR 59
           +++  IG  +G+ G + I S+  NP D+     + L  N  R+     + +++  R N  
Sbjct: 9   LVVGHIGAVYGVKGWLKIQSFTENPEDIFDYTPWTLQGNAARQTTEEVINVVQWRRHNNG 68

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            IA   GI++   A+    L +    +  K  EL +DEF+  DL  +   ++QG   G V
Sbjct: 69  LIAQLEGINDRELAATKTGLSICINAE--KLPELADDEFYWRDLIGLRVVNKQGYDMGVV 126

Query: 120 CGVYNFGAGSILEIKNTMEKTF-----LIPFTKFA-VLEVNLQENKILID 163
             +    A  +L +       F     LIPF +   VL+V+ ++ +I +D
Sbjct: 127 EQIMPTAANDVLVVTANSNDAFGKSERLIPFVQSQYVLDVDNEKQQIQVD 176


>gi|225028003|ref|ZP_03717195.1| hypothetical protein EUBHAL_02272 [Eubacterium hallii DSM 3353]
 gi|224954717|gb|EEG35926.1| hypothetical protein EUBHAL_02272 [Eubacterium hallii DSM 3353]
          Length = 169

 Score = 51.6 bits (122), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 76/163 (46%), Gaps = 6/163 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNP---IDLNRYVLYSNDNR-ELRILKMYRKNKR 59
           ++ L  +  I  THGL GEV +    ++    +DL+  ++ +     E ++       + 
Sbjct: 1   MEDLFQVGIITGTHGLKGEVKVFPTTDDKERFLDLDTVLIDTGKELIEKKVQYCKFFKQF 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
               F G+D+I+   + +   L   R++     LEEDE++  DL  +   D  G   G++
Sbjct: 61  VFVKFEGLDDINDVEKYKRCPLKVTRENAV--PLEEDEYYVADLLGLTIVDESGVTIGEL 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
             V   GA  + E+K       L+P  K  +L+V+++E  IL+
Sbjct: 119 IDVIETGANDVYEVKTPDGGHVLLPAIKDCILDVDMEEKIILV 161


>gi|225851485|ref|YP_002731719.1| 16S rRNA processing protein RimM [Persephonella marina EX-H1]
 gi|225645188|gb|ACO03374.1| 16S rRNA processing protein RimM [Persephonella marina EX-H1]
          Length = 169

 Score = 51.6 bits (122), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 83/164 (50%), Gaps = 9/164 (5%)

Query: 3   KLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKN---KR 59
           K +  V+   I  THG+ G++ I+ +  N  DL   V+Y  D +E   + +Y ++   K+
Sbjct: 4   KREDFVIAGKIHGTHGVRGDLKIEIFPPN-FDLPD-VIYIKD-KEGNFVPLYIEHFSKKK 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +  F G D+I  A +++    Y +    K  EL++D+F+   L +M+     GK  G++
Sbjct: 61  NLIRFKGFDDIDKAKKIKHRYFYVESH--KLPELDKDQFYEYQLIDMDVI-FNGKVIGKI 117

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
             V +    + L IK   +K   +PF K  V EV+ +  K+++D
Sbjct: 118 IKVDDRLPTAYLIIKCVDDKVRHLPFIKEFVKEVDTEGRKVVVD 161


>gi|197303268|ref|ZP_03168309.1| hypothetical protein RUMLAC_01991 [Ruminococcus lactaris ATCC
           29176]
 gi|197297694|gb|EDY32253.1| hypothetical protein RUMLAC_01991 [Ruminococcus lactaris ATCC
           29176]
          Length = 178

 Score = 51.6 bits (122), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 82/164 (50%), Gaps = 7/164 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLN--RYVLYSNDNRELRI-LKMYRKNKRF 60
           +++ + +  I +THGL GEV +    ++       + V+      +L + ++  R  K+F
Sbjct: 10  MEQFLQVGVISSTHGLRGEVKVFPTTDDAARFQTLKEVILDTGKEKLDLEIQSVRFFKQF 69

Query: 61  -IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETF-DRQGKYWGQ 118
            I  F GID+I+   + +   L+  R++    ELEEDE++  DL  M+ + D   + +G 
Sbjct: 70  VIVKFKGIDDINDIEKYKGKSLFVARENAV--ELEEDEYYIGDLIGMDVYTDESEERFGV 127

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
           +  V   GA  +  +++      L+P     +LEV+ +E K+ +
Sbjct: 128 LKDVMETGANEVYIVQSERYGEVLLPAIHECILEVDPEEKKMTV 171


>gi|74318392|ref|YP_316132.1| 16S rRNA processing protein RimM [Thiobacillus denitrificans ATCC
           25259]
 gi|109893066|sp|Q3SGC3|RIMM_THIDA RecName: Full=Ribosome maturation factor rimM
 gi|74057887|gb|AAZ98327.1| 16S rRNA processing protein RimM [Thiobacillus denitrificans ATCC
           25259]
          Length = 189

 Score = 51.6 bits (122), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 38/167 (22%), Positives = 76/167 (45%), Gaps = 8/167 (4%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNP---IDLNRYVLYSNDNR-ELRILKMYRK 56
           + + +  V+M  +    G+ G V +  ++ +P   +D   + +   + + +  +  +   
Sbjct: 22  LAESEAWVVMGRVSAPFGVKGWVKVQPFSEDPGTLMDFESWRVGRGEQQAQYAVEAVQDH 81

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
            K  +A   GID+  +A  LR  ++   +      E  E+EF+ +DL  +   +R+G   
Sbjct: 82  GKSLVAKLVGIDDRDAAFALRGQEVSVAKSALPPPE--ENEFYWSDLIGLTVMNREGVEL 139

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
           G+V  +   GA  +L +K   E   LIPF    V +V+L    + +D
Sbjct: 140 GKVDSLMESGAHDLLVVKGRREH--LIPFVAAFVGKVDLAGGTVEVD 184


>gi|269955969|ref|YP_003325758.1| 16S rRNA processing protein RimM [Xylanimonas cellulosilytica DSM
           15894]
 gi|269304650|gb|ACZ30200.1| 16S rRNA processing protein RimM [Xylanimonas cellulosilytica DSM
           15894]
          Length = 181

 Score = 51.6 bits (122), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 74/161 (45%), Gaps = 8/161 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPID-LNRYVLYSNDNRE---LRILKMYRKNKRFIAT 63
           +++A I   H L GEV +D   ++P   L    + + D  E   L +L       R++  
Sbjct: 3   LVVARISKAHSLRGEVALDLRTDDPESRLPVGAVLATDPPEAGPLTVLSRRLHQGRWLVK 62

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F+ + +  +A  LR ++L  +  D  DEE   D ++  +L+ +      G   G+V  + 
Sbjct: 63  FAEVADRTAAEALRGVELVVE-ADASDEE---DAWYPHELQGLRVELLDGTVVGEVVTLE 118

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           +  A   L I+ T     LIPF    V  V++   ++++DP
Sbjct: 119 HLPAHDALLIEETGGARTLIPFVTAIVPVVDVAGGRVVLDP 159


>gi|302670921|ref|YP_003830881.1| 16S rRNA processing protein RimM [Butyrivibrio proteoclasticus
           B316]
 gi|302395394|gb|ADL34299.1| 16S rRNA processing protein RimM [Butyrivibrio proteoclasticus
           B316]
          Length = 170

 Score = 51.6 bits (122), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 76/160 (47%), Gaps = 10/160 (6%)

Query: 10  MATIGTTHGLNGEVYIDSYANNP---IDLNRYVLYSNDNRELRI-LKMYRKNKRF-IATF 64
           +  I +THGL GEV +     +P     L +  L++    E+ + ++  R  K+F I  F
Sbjct: 7   VGVIASTHGLQGEVNVFPTTEDPNRFKKLKKVTLHTQRGEEIELDVQSARFFKKFVIVKF 66

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
              +NI+   + R  +L  +R+D    +LE  E++  DL  ++  D  G   G V  +  
Sbjct: 67  KQYNNINDVEKFRGCELTIERKDAI--KLEPGEYYCADLMGLDIVDEDGNKLGVVTDIIQ 124

Query: 125 FGAGSILEI--KNTMEKTFLIPFTKFAVLEVNLQENKILI 162
            GA  + E+  + + EK + IP  K  V  +++   KI I
Sbjct: 125 TGANDVYEMAREGSDEKVY-IPVIKDCVRNIDVNGGKITI 163


>gi|320008293|gb|ADW03143.1| 16S rRNA processing protein RimM [Streptomyces flavogriseus ATCC
           33331]
          Length = 210

 Score = 51.6 bits (122), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 38/163 (23%), Positives = 77/163 (47%), Gaps = 9/163 (5%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNP-IDLNRYVLYSND---NRELRILKMYRKNKRFIAT 63
           +++A IG  HG+ GEV ++   + P + L    + + +      L I      + R +  
Sbjct: 3   LVVARIGRAHGIKGEVTVEVRTDEPELRLGPGAVLATEPAGTGPLTIETGRVHSGRLLLR 62

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEED--EFFNTDLEEMETFDRQGKYWGQVCG 121
           F G+ +  +A  LR+  L A+       EL +D  EF++  L +++     G   G++  
Sbjct: 63  FEGVRDRSAAEALRNTLLIAE---VDPAELPDDPEEFYDHQLMDLDVVLGDGTEIGRITE 119

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           + +  +  +  ++       +IPF +  V E++L+E +I+I P
Sbjct: 120 ISHLPSQDLFIVERPDGSEVMIPFVEEIVTEIDLEEQRIVIAP 162


>gi|294664961|ref|ZP_06730273.1| 16S rRNA-processing protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|292605268|gb|EFF48607.1| 16S rRNA-processing protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 170

 Score = 51.6 bits (122), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 35/168 (20%), Positives = 76/168 (45%), Gaps = 8/168 (4%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY-----SNDNRELRILKMYR 55
           M + ++ +L+  I    G+ GE+ ++S+      + RY  +     S     +  ++   
Sbjct: 1   MKQTERRILLGRIVGAFGVKGELKLESWTEPRTAIFRYQPWIVRTPSGQESGVSGVRGRD 60

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
           + K  IA F G+ +  +   +   ++Y  R      +   DE++  DLEE++    +G  
Sbjct: 61  QGKNLIAVFPGVTDRDTVEAMHGTEIYVARSALPPPK--PDEYYWVDLEELQVETVEGVK 118

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
            G V  +++ G+  ++ ++   E+     F  F V  V+ + N I++D
Sbjct: 119 LGTVSHLFSTGSNDVVVVRGDRERMIPFVFPDF-VKSVDFEANLIVVD 165


>gi|118463723|ref|YP_882934.1| 16S rRNA-processing protein RimM [Mycobacterium avium 104]
 gi|166226451|sp|A0QJ46|RIMM_MYCA1 RecName: Full=Ribosome maturation factor rimM
 gi|118165010|gb|ABK65907.1| 16S rRNA processing protein RimM [Mycobacterium avium 104]
          Length = 175

 Score = 51.6 bits (122), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 35/159 (22%), Positives = 65/159 (40%), Gaps = 11/159 (6%)

Query: 16  THGLNGEVYIDSYANNPI-------DLNRYVLYSNDNRELRILKMYRKNKRFIATFSGID 68
            HG++GE+ ++   ++P         L          R   I        R +   +G+ 
Sbjct: 11  AHGISGEIVVEIRTDDPAARFAPGNTLRAKPSRGGPERSCVIESAREHGGRLLVRLAGVT 70

Query: 69  NIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFGAG 128
           +  +A  LR         +  D + E D +++  LE ++     G+  G V  V +  AG
Sbjct: 71  DRDAADALRGTLFVVDSAELPDID-EPDTYYDHQLEGLQVRTTGGQRVGAVAEVLHTAAG 129

Query: 129 SILEIKNTME---KTFLIPFTKFAVLEVNLQENKILIDP 164
            +L +++  +   +  L+PF    V  V+L +  I IDP
Sbjct: 130 ELLAVRDDADGAPREVLVPFVSAIVTAVSLDDGLIEIDP 168


>gi|256831067|ref|YP_003159795.1| 16S rRNA processing protein RimM [Desulfomicrobium baculatum DSM
           4028]
 gi|256580243|gb|ACU91379.1| 16S rRNA processing protein RimM [Desulfomicrobium baculatum DSM
           4028]
          Length = 182

 Score = 51.6 bits (122), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 75/169 (44%), Gaps = 9/169 (5%)

Query: 3   KLD--KLVLMATIGTTHGLNGEVYIDSYANNPI---DLNR-YVLYSNDNRELRILKMYRK 56
           KLD  KLV +  +   HGL GE+ I+ YA++P     L R Y+       +  +L+ +R 
Sbjct: 5   KLDPVKLVELGRVQKPHGLRGELCIEPYADSPFIFEGLTRVYLRLPGKKPKPCVLEGWRA 64

Query: 57  NK-RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
           ++ R + T         A   R   + A+ +D     L+EDEF   DL  +      G  
Sbjct: 65  HQGRALITVDRSQGRDQAEAWRGADVLARERDLP--PLDEDEFRPEDLLGLPVMHVNGSR 122

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
            G +  + +     +  I +      ++P     +L+++L+   IL+DP
Sbjct: 123 IGVLEDIRDVAGQELWFILDDAGNEIMLPAVDEFILDIDLEAGVILVDP 171


>gi|46206221|ref|ZP_00047565.2| COG0806: RimM protein, required for 16S rRNA processing
           [Magnetospirillum magnetotacticum MS-1]
          Length = 179

 Score = 51.6 bits (122), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 47/102 (46%), Gaps = 6/102 (5%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKR----FI 61
           LVL+   G  HGL+GEV + SY   P+ +  Y  L ++D R L +        R     I
Sbjct: 44  LVLLGEFGRPHGLHGEVRLKSYTGQPLAIAGYGPLRASDGRTLELADARPAPGRSPDLLI 103

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDL 103
               G+D+   A  L  + L   R+     E +EDEFF  DL
Sbjct: 104 VRVKGVDDRSGAEALNRVTLAIPRERLGTAE-DEDEFFLADL 144


>gi|148285006|ref|YP_001249096.1| 16S rRNA-processing protein [Orientia tsutsugamushi str. Boryong]
 gi|166226461|sp|A5CF62|RIMM_ORITB RecName: Full=Ribosome maturation factor rimM
 gi|146740445|emb|CAM80941.1| 16S rRNA processing protein [Orientia tsutsugamushi str. Boryong]
          Length = 164

 Score = 51.6 bits (122), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 68/142 (47%), Gaps = 2/142 (1%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIATF 64
            KL+ +  I + +G+ G+V I S+ +   ++  Y L       ++I      +K+ I   
Sbjct: 5   SKLIPIGIISSPYGIRGQVAIKSFTDPASNILNYELKDYRKNIIKIHSAKILSKKIICNI 64

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
             I    +A +L   KLY  + +    +L + E++  +L  ++  + +G+  G++  + N
Sbjct: 65  DQIVTRTAAEQLTRTKLYIYKHEL--PQLPDSEYYVANLNGIKVKNLEGEIIGKINNICN 122

Query: 125 FGAGSILEIKNTMEKTFLIPFT 146
           + AG I+E+     K  + PFT
Sbjct: 123 YNAGDIIEVVYNDGKKIMYPFT 144


>gi|238916981|ref|YP_002930498.1| 16S rRNA processing protein RimM [Eubacterium eligens ATCC 27750]
 gi|238872341|gb|ACR72051.1| 16S rRNA processing protein RimM [Eubacterium eligens ATCC 27750]
          Length = 172

 Score = 51.6 bits (122), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 37/163 (22%), Positives = 75/163 (46%), Gaps = 6/163 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRF--- 60
           ++ ++ +  I +THG+ GEV +    ++P+   +      D +  ++       K F   
Sbjct: 1   MEDMLRVGVITSTHGIRGEVKVFPTTDDPLRFKKLKKCVIDGKREQVAVTVSSVKFFKQF 60

Query: 61  -IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F   D+I+   +     L   R+D    +LE  E+F  DL  ++    +GK+ G +
Sbjct: 61  VILKFKEFDDINDIEKYTKCDLLVSREDAV--KLEPGEYFICDLIGLDVITDEGKHLGVL 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
             V   GA ++ E++    +++LIP     +L+ +L +  I +
Sbjct: 119 KDVLETGANNVYEVEADNGESYLIPVIDQCILDHDLDKKTITV 161


>gi|228998618|ref|ZP_04158205.1| Ribosome maturation factor rimM [Bacillus mycoides Rock3-17]
 gi|228761086|gb|EEM10045.1| Ribosome maturation factor rimM [Bacillus mycoides Rock3-17]
          Length = 188

 Score = 51.6 bits (122), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 42/176 (23%), Positives = 82/176 (46%), Gaps = 10/176 (5%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNP-----IDLNRYVLYSNDNRELRI-LKMY 54
           M+ + K   +  I  THG+ GE+ + S  + P     +    Y+ +      L + +  +
Sbjct: 15  MLFMTKWFNVGKIVNTHGVRGEIRVISRTDFPEERYKVGNTLYIWHDKGTEPLSVKVASH 74

Query: 55  RKNKRF-IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQG 113
           R++K F + TF G +N+    +L+   +    +     EL E E++  ++   +    +G
Sbjct: 75  RQHKTFDLLTFEGYNNVDEVEKLKGSSIKVPEEQLG--ELAEGEYYYHEIIGCKVVTEEG 132

Query: 114 KYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           +  G +  + + GA  +  IK    +  LIP+    VL+VN+ ENK++   +  GL
Sbjct: 133 EDLGTIKEILSPGANDVWVIKRPKGQDLLIPYIDDIVLQVNI-ENKLVTIHVMEGL 187


>gi|197335041|ref|YP_002155308.1| 16S rRNA processing protein RimM [Vibrio fischeri MJ11]
 gi|238690257|sp|B5FAE6|RIMM_VIBFM RecName: Full=Ribosome maturation factor rimM
 gi|197316531|gb|ACH65978.1| 16S rRNA processing protein RimM [Vibrio fischeri MJ11]
          Length = 175

 Score = 51.6 bits (122), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 38/172 (22%), Positives = 81/172 (47%), Gaps = 11/172 (6%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNP---IDLNRYVLYSNDNRELRILKMYRKN 57
           M K D+++++   G ++G+ G + + S+ + P    D   +++          ++ ++++
Sbjct: 1   MSKQDEVIVVGKFGASYGIRGWLKVVSFTDQPESIFDYKPWLIQVKGEWVEFSVESWKRH 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
           K  +    G+D    A    +L++  K       EL EDEF+  +L  ME    +G   G
Sbjct: 61  KGLVCKLKGLDVREEAQTYTNLEIAVKADVLP--ELSEDEFYWRELFGMEVVTTKGYALG 118

Query: 118 QVCGVYNFGAGSILEIKNTMEKTF-----LIPFTKFAVLE-VNLQENKILID 163
            V  ++  G+  +L +K  ++  F     LIPF    V++ ++ +  +I +D
Sbjct: 119 VVDDIFETGSNDVLVVKANLKDAFGKKERLIPFIDEQVIKLIDREAQRIEVD 170


>gi|303241506|ref|ZP_07328007.1| 16S rRNA processing protein RimM [Acetivibrio cellulolyticus CD2]
 gi|302590924|gb|EFL60671.1| 16S rRNA processing protein RimM [Acetivibrio cellulolyticus CD2]
          Length = 174

 Score = 51.6 bits (122), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 37/160 (23%), Positives = 77/160 (48%), Gaps = 8/160 (5%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNRY-----VLYSNDNRELRILKMYRKNKRFIA-T 63
           +  +  THG+ GE+ +    ++P   N+          ++N +    +  + +K F+   
Sbjct: 7   IGKVVNTHGVKGEIKVVPLTDDPNRFNKLKSAFIASEISENMQKYNFEGIKFHKNFVLLK 66

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
             GID+ + A +L+D  +   R+D    +L E  FF  DL   E +D +    G +  + 
Sbjct: 67  LKGIDDPNEAEKLKDKFIIIDREDAV--KLPEGSFFVCDLINCEVYDEKENKLGVLIDIL 124

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
             G+  +  +++  +K  L+P  K  V EV++++ KI+++
Sbjct: 125 QTGSNDVYVVRDENKKEILVPALKSVVKEVSIEDKKIIVE 164


>gi|15895034|ref|NP_348383.1| 16S rRNA-processing protein RimM [Clostridium acetobutylicum ATCC
           824]
 gi|21362869|sp|Q97I95|RIMM_CLOAB RecName: Full=Ribosome maturation factor rimM
 gi|15024726|gb|AAK79723.1|AE007684_11 RimM protein, required for 16S rRNA processing [Clostridium
           acetobutylicum ATCC 824]
 gi|325509171|gb|ADZ20807.1| 16S rRNA-processing protein [Clostridium acetobutylicum EA 2018]
          Length = 166

 Score = 51.6 bits (122), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 41/166 (24%), Positives = 79/166 (47%), Gaps = 10/166 (6%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNRELRILKMYRKNKRFIATFS 65
           +  I  THG+ GE+ I    +   D+NR+     +Y  DN   +++ + ++  + I    
Sbjct: 7   IGQIINTHGVRGELKIYPLTD---DINRFDDLDSVYV-DNEIKKVISVKKQPNKLILKLE 62

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNF 125
           GID +  A + ++  +   R+D    EL+E ++F  D+     FD   K  G+V  V + 
Sbjct: 63  GIDTLDEAVKYKNKYIKVLREDAV--ELKEGQYFIKDIIGCNVFDENDKDLGEVYDVIST 120

Query: 126 GAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN 171
               +  I+   ++  L+P  K  VL++ ++  KI+I  +   L +
Sbjct: 121 KNNDVYCIRKEGQQDILVPALKDIVLKIEIENKKIVIKAVEEWLES 166


>gi|171741403|ref|ZP_02917210.1| hypothetical protein BIFDEN_00486 [Bifidobacterium dentium ATCC
           27678]
 gi|283455250|ref|YP_003359814.1| 16S rRNA processing protein RimM [Bifidobacterium dentium Bd1]
 gi|171277017|gb|EDT44678.1| hypothetical protein BIFDEN_00486 [Bifidobacterium dentium ATCC
           27678]
 gi|283101884|gb|ADB08990.1| rimM 16S rRNA processing protein [Bifidobacterium dentium Bd1]
          Length = 195

 Score = 51.2 bits (121), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 83/182 (45%), Gaps = 27/182 (14%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNRELRILKMYRKNK-RF 60
           +L+ +  IG   GL GEV +  + + P    R+    VLY+ D  E  +++  R  K R+
Sbjct: 10  ELLRVCRIGRAQGLKGEVTVQIFTDEP--EYRFAPGAVLYTKDGEEEYVVEHSRTFKNRW 67

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMET--------FDRQ 112
           I  F GIDN  S+       LY +  D  +E L+ DE++  DL  +E             
Sbjct: 68  IIKFEGIDNRDSSEAANGTVLYGEADD-PEEMLQADEWYPKDLIGLEARLADDNTLGLEP 126

Query: 113 GKYWGQVCGVYNFGAGSILEIK----------NTMEKTFLIPFTKFAVLEVNLQENKILI 162
           G   G+V  V    A  +L+I+            +E + L+PF    V +++L+E  + +
Sbjct: 127 GMAIGKVVDVIEV-AQWLLKIRLANPVKDADGVVVENSALVPFVDELVPDIDLEEGYLTL 185

Query: 163 DP 164
           +P
Sbjct: 186 NP 187


>gi|71908678|ref|YP_286265.1| 16S rRNA processing protein RimM [Dechloromonas aromatica RCB]
 gi|109893010|sp|Q47BI6|RIMM_DECAR RecName: Full=Ribosome maturation factor rimM
 gi|71848299|gb|AAZ47795.1| 16S rRNA processing protein RimM [Dechloromonas aromatica RCB]
          Length = 170

 Score = 51.2 bits (121), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 31/162 (19%), Positives = 74/162 (45%), Gaps = 7/162 (4%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY-----SNDNRELRILKMYRKNKRFI 61
           +V++  +   +G+ G +++  + ++P+      ++         RE R+  +       +
Sbjct: 6   IVVLGRLADPYGIQGWLWLYPFGDDPLAWAEMPVWWIAREGEPWRECRLKSLKAHGNGVV 65

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               G+ +  +A  ++ + + A R+     E  ++EF+ TDL  ++  +   +  G+V G
Sbjct: 66  VLLDGVADRTAAESMKGVLVGAPREALPTTE--KNEFYWTDLIGLDVINTADERIGKVVG 123

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
           +   GA S+L +    +   L+PF    VL V  +  +I ++
Sbjct: 124 LIETGANSVLRVMGDDKVERLLPFVSAVVLAVEKEAGQIRVE 165


>gi|108798935|ref|YP_639132.1| 16S rRNA-processing protein RimM [Mycobacterium sp. MCS]
 gi|119868050|ref|YP_938002.1| 16S rRNA-processing protein [Mycobacterium sp. KMS]
 gi|126434535|ref|YP_001070226.1| 16S rRNA-processing protein RimM [Mycobacterium sp. JLS]
 gi|123178993|sp|Q1BAK8|RIMM_MYCSS RecName: Full=Ribosome maturation factor rimM
 gi|166226454|sp|A3PXV8|RIMM_MYCSJ RecName: Full=Ribosome maturation factor rimM
 gi|166226455|sp|A1UEF4|RIMM_MYCSK RecName: Full=Ribosome maturation factor rimM
 gi|108769354|gb|ABG08076.1| 16S rRNA processing protein RimM [Mycobacterium sp. MCS]
 gi|119694139|gb|ABL91212.1| 16S rRNA processing protein RimM [Mycobacterium sp. KMS]
 gi|126234335|gb|ABN97735.1| 16S rRNA processing protein RimM [Mycobacterium sp. JLS]
          Length = 173

 Score = 51.2 bits (121), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 36/164 (21%), Positives = 63/164 (38%), Gaps = 8/164 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNP-------IDLNRYVLYSNDNRELRILKMYRKNKRF 60
           +++  +   HG+ GE+ ++   ++P         L          R   +  +     R 
Sbjct: 3   LVIGRVAKAHGVTGELVVEVRTDDPDARFVPGARLRGRAPRGGAERAFVVESVRPHGGRL 62

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +    G+ +  +A  LR         D    E E DE+++  LE +      G   G V 
Sbjct: 63  LLRLDGVADRTAADALRGTVFLVDSADLPPIE-EPDEYYDHQLEGLLVRTVDGVDVGTVA 121

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
            V +  AG +L +K       L+PF    V  V+L +  + IDP
Sbjct: 122 EVLHTAAGELLSVKTPEGAEILVPFVTAIVPRVSLADGLVEIDP 165


>gi|294626998|ref|ZP_06705588.1| 16S rRNA-processing protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292598660|gb|EFF42807.1| 16S rRNA-processing protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
          Length = 170

 Score = 51.2 bits (121), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 35/168 (20%), Positives = 76/168 (45%), Gaps = 8/168 (4%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY-----SNDNRELRILKMYR 55
           M + ++ +L+  I    G+ GE+ ++S+      + RY  +     S     +  ++   
Sbjct: 1   MKQTERRILLGRIVGAFGVKGELKLESWTEPRTAIFRYQPWIVRTPSGQESVVSGVRGRD 60

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
           + K  IA F G+ +  +   +   ++Y  R      +   DE++  DLEE++    +G  
Sbjct: 61  QGKNLIAVFPGVTDRDTVEAMHGTEIYVARSALPPPK--PDEYYWVDLEELQVETVEGVK 118

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
            G V  +++ G+  ++ ++   E+     F  F V  V+ + N I++D
Sbjct: 119 LGTVSHLFSTGSNDVVVVRGDRERMIPFVFPDF-VKSVDFEANLIVVD 165


>gi|306823689|ref|ZP_07457064.1| 16S rRNA processing protein RimM [Bifidobacterium dentium ATCC
           27679]
 gi|309802986|ref|ZP_07697087.1| 16S rRNA processing protein RimM [Bifidobacterium dentium
           JCVIHMP022]
 gi|304553396|gb|EFM41308.1| 16S rRNA processing protein RimM [Bifidobacterium dentium ATCC
           27679]
 gi|308220453|gb|EFO76764.1| 16S rRNA processing protein RimM [Bifidobacterium dentium
           JCVIHMP022]
          Length = 199

 Score = 51.2 bits (121), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 83/182 (45%), Gaps = 27/182 (14%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNRELRILKMYRKNK-RF 60
           +L+ +  IG   GL GEV +  + + P    R+    VLY+ D  E  +++  R  K R+
Sbjct: 14  ELLRVCRIGRAQGLKGEVTVQIFTDEP--EYRFAPGAVLYTKDGEEEYVVEHSRTFKNRW 71

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMET--------FDRQ 112
           I  F GIDN  S+       LY +  D  +E L+ DE++  DL  +E             
Sbjct: 72  IIKFEGIDNRDSSEAANGTVLYGEADD-PEEMLQADEWYPKDLIGLEARLADDNTLGLEP 130

Query: 113 GKYWGQVCGVYNFGAGSILEIK----------NTMEKTFLIPFTKFAVLEVNLQENKILI 162
           G   G+V  V    A  +L+I+            +E + L+PF    V +++L+E  + +
Sbjct: 131 GMAIGKVVDVIEV-AQWLLKIRLANPVRDADGVVVENSALVPFVDELVPDIDLEEGYLTL 189

Query: 163 DP 164
           +P
Sbjct: 190 NP 191


>gi|289675161|ref|ZP_06496051.1| 16S rRNA-processing protein RimM [Pseudomonas syringae pv. syringae
           FF5]
          Length = 171

 Score = 51.2 bits (121), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 34/165 (20%), Positives = 82/165 (49%), Gaps = 11/165 (6%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYAN---NPIDLNRYVLY--SNDNRELRILKMYRKNKR 59
           D L+++  I + HG+ GEV + S+ +   N +D   + L    + ++++ ++    ++K 
Sbjct: 9   DDLIVIGKIYSVHGVRGEVKVYSFTDPIGNLLDYKTWTLRREGSVDKQVELVSGRLQSKF 68

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +    G+D+   A  L   ++   R  F D  L++ E++   LE ++  D+ G+  G++
Sbjct: 69  LVTKLKGLDDREEARLLSGYEICVPRNLFPD--LDDGEYYWYQLEGLKVIDQLGQLLGKI 126

Query: 120 CGVYNFGAGSILEIKNTM----EKTFLIPFTKFAVLEVNLQENKI 160
             +   G+  ++ +K       ++  L+P+T+  VL +++    +
Sbjct: 127 DHLLETGSNDVMVVKPCAGSLDDRERLLPYTEQCVLAIDMAAGGV 171


>gi|75907314|ref|YP_321610.1| 16S rRNA-processing protein RimM [Anabaena variabilis ATCC 29413]
 gi|109892999|sp|Q3ME71|RIMM_ANAVT RecName: Full=Probable 16S rRNA-processing protein rimM
 gi|75701039|gb|ABA20715.1| 16S rRNA processing protein RimM [Anabaena variabilis ATCC 29413]
          Length = 233

 Score = 51.2 bits (121), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 77/176 (43%), Gaps = 19/176 (10%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNP----IDLNRYVLYSNDNRELRILKM---YRKN 57
           D+ + +  I +  GL+GEV +   ++ P    +   R++L         I  +   Y +N
Sbjct: 50  DEWLQIGKIVSAQGLSGEVRVYPDSDFPERFEVPGTRWLLRPGQTEPQPIELLHGRYLEN 109

Query: 58  KR-FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETF-DRQGKY 115
           K  ++   +G++N   + ELR   L+    D    EL EDE+   DL  ME F    G  
Sbjct: 110 KNLYVLQLAGVENRTQSEELRGCMLFVPASDRP--ELGEDEYHVVDLIGMEVFLQTSGDL 167

Query: 116 WGQVCGVYNFGAGSILEIK-------NTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
            G V  V   G   +LE+        +   KT LIPF K     V+L+  +I I P
Sbjct: 168 VGTVVDVIPAGN-DLLEVSLHEPVPSDKKPKTVLIPFVKAIAPVVDLETRRIEITP 222


>gi|227495316|ref|ZP_03925632.1| 16S rRNA processing protein RimM [Actinomyces coleocanis DSM 15436]
 gi|226831186|gb|EEH63569.1| 16S rRNA processing protein RimM [Actinomyces coleocanis DSM 15436]
          Length = 176

 Score = 51.2 bits (121), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 71/159 (44%), Gaps = 8/159 (5%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDL----NRYVLYSNDNRELRILKMYRKNKRFIATFS 65
           +A IG  H L GEV ++ + + P +      ++         L +  +     R    F+
Sbjct: 5   VAEIGAAHALKGEVLLNLHTDVPEERIYPGAQFRTVPAGRGPLTVDTIRVHKGRLAVRFA 64

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNF 125
           G  + ++A  LR  KL     DF + ELEED ++  +L   +     G   G+V  +   
Sbjct: 65  GHADRNAAEALRSTKLVI---DFDEVELEEDAWYADELIGFKALHVNGTELGEVSDLILG 121

Query: 126 GAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
            A  +LEIK    K  L+PF +  V  ++ +   +L+DP
Sbjct: 122 DAQDLLEIKYQGRKV-LVPFVEELVPVIDEEAETVLLDP 159


>gi|21242046|ref|NP_641628.1| 16S rRNA-processing protein RimM [Xanthomonas axonopodis pv. citri
           str. 306]
 gi|24418649|sp|Q8PMY2|RIMM_XANAC RecName: Full=Ribosome maturation factor rimM
 gi|21107448|gb|AAM36164.1| 16S rRNA processing protein RimM [Xanthomonas axonopodis pv. citri
           str. 306]
          Length = 170

 Score = 51.2 bits (121), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 35/164 (21%), Positives = 77/164 (46%), Gaps = 8/164 (4%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY---VLYSNDNRELRI--LKMYRKNKR 59
           ++ +L+  I    G+ GE+ ++S+      + RY   ++ S   +E  +  ++   + K 
Sbjct: 5   ERRILLGRIVGAFGVKGELKLESWTEPRTAIFRYQPWIVRSPSGQESVVSGVRGRDQGKN 64

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            IA F G+ +  +   +   ++Y  R      +   DE++  DLEE++    +G   G V
Sbjct: 65  LIAVFPGVTDRDTVEAMHGTEIYVARSALPPPK--PDEYYWVDLEELQVETVEGVKLGTV 122

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
             +++ G+  ++ ++   E+     F  F V  V+ + N I++D
Sbjct: 123 SHLFSTGSNDVVVVRGDRERMIPFVFPDF-VKSVDFEANLIVVD 165


>gi|109897899|ref|YP_661154.1| 16S rRNA processing protein RimM [Pseudoalteromonas atlantica T6c]
 gi|123360985|sp|Q15VI8|RIMM_PSEA6 RecName: Full=Ribosome maturation factor rimM
 gi|109700180|gb|ABG40100.1| 16S rRNA processing protein RimM [Pseudoalteromonas atlantica T6c]
          Length = 176

 Score = 51.2 bits (121), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 35/147 (23%), Positives = 68/147 (46%), Gaps = 11/147 (7%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRKNKRFIAT 63
           ++M  IG  +G+ G V I SY +    +  Y  +      + +E+ + +    NK  +A 
Sbjct: 8   LVMGKIGAPYGVKGWVKITSYTDELDGIFSYTPWLVGQEGNTKEIVVDQWRTHNKGLVAK 67

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
             G++    A  +++L +  K Q     +L+ DEF+  +L  M+    QG   G V  ++
Sbjct: 68  LVGVETRDDAESIKNLDISIKAQQLP--QLDGDEFYWRELVGMQVVTEQGYNLGVVKELF 125

Query: 124 NFGAGSILEIKNTMEKTF-----LIPF 145
             GA  ++ IK  ++  F     ++P+
Sbjct: 126 ETGANDVMLIKANLKDAFGQKERMVPY 152


>gi|91794104|ref|YP_563755.1| 16S rRNA-processing protein [Shewanella denitrificans OS217]
 gi|122968557|sp|Q12KJ4|RIMM_SHEDO RecName: Full=Ribosome maturation factor rimM
 gi|91716106|gb|ABE56032.1| 16S rRNA processing protein RimM [Shewanella denitrificans OS217]
          Length = 176

 Score = 51.2 bits (121), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 39/166 (23%), Positives = 82/166 (49%), Gaps = 12/166 (7%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRKNKRFIAT 63
           V++  +G++HG+ G + I +Y ++   +  YV +        RE+++ +   + K  +A 
Sbjct: 8   VVLGKLGSSHGIKGWLKITAYTDSVEGIFDYVPWLIKDQGVWREVKVTQWRFQGKAVVAE 67

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
             G+     A  L + ++    +  K  EL++++F++ DL   E  +  G   G V  + 
Sbjct: 68  LEGVTTREQAQMLTNCEIAILPEQMK--ELDDNDFYHRDLIGCEVTNVNGYNLGIVDQIV 125

Query: 124 NFGAGSILEIKNTMEKTF-----LIPF-TKFAVLEVNLQENKILID 163
             G+  +L +K   +  F     +IPF T+  + +V+LQ  +I++D
Sbjct: 126 ETGSNDVLLVKANAKDAFGKVERMIPFVTEQFIKQVDLQGKQIVVD 171


>gi|28868681|ref|NP_791300.1| 16S rRNA processing protein RimM [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|213969057|ref|ZP_03397196.1| 16S rRNA processing protein RimM [Pseudomonas syringae pv. tomato
           T1]
 gi|301384048|ref|ZP_07232466.1| 16S rRNA-processing protein RimM [Pseudomonas syringae pv. tomato
           Max13]
 gi|302058754|ref|ZP_07250295.1| 16S rRNA-processing protein RimM [Pseudomonas syringae pv. tomato
           K40]
 gi|302131715|ref|ZP_07257705.1| 16S rRNA-processing protein RimM [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|37999587|sp|Q886V1|RIMM_PSESM RecName: Full=Ribosome maturation factor rimM
 gi|28851920|gb|AAO54995.1| 16S rRNA processing protein RimM [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|213926055|gb|EEB59611.1| 16S rRNA processing protein RimM [Pseudomonas syringae pv. tomato
           T1]
 gi|331016303|gb|EGH96359.1| 16S rRNA-processing protein RimM [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 179

 Score = 51.2 bits (121), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 34/168 (20%), Positives = 84/168 (50%), Gaps = 11/168 (6%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYAN---NPIDLNRYVLYSNDN--RELRILKMYRKNKR 59
           D L+++  I + HG+ GEV + S+ +   N +D   + L    +  +++ ++    ++K 
Sbjct: 9   DDLIVIGKIYSVHGVRGEVKVYSFTDPIGNLLDYKTWTLRREGSVEKQVELVSGRLQSKF 68

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +    G+D+   A  L   ++   R  F D  L++ E++   LE ++  D+ G+  G++
Sbjct: 69  LVVKLKGLDDREEARLLSGYEICVPRNLFPD--LDDGEYYWYQLEGLKVIDQLGQLLGKI 126

Query: 120 CGVYNFGAGSILEIKNTM----EKTFLIPFTKFAVLEVNLQENKILID 163
             +   G+  ++ +K       ++  L+P+T+  VL +++   ++ ++
Sbjct: 127 DHLLETGSNDVMVVKPCAGSLDDRERLLPYTEQCVLAIDMAAGEMKVE 174


>gi|242088857|ref|XP_002440261.1| hypothetical protein SORBIDRAFT_09g028680 [Sorghum bicolor]
 gi|241945546|gb|EES18691.1| hypothetical protein SORBIDRAFT_09g028680 [Sorghum bicolor]
          Length = 663

 Score = 51.2 bits (121), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 46/190 (24%), Positives = 86/190 (45%), Gaps = 32/190 (16%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNP-----IDLNRYV-LYSNDNRELRILKMYRK-- 56
           ++LV +  +   HG+ G+V +    + P         R++   +   +++R  ++ R   
Sbjct: 94  EELVEVGYVSGAHGVRGDVLVTPRTDFPELRLATPGTRWLRARAAGKQQVREFELVRGRA 153

Query: 57  ---NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQ- 112
               K +I +F GIDN+  A ++    +  K  D    E+E+DEF++ DL  M    +  
Sbjct: 154 HTGKKSWIVSFDGIDNLDEARQIVGSAVLVKAGD--RPEIEDDEFYSLDLVGMRVIVKDT 211

Query: 113 GKYWGQVCGVYNFGAGSILEIK-NTMEKTFL-----------------IPFTKFAVLEVN 154
           GK  G V  ++NFG G +L++   + E T +                 IPF +  V +V+
Sbjct: 212 GKVVGTVGQIFNFGGGDLLQVMIGSAEGTAVDPDSENQDSISSREHVWIPFAEDIVPDVD 271

Query: 155 LQENKILIDP 164
           +   ++ I P
Sbjct: 272 MASREMWITP 281


>gi|119717481|ref|YP_924446.1| 16S rRNA processing protein RimM [Nocardioides sp. JS614]
 gi|171704654|sp|A1SLS4|RIMM_NOCSJ RecName: Full=Ribosome maturation factor rimM
 gi|119538142|gb|ABL82759.1| 16S rRNA processing protein RimM [Nocardioides sp. JS614]
          Length = 184

 Score = 51.2 bits (121), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 76/166 (45%), Gaps = 14/166 (8%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSND--NRELRILKMYRKNKRF- 60
           VL+  IG  HG+ GE+ +D   + P    R+    VL +        R+ ++  ++ R+ 
Sbjct: 6   VLVGRIGKPHGIRGELTLDVRTDEP--ERRFAPGAVLRAEPPAGSASRLRRVTVRSARWH 63

Query: 61  ----IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
               +  F  + +  +A   R + L+A          + DE+++  L  +  +D  G   
Sbjct: 64  QSTLLVAFEEVADRTAAEAARGILLHAT-VPADAAPDDPDEYYDHQLVGLAAYDVSGAAL 122

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
           G V G+ + GA  +L ++    +  L+PF K  V EV+L   +++I
Sbjct: 123 GSVTGLVHGGAQDLLTVRTPDGRDALVPFVKALVPEVDLAGRRVVI 168


>gi|83814853|ref|YP_445748.1| 16S rRNA processing protein RimM [Salinibacter ruber DSM 13855]
 gi|294507643|ref|YP_003571701.1| 16S rRNA processing protein rimM [Salinibacter ruber M8]
 gi|109893047|sp|Q2S233|RIMM_SALRD RecName: Full=Ribosome maturation factor rimM
 gi|83756247|gb|ABC44360.1| 16S rRNA processing protein RimM [Salinibacter ruber DSM 13855]
 gi|294343971|emb|CBH24749.1| 16S rRNA processing protein rimM [Salinibacter ruber M8]
          Length = 198

 Score = 51.2 bits (121), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 72/171 (42%), Gaps = 17/171 (9%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSN---DNRELRILKM------YRKN 57
           LV +  I   HGL+GE+ ID  A +  D  R+ +           R+++       Y+K 
Sbjct: 27  LVKVGFIFRPHGLDGELKIDPSATD--DPARFEVLPTVFVGPHPRRVVRHDIASVRYQKT 84

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEE---LEEDEFFNTDLEEMETFDRQGK 114
           KR I    G+D I    +  D +  AK   F  E    LE+DE F  DL        +G 
Sbjct: 85  KRGITVILGLDGI---VDRDDAEAVAKMDVFATEAALGLEDDELFADDLVGWTVVTEEGA 141

Query: 115 YWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPI 165
             G V       A  +  ++   +   +IP     ++E++ +  +I++ PI
Sbjct: 142 VQGTVADFMEMPAQDLFVVRTPEDTEAMIPAIDDFIIEIDEEAERIVVRPI 192


>gi|239623997|ref|ZP_04667028.1| 16S rRNA processing protein RimM [Clostridiales bacterium
           1_7_47_FAA]
 gi|239522028|gb|EEQ61894.1| 16S rRNA processing protein RimM [Clostridiales bacterium
           1_7_47FAA]
          Length = 170

 Score = 51.2 bits (121), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 74/161 (45%), Gaps = 10/161 (6%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPI---DLNRYVLYSNDNR---ELRILKMYRKN 57
           ++ ++ +  I +THG+ GEV +    ++P     L   +L +       E++ +K ++  
Sbjct: 1   MEDMLRVGVIASTHGVRGEVKVFPTTDDPSRFKQLKEVILDTGKEHLPLEIQQVKFFKN- 59

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              I  F G DNI+   + +   L   R   +  ELE DE+F TDL  +E     G+  G
Sbjct: 60  -MVILKFKGYDNINDIEKYKSKDLLIPRD--QAVELEPDEYFITDLIGLEVRTEDGEILG 116

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQEN 158
            +  V   GA  +  ++    K  L+P     +L V+L++ 
Sbjct: 117 TMKDVLETGANDVYVVQMKDGKELLLPAIGDCILNVDLEQG 157


>gi|242308900|ref|ZP_04808055.1| 16S rRNA processing protein RimM [Helicobacter pullorum MIT
           98-5489]
 gi|239524564|gb|EEQ64430.1| 16S rRNA processing protein RimM [Helicobacter pullorum MIT
           98-5489]
          Length = 183

 Score = 50.8 bits (120), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 47/164 (28%), Positives = 79/164 (48%), Gaps = 13/164 (7%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIATFSGI 67
           V +A IG   G+ GEV +    + P  L     Y +   +L I    ++N R    F+ I
Sbjct: 12  VSVAKIGRPVGVKGEVLLHLLTDFPEVLKVGDTYFSQIGDLTIQSYNKENSRI--KFTQI 69

Query: 68  DNIHSASELRDLKLYAKRQDFKDE--ELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNF 125
           ++   A +  +L LY   QDF  E  +L++DEFF  ++   +  +  G+  G+VC +  F
Sbjct: 70  NSREIAKQFTNLILYT-TQDFTKEHCKLKKDEFFWFEIIGSKILEL-GEILGEVCEIERF 127

Query: 126 GAGSILEIKNTME-------KTFLIPFTKFAVLEVNLQENKILI 162
           G    L IK + +       K+FL+P+ K  + EV++     +I
Sbjct: 128 GQKDFLSIKTSHDLQAKGFPKSFLVPYEKRYIKEVDIHTTPKII 171


>gi|70728477|ref|YP_258226.1| 16S rRNA-processing protein RimM [Pseudomonas fluorescens Pf-5]
 gi|109893033|sp|Q4KHQ7|RIMM_PSEF5 RecName: Full=Ribosome maturation factor rimM
 gi|68342776|gb|AAY90382.1| 16S rRNA processing protein RimM [Pseudomonas fluorescens Pf-5]
          Length = 178

 Score = 50.8 bits (120), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 39/167 (23%), Positives = 81/167 (48%), Gaps = 10/167 (5%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYAN---NPIDLNRYVLYSNDNRELRILKMYRKNKRF- 60
           D L+++  I + HG+ GEV + S+ +   N +D   + L    + +   L   R N +F 
Sbjct: 9   DDLIVIGKIYSVHGVRGEVKVFSFTDPIKNLLDYKTWTLKREGSVKQVELVSGRGNDKFL 68

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +A   G+D+   A  L   ++   R  F   EL + E++   L+ ++  D  G+  G++ 
Sbjct: 69  VAKLKGLDDREEARLLAGYEICVPRSLFP--ELTDGEYYWYQLQGLKVIDGLGQLLGKID 126

Query: 121 GVYNFGAGSILEIKNTM----EKTFLIPFTKFAVLEVNLQENKILID 163
            +   G+  ++ +K       ++  L+P+T+  VL V+L   ++ ++
Sbjct: 127 HLLETGSNDVMVVKPCAGSLDDRERLLPYTEQCVLAVDLAAGEMKVE 173


>gi|27364980|ref|NP_760508.1| 16S rRNA-processing protein RimM [Vibrio vulnificus CMCP6]
 gi|37680971|ref|NP_935580.1| 16S rRNA-processing protein [Vibrio vulnificus YJ016]
 gi|320155364|ref|YP_004187743.1| 16S rRNA processing protein RimM [Vibrio vulnificus MO6-24/O]
 gi|29611849|sp|Q8DC32|RIMM_VIBVU RecName: Full=Ribosome maturation factor rimM
 gi|46397679|sp|Q7MHT2|RIMM_VIBVY RecName: Full=Ribosome maturation factor rimM
 gi|27361126|gb|AAO10035.1| 16S rRNA processing protein RimM [Vibrio vulnificus CMCP6]
 gi|37199721|dbj|BAC95551.1| RimM protein [Vibrio vulnificus YJ016]
 gi|319930676|gb|ADV85540.1| 16S rRNA processing protein RimM [Vibrio vulnificus MO6-24/O]
          Length = 182

 Score = 50.8 bits (120), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 79/169 (46%), Gaps = 12/169 (7%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNR----ELRILKMYRKNKRF 60
           D+ +++   G+T+G+ G + + SY +N   L  Y  +  + +    E ++    R NK  
Sbjct: 11  DERIVVGKFGSTYGIRGWLKVFSYTDNAESLFDYSPWYVNQKGEWVEFKVESWKRHNKGM 70

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +A   G+D    A  L +L++          EL EDEF+  +L  M+     G   G V 
Sbjct: 71  VAKLEGLDVREDAHLLTNLEIAIDPAVLP--ELSEDEFYWRELFGMQVVTTNGYDLGVVT 128

Query: 121 GVYNFGAGSILEIKNTMEKTF-----LIPFTKFAV-LEVNLQENKILID 163
            +   G+  +L +K  ++  F     LIPF +  V ++V+ +  +I +D
Sbjct: 129 DMLETGSNDVLVVKANLKDAFGQKERLIPFLEEQVIIKVDREAQRIEVD 177


>gi|307730594|ref|YP_003907818.1| 16S rRNA processing protein RimM [Burkholderia sp. CCGE1003]
 gi|307585129|gb|ADN58527.1| 16S rRNA processing protein RimM [Burkholderia sp. CCGE1003]
          Length = 252

 Score = 50.8 bits (120), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 74/171 (43%), Gaps = 17/171 (9%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNP------IDLNRYVLYSNDNRE-LRILKMYRKNKRF 60
           V +  I   +GL G V + ++A+        +   R+ L     R     L+    +   
Sbjct: 79  VEVGAIVDAYGLKGWVKVAAHADAGQGGDALLSAKRWWLLKGRERHSAPSLQARTHSDSV 138

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +A   GI +  +A  LR  ++Y  R +F    L+ DEF+  DL  ++  +  G+  G+V 
Sbjct: 139 VAHLGGIADRDAALALRGSRVYVSRSEF--PALQADEFYWVDLLGLDVVNLAGENLGKVA 196

Query: 121 GVYNFGAGSILEIK--------NTMEKTFLIPFTKFAVLEVNLQENKILID 163
           G+ + GA S+L ++          +    LIPF    V  V+    +I +D
Sbjct: 197 GMIDNGAHSVLRVEYPAADKSGKPVTAERLIPFVGVFVKTVDQAAKQITVD 247


>gi|51892607|ref|YP_075298.1| 16S rRNA processing protein [Symbiobacterium thermophilum IAM
           14863]
 gi|59798669|sp|Q67PD9|RIMM_SYMTH RecName: Full=Ribosome maturation factor rimM
 gi|51856296|dbj|BAD40454.1| 16S rRNA processing protein [Symbiobacterium thermophilum IAM
           14863]
          Length = 174

 Score = 50.8 bits (120), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 39/169 (23%), Positives = 75/169 (44%), Gaps = 7/169 (4%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNP---IDLNRYVLYSNDNRELRILKMYRKNKRFIAT 63
           L+ +  +   HG+ G V +    + P   + L R ++   D       + + KN   I  
Sbjct: 9   LIRIGQVTAPHGVRGAVRVYPTTDFPERFVTLKRVMIDGPDRAVGARFRGFVKNL-VILE 67

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV- 122
             GI + + A  LR   L   R++     L E  +++ D+  +E  D  G+  G+V  V 
Sbjct: 68  LEGITDRNQAERLRGADLLVPREEV--HPLPEGYYYDFDIIGIEVVDPDGRQLGRVVEVD 125

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN 171
           +      +  ++    K +L+P  +  V E++L+  +++IDPI   L +
Sbjct: 126 HTSPVHDLYVVETAPGKRYLVPAVRRFVKEIDLETGRMVIDPIPGLLED 174


>gi|168032186|ref|XP_001768600.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162680099|gb|EDQ66538.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 200

 Score = 50.8 bits (120), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 80/182 (43%), Gaps = 27/182 (14%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYR--------- 55
           D  V +  +  THG+ GE+ I S  + P +  R+   +   R ++ ++M +         
Sbjct: 1   DDFVEIGIVAETHGVYGELRIRSSTDFPEE--RF--ETPGTRWIKKMRMGKPSITEVELI 56

Query: 56  -------KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMET 108
                  K   ++    G+D +  ASE +   +   R D +   LEEDE +  DL  M+ 
Sbjct: 57  EGRETIGKQTSWLVRLKGVDTLEKASEFQGATMLI-RADERPVSLEEDEDYIPDLLGMDV 115

Query: 109 FDRQGK-YWGQVCGVYNFGAGSILEIKNT-----MEKTFLIPFTKFAVLEVNLQENKILI 162
             ++ K   G +  V+N GA  +L ++ T      +    IPF K  V  V++  N++ I
Sbjct: 116 VIQETKETIGTIVDVHNSGASDLLRVQLTKPIRGKDVRIWIPFVKEIVPVVDISSNRVEI 175

Query: 163 DP 164
            P
Sbjct: 176 SP 177


>gi|58580949|ref|YP_199965.1| 16S rRNA-processing protein RimM [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|188578072|ref|YP_001915001.1| 16S rRNA-processing protein RimM [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|58425543|gb|AAW74580.1| 16S rRNA processing protein RimM [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|188522524|gb|ACD60469.1| 16S rRNA processing protein RimM [Xanthomonas oryzae pv. oryzae
           PXO99A]
          Length = 180

 Score = 50.8 bits (120), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 35/168 (20%), Positives = 79/168 (47%), Gaps = 8/168 (4%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY---VLYSNDNRELRI--LKMYR 55
           M + ++ +L+  +    G+ GE+ ++S+      + RY   ++ +   +E  I  ++   
Sbjct: 11  MKQTERRILLGRVVGAFGVKGELKLESWTEPRSAIFRYQPWIVRAPSGQESVINGVRGRD 70

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
           + K  IA F G+ +  +   +   ++Y  R      +   DE++  DLEE++    +G  
Sbjct: 71  QGKNLIAVFPGVADRDTVEAMHGTEIYVARSALPPPK--PDEYYWVDLEELQVETVEGVK 128

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
            G V  +++ G+  ++ ++   E+     F  F V  V+ + N I++D
Sbjct: 129 LGTVSHLFSTGSNDVVVVRGDRERMIPFVFPDF-VKSVDFEANLIVVD 175


>gi|326333673|ref|ZP_08199910.1| 16S rRNA processing protein RimM [Nocardioidaceae bacterium
           Broad-1]
 gi|325948579|gb|EGD40682.1| 16S rRNA processing protein RimM [Nocardioidaceae bacterium
           Broad-1]
          Length = 181

 Score = 50.8 bits (120), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 73/168 (43%), Gaps = 18/168 (10%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNR-------ELRILKMYRK 56
           +L+  IG  HG+ G V ++   + P    R+    VL +   +        L +      
Sbjct: 1   MLVGRIGKPHGIRGFVTVEVRTDEPD--RRFAEGTVLRTQPPKGSAYAAKRLTVEGARWH 58

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEED--EFFNTDLEEMETFDRQGK 114
            +     F  I + + A   R   L+A   D   EE  ED  E+++  L  +  FD +G+
Sbjct: 59  GQVLQVAFEEITDRNEAEAARGTLLFA---DVPAEETPEDPDEYYDHQLIGLTAFDEEGR 115

Query: 115 YWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
             G V  + + GA  +L I+    +  L+PF K  V  V+L E K++I
Sbjct: 116 ELGTVKALVHGGAQDLLTIRTPDRRDALVPFVKALVPVVDLTEKKVVI 163


>gi|296126136|ref|YP_003633388.1| 16S rRNA processing protein RimM [Brachyspira murdochii DSM 12563]
 gi|296017952|gb|ADG71189.1| 16S rRNA processing protein RimM [Brachyspira murdochii DSM 12563]
          Length = 169

 Score = 50.8 bits (120), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 61/133 (45%), Gaps = 8/133 (6%)

Query: 7   LVLMATIGTTHGLNGEVYID-----SYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFI 61
           ++  A I   HGL GEV +       +A+ P+ LN+      + +   +  + +KNK F+
Sbjct: 2   IIFYAKITGIHGLKGEVEMTFSDKGYFASLPV-LNKNTSIIINGQTFTVTNVKKKNKAFV 60

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
                ID +  A EL  L ++    +    EL+ D F+  +L   +  D     +G++  
Sbjct: 61  LALKDIDTLEKAKELIGLDIFIDSSNLP--ELDNDTFYEAELIGYKIIDSDNNIYGEITD 118

Query: 122 VYNFGAGSILEIK 134
           VY+  +  + EIK
Sbjct: 119 VYSIPSNYVFEIK 131


>gi|229006118|ref|ZP_04163806.1| Ribosome maturation factor rimM [Bacillus mycoides Rock1-4]
 gi|228755194|gb|EEM04551.1| Ribosome maturation factor rimM [Bacillus mycoides Rock1-4]
          Length = 171

 Score = 50.8 bits (120), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 78/167 (46%), Gaps = 10/167 (5%)

Query: 10  MATIGTTHGLNGEVYIDSYANNP-----IDLNRYVLYSNDNRELRI-LKMYRKNKRF-IA 62
           +  I  THG+ GE+ + S  + P     +    Y+ +      L + +  +R++K F + 
Sbjct: 7   VGKIVNTHGVRGEIRVISRTDFPEERYKVGNTLYIWHDKGTEPLSVKVASHRQHKTFDLL 66

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
           TF G +N+    +L+   +    +     EL E E++  ++   +    +G+  G +  +
Sbjct: 67  TFEGYNNVDEVEKLKGSSIKVPEEQLG--ELAEGEYYYHEIIGCKVVTEEGEDLGTIKEI 124

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
            + GA  +  IK    +  LIP+    VL+VN+ ENK++   +  GL
Sbjct: 125 LSPGANDVWVIKRPKGQDLLIPYIDDIVLQVNI-ENKLVTIHVMEGL 170


>gi|317125415|ref|YP_004099527.1| 16S rRNA processing protein RimM [Intrasporangium calvum DSM 43043]
 gi|315589503|gb|ADU48800.1| 16S rRNA processing protein RimM [Intrasporangium calvum DSM 43043]
          Length = 182

 Score = 50.8 bits (120), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 44/165 (26%), Positives = 71/165 (43%), Gaps = 11/165 (6%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNP--------IDLNRYVLYSNDNRELRILKMYRKNKR 59
           VL+A IG  HGL GEV +  + ++P        +        S   R+L +      N  
Sbjct: 6   VLVARIGKPHGLRGEVTVQLHTDDPERRFAPGEVLETEATPGSGVPRQLTVRTTRDHNGT 65

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDE-FFNTDLEEMETFDRQGKYWGQ 118
           ++  F  I +   A  LR  +L  +      +E E+D  +F  DL  +E  DR+G   G 
Sbjct: 66  WLLGFEEIPDRTGAEGLRGTRLVVEASAVTADEDEDDAAWFEDDLVGLEVRDREGLVLGM 125

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
           V G+    A   L I+ +   T  +PF +  V  V    + +++D
Sbjct: 126 VTGLDLGAAQDRLVIRLSDGVTAQVPFVEAIVPTV--AADHVVVD 168


>gi|46579250|ref|YP_010058.1| 16S rRNA processing protein RimM [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120603187|ref|YP_967587.1| 16S rRNA processing protein RimM [Desulfovibrio vulgaris DP4]
 gi|59798766|sp|Q72DU2|RIMM_DESVH RecName: Full=Ribosome maturation factor rimM
 gi|166226438|sp|A1VFE4|RIMM_DESVV RecName: Full=Ribosome maturation factor rimM
 gi|46448664|gb|AAS95317.1| 16S rRNA processing protein RimM [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120563416|gb|ABM29160.1| 16S rRNA processing protein RimM [Desulfovibrio vulgaris DP4]
 gi|311233079|gb|ADP85933.1| 16S rRNA processing protein RimM [Desulfovibrio vulgaris RCH1]
          Length = 176

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 68/163 (41%), Gaps = 6/163 (3%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDN---RELRILKMYRKNKRFIA 62
           + + +  +   HGL GEV +D YA++P  L   V         R +++  M     R + 
Sbjct: 5   RFIEIGLLTRPHGLKGEVCVDYYADSPFLLEGTVYLKAGRAAPRPVKVQSMRMHKGRPLV 64

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEME-TFDRQGKYWGQVCG 121
            F G+++  +A  LR   +          EL+EDE +  +LE +    D  G++ G +  
Sbjct: 65  IFEGVNDRTAAELLRGHVMLVPEDTLP--ELDEDEVYLFELEGISVVIDESGEHLGVIER 122

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           +       I  I+    K  L P     VL+++L      I P
Sbjct: 123 IDTDAYQEIWVIRTPQGKEVLFPAAAPFVLDIDLDSRTARIAP 165


>gi|145297737|ref|YP_001140578.1| 16S rRNA-processing protein RimM [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|172044435|sp|A4SIV8|RIMM_AERS4 RecName: Full=Ribosome maturation factor rimM
 gi|142850509|gb|ABO88830.1| 16S rRNA processing protein RimM [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 173

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 80/170 (47%), Gaps = 12/170 (7%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSY---ANNPIDLNRYVLYSND-NRELRILKMYRKNKR 59
           ++K V++ T+GT +G+ G + ++S+   A    D N +++  N   REL++    R NK 
Sbjct: 1   MEKPVVLGTLGTVYGIKGWLKVNSFTDVAEAIFDYNPWMINQNGVWRELKVSAWKRHNKG 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I    GID    A  L ++++           L E EF+  DL        +G   G+V
Sbjct: 61  LICKIDGIDLREDALALTNVEIGVPADLLP--ALPEGEFYWRDLIGCSVSTTKGYDLGKV 118

Query: 120 CGVYNFGAGSILEIKNTMEKTF-----LIPFTKFAVLE-VNLQENKILID 163
             +   G+  +L ++  ++  F     LIPF +  V++ ++L    I +D
Sbjct: 119 TELMETGSNDVLVVEANVKDAFGAKERLIPFLEEQVIKHIDLTARTIEVD 168


>gi|21223948|ref|NP_629727.1| 16S rRNA-processing protein RimM [Streptomyces coelicolor A3(2)]
 gi|256784950|ref|ZP_05523381.1| 16S rRNA-processing protein RimM [Streptomyces lividans TK24]
 gi|289768842|ref|ZP_06528220.1| 16S rRNA processing protein RimM [Streptomyces lividans TK24]
 gi|61230608|sp|P0A4D3|RIMM_STRCO RecName: Full=Ribosome maturation factor rimM
 gi|61230611|sp|P0A4D4|RIMM_STRLI RecName: Full=Ribosome maturation factor rimM
 gi|3191986|emb|CAA19385.1| putative 16S rRNA processing protein [Streptomyces coelicolor
           A3(2)]
 gi|3336921|emb|CAB06806.1| hypothetical protein [Streptomyces lividans]
 gi|289699041|gb|EFD66470.1| 16S rRNA processing protein RimM [Streptomyces lividans TK24]
          Length = 188

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/187 (20%), Positives = 80/187 (42%), Gaps = 5/187 (2%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNP-IDLNRYVLYSND---NRELRILKMYRKNKRFIAT 63
           +++A IG  HG+ GEV ++   + P + L    + + D      L I      + R +  
Sbjct: 3   LVVARIGRAHGIKGEVTVEVRTDEPELRLGPGAVLATDPASTGPLTIESGRVHSGRLLLR 62

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F+G+ +   A  LR+  L A   D  +   +EDE+++  L +++     G   G++  + 
Sbjct: 63  FAGVHDRTGAEALRNTLLIAD-VDPDERPEDEDEYYDHQLIDLDVVTEDGTEVGRITEIS 121

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQYDCPL 183
           +     +  ++        +PF    V  ++L   + +IDP    +++        D   
Sbjct: 122 HLPTQDLFVVERPDGSEVYVPFVSEIVTGIDLDAQRAVIDPPPGLIDDRAEIASARDAGA 181

Query: 184 DSAGKKS 190
           + AG ++
Sbjct: 182 EDAGDEA 188


>gi|237800085|ref|ZP_04588546.1| 16S rRNA-processing protein RimM [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|331022940|gb|EGI02997.1| 16S rRNA-processing protein RimM [Pseudomonas syringae pv. oryzae
           str. 1_6]
          Length = 179

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/168 (20%), Positives = 84/168 (50%), Gaps = 11/168 (6%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYAN---NPIDLNRYVLY--SNDNRELRILKMYRKNKR 59
           D L+++  I + HG+ GEV + S+ +   N +D   + L    + ++++ ++    ++K 
Sbjct: 9   DDLIVIGKIYSVHGVRGEVKVYSFTDPIGNLLDYKTWTLRREGSVDKQVELVSGRLQSKF 68

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +    G+D+   A  L    +   R  F D  L++ E++   LE ++  D+ G+  G++
Sbjct: 69  LVVKLKGLDDREEARLLSGYDICVPRNLFPD--LDDGEYYWYQLEGLKVIDQLGQLLGKI 126

Query: 120 CGVYNFGAGSILEIKNTM----EKTFLIPFTKFAVLEVNLQENKILID 163
             +   G+  ++ +K       ++  L+P+T+  VL +++   ++ ++
Sbjct: 127 DHLLETGSNDVMVVKPCAGSLDDRERLLPYTEQCVLAIDMAAGEMKVE 174


>gi|295696072|ref|YP_003589310.1| 16S rRNA processing protein RimM [Bacillus tusciae DSM 2912]
 gi|295411674|gb|ADG06166.1| 16S rRNA processing protein RimM [Bacillus tusciae DSM 2912]
          Length = 175

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 71/171 (41%), Gaps = 12/171 (7%)

Query: 10  MATIGT---THGLNGEVYIDSYANNPIDLNRY--VLY----SNDNRELRILKMYRKNKRF 60
           M T+G    THGL GEV I    + P    R   VL+    +    ELR+ K  +    F
Sbjct: 7   MYTVGVVVGTHGLRGEVRIFPRTDFPEVRFRQGSVLWLDGGTGPAMELRVEKARKHKNVF 66

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           I  F+G  +I +    +  +L           L E  ++   L      D  G++ G++ 
Sbjct: 67  IVQFAGFHSIQAVEPWKGRELKVPESALMP--LPEGRYYIHQLVGCRVVDEHGRWLGELS 124

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN 171
            V   GA  +  ++    K  L+P     V  V++ E+++++  +  GL  
Sbjct: 125 EVLQPGANDVYVVRRPGAKDLLVPAIPSVVKRVSV-EDRLMVVSLPEGLEE 174


>gi|78046899|ref|YP_363074.1| 16S rRNA-processing protein RimM [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|109893068|sp|Q3BVY9|RIMM_XANC5 RecName: Full=Ribosome maturation factor rimM
 gi|78035329|emb|CAJ22974.1| 16S rRNA processing protein RimM [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
          Length = 180

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/168 (20%), Positives = 75/168 (44%), Gaps = 8/168 (4%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY-----SNDNRELRILKMYR 55
           M + ++ +L+  I    G+ GE+ ++S+      + RY  +     S     +  ++   
Sbjct: 11  MKQTERRILLGRIVGAFGVKGELKLESWTEPRTAIFRYQPWIVRAPSGQESVVSGVRGRD 70

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
           + K  IA F G+ +  +   +   ++Y  R      +   DE++  DLEE++    +G  
Sbjct: 71  QGKNLIAVFPGVTDRDTVEAMHGTEIYVARSALPPPK--PDEYYWVDLEELQVETVEGVK 128

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
            G V  +++ G+  ++ ++   E+     F  F V  V+   N I++D
Sbjct: 129 LGTVSHLFSTGSNDVVVVRGDRERMIPFVFPDF-VKSVDFDANLIVVD 175


>gi|317152479|ref|YP_004120527.1| 16S rRNA processing protein RimM [Desulfovibrio aespoeensis Aspo-2]
 gi|316942730|gb|ADU61781.1| 16S rRNA processing protein RimM [Desulfovibrio aespoeensis Aspo-2]
          Length = 199

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 74/169 (43%), Gaps = 7/169 (4%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRI---LKMYRKNKRFI- 61
           L+L+  +   HG+ GE+ I S+A++P        LY  D  +  I   ++ +R++K  + 
Sbjct: 6   LILVGGVVRPHGIRGEICIKSHADSPSLFGLVAALYLQDKGKPPIPHAVRSWREHKGMVL 65

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
            T  G+D+   A  LR  ++  +  D    EL+E E +   L         G   G +  
Sbjct: 66  LTLDGVDDRDKAEALRGREVLVREADLP--ELDEGEHYLYQLMGCRVTLADGTDVGVLEH 123

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
            +  G      I N      ++P     VL+V+L    I+IDP A  L+
Sbjct: 124 FFETGEQDTWVIINEAGTEIMLPAVPEFVLDVDLDAGVIVIDPPAGLLD 172


>gi|117620610|ref|YP_855209.1| 16S rRNA-processing protein RimM [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|171855192|sp|A0KG24|RIMM_AERHH RecName: Full=Ribosome maturation factor rimM
 gi|117562017|gb|ABK38965.1| 16S rRNA processing protein RimM [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 173

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 80/170 (47%), Gaps = 12/170 (7%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSY---ANNPIDLNRYVLYSND-NRELRILKMYRKNKR 59
           ++K V++ T+GT +G+ G + ++S+   A    D N +++  N   RE+++    R NK 
Sbjct: 1   MEKPVVLGTLGTVYGIKGWLKVNSFTDVAEAIFDYNPWLINQNGVWREIQVSSWKRHNKG 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I    GID    A  L ++++           L E EF+  DL        +G   G+V
Sbjct: 61  LICKLDGIDVREDALALTNVEIGVAADLLP--ALPEGEFYWRDLIGCSVVTTKGYDLGKV 118

Query: 120 CGVYNFGAGSILEIKNTMEKTF-----LIPFTKFAVLE-VNLQENKILID 163
             +   G+  +L ++  ++  F     LIPF +  V++ ++L    I +D
Sbjct: 119 TELMETGSNDVLVVEANVKDAFGAKERLIPFLEEQVIKNIDLTARTIEVD 168


>gi|317508408|ref|ZP_07966078.1| 16S rRNA processing protein RimM [Segniliparus rugosus ATCC
           BAA-974]
 gi|316253255|gb|EFV12655.1| 16S rRNA processing protein RimM [Segniliparus rugosus ATCC
           BAA-974]
          Length = 179

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 69/157 (43%), Gaps = 12/157 (7%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLN---------RYVLYSNDNRELRILKMYRKNK 58
           +++  I  +HGL GEV ++   + P +L          R        + LR++ +     
Sbjct: 4   LVVGRIAKSHGLVGEVAVEIRTDEP-ELRFAPGSALAVRMPKAKAAGKTLRVVSVREHAN 62

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDR-QGKYWG 117
           R + +F G+ +  +A  LR   L  + +D    E + DEF++ +L  +   D   G   G
Sbjct: 63  RLLVSFEGVVDRTAADSLRGALLVVRSEDLPPNE-DPDEFYDHELVGLRIEDHGTGAELG 121

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVN 154
           ++  V +   G  L  +    +  LIPF    V+E++
Sbjct: 122 EIADVAHSAGGDWLVARVKDGREVLIPFVAAIVVEIS 158


>gi|312143701|ref|YP_003995147.1| 16S rRNA processing protein RimM [Halanaerobium sp. 'sapolanicus']
 gi|311904352|gb|ADQ14793.1| 16S rRNA processing protein RimM [Halanaerobium sp. 'sapolanicus']
          Length = 173

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 89/177 (50%), Gaps = 12/177 (6%)

Query: 1   MVKL-DKLVLMATIGTTHGLNGEVYIDSYANNP---IDLNRYVLYSNDN-RELRILKMYR 55
           M+KL DK + +  I    G  GEV +    + P    +L+   L + D   EL I +  R
Sbjct: 1   MIKLQDKYIEIGKITRYQGNKGEVRVMPSTDIPQRFFELDSVFLKNADEFYELEI-EYIR 59

Query: 56  KNKRF-IATFSGIDNIHSASELRDLK-LYAKRQDFKDEELEEDEFFNTDLEEMETFDRQG 113
            +K+F I  F GID+I  A EL++ + L  + + +    L ED ++  DL   + +    
Sbjct: 60  FHKQFVIIKFFGIDSIDQAEELKNSRVLIVESEKYL---LPEDSYYVDDLVGCKVYLSDD 116

Query: 114 KYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
            Y G+V  V +     I+ +K    K +++P ++  ++E++L+  KI+ +PI   L+
Sbjct: 117 TYLGKVIEVVDTSGTDIIIVKGEA-KEYMLPASREMIIEIDLEAEKIIYNPIQGLLD 172


>gi|150390505|ref|YP_001320554.1| 16S rRNA processing protein RimM [Alkaliphilus metalliredigens
           QYMF]
 gi|166977501|sp|A6TRS7|RIMM_ALKMQ RecName: Full=Ribosome maturation factor rimM
 gi|149950367|gb|ABR48895.1| 16S rRNA processing protein RimM [Alkaliphilus metalliredigens
           QYMF]
          Length = 168

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/167 (22%), Positives = 78/167 (46%), Gaps = 5/167 (2%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYAN--NPIDLNRYVLYSNDNRELRILKMYRKNKRFI 61
           + K++ +  I  THG+ GE+ + S ++     +   +V     + +  I  +  +    I
Sbjct: 1   MKKMLKVGQIVNTHGIKGELKVTSLSDYLERFEELEWVYIQGYDEKYYIGNIKYRPTTVI 60

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
            +F G DNI+   + +    Y    + +  EL ED F+  DL  ++ +  +  Y G++  
Sbjct: 61  LSFEGYDNINIVEQFKGK--YVLIDESQRRELPEDTFYKADLIGLDGYTVEEVYLGKLVD 118

Query: 122 VYNFGAGSILEIKNT-MEKTFLIPFTKFAVLEVNLQENKILIDPIAA 167
           +   G+  +   ++    K  LIP  K  + E++L++ +I +DPI  
Sbjct: 119 IIQAGSNEVYVFRDKETNKDILIPAVKEFIPEISLEKKRITVDPIEG 165


>gi|90109245|pdb|2F1L|A Chain A, Crystal Structure Of A Putative 16s Ribosomal Rna
           Processing Protein Rimm (Pa3744) From Pseudomonas
           Aeruginosa At 2.46 A Resolution
          Length = 187

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/167 (22%), Positives = 76/167 (45%), Gaps = 10/167 (5%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYAN---NPIDLNRYVLYSNDN-RELRILKMYRKNKRF 60
           D LV++  I + +G+ GEV + S+ +   N +D  R+ L  +   R+  +++     K  
Sbjct: 18  DDLVVIGKIVSVYGIRGEVKVYSFTDPLDNLLDYRRWTLRRDGEIRQAELVRGRLHGKVL 77

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
            A   G+D+   A      ++   R +     LEE E++   LE ++  D+  +  G + 
Sbjct: 78  AAKLKGLDDREEARTFTGYEICIPRSELP--SLEEGEYYWHQLEGLKVIDQGRQLLGVID 135

Query: 121 GVYNFGAGSILEIKNTM----EKTFLIPFTKFAVLEVNLQENKILID 163
            +   GA  +  +K       ++  L+P+T   VL ++L   +  +D
Sbjct: 136 HLLETGANDVXVVKPCAGSLDDRERLLPYTGQCVLSIDLAAGEXRVD 182


>gi|260767212|ref|ZP_05876154.1| 16S rRNA processing protein RimM [Vibrio furnissii CIP 102972]
 gi|260617820|gb|EEX42997.1| 16S rRNA processing protein RimM [Vibrio furnissii CIP 102972]
 gi|315181157|gb|ADT88071.1| 16S rRNA-processing protein [Vibrio furnissii NCTC 11218]
          Length = 184

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 81/173 (46%), Gaps = 12/173 (6%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNRELRILKMYRK 56
           M K D+ +++   G ++G+ G + + SY ++   +  Y    V +  +  E ++    R 
Sbjct: 9   MSKQDEKIVVGKFGASYGIRGWLKVFSYTDDAESIFDYSPWFVNHKGEWVEYKVESWKRH 68

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           NK  +A   G+D    A+ + + ++          EL EDEF+  +L  M+    QG   
Sbjct: 69  NKGMVAKLQGLDVREDANLMTNFEIAIDPASLP--ELSEDEFYWRELFGMQVVTTQGYNL 126

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTF-----LIPFTKFAVLE-VNLQENKILID 163
           G+V  +   G+  +L +K  ++  F     LIPF +  V++ ++    +I +D
Sbjct: 127 GEVVDMLETGSNDVLVVKANLKDAFGQKERLIPFLEEQVIKNIDRTAQRIEVD 179


>gi|313115223|ref|ZP_07800706.1| 16S rRNA processing protein RimM [Faecalibacterium cf. prausnitzii
           KLE1255]
 gi|310622452|gb|EFQ05924.1| 16S rRNA processing protein RimM [Faecalibacterium cf. prausnitzii
           KLE1255]
          Length = 178

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/161 (24%), Positives = 70/161 (43%), Gaps = 7/161 (4%)

Query: 15  TTHGLNGEVYIDSYANNP---IDLNRYVLYSNDNRELRILKMYRKNKRFIATFSGIDNIH 71
           TTHG+ GE+ ++ + +       + R    +   R  +I+ +  + +  +    G+D++ 
Sbjct: 12  TTHGVRGEMKLELWCDGVNFLKKVGRLYPSAQGGRAYKIVSIRAQGQMALLQLEGVDDMD 71

Query: 72  SASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQ-GKYWGQVCGVYNFGAGSI 130
           +A  LR    Y  R    D  L    ++  DL   E  D   G+ +G V  V + GA  I
Sbjct: 72  AARALRGQVFYFDR---NDATLPAGRWYVADLIGCEVRDADTGRVYGVVTSVDHPGAQDI 128

Query: 131 LEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN 171
             +K    K ++ P     + E N  E  +L+ PI   L++
Sbjct: 129 YTVKAPNGKEYMFPGVDAFLKERNPPEGYLLVTPIPGLLDD 169


>gi|229031472|ref|ZP_04187472.1| Ribosome maturation factor rimM [Bacillus cereus AH1271]
 gi|228729761|gb|EEL80741.1| Ribosome maturation factor rimM [Bacillus cereus AH1271]
          Length = 171

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 80/169 (47%), Gaps = 14/169 (8%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNRELRILKM----YRKNKRF- 60
           +  I  THG+ GE+ + S  + P +  RY     LY ++ +    L +    +R++K F 
Sbjct: 7   VGKIVNTHGVRGEIRVISRTDFPEE--RYKVGNTLYISNEKSTDYLPVKVTSHRQHKTFD 64

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           + TF G +N+  A + +   +    +     EL E E++  ++        +G+  G + 
Sbjct: 65  LLTFEGCNNVDEAEKFKGSLIKVPEEQLG--ELAEGEYYYHEIIGCSVVTEEGEALGTIK 122

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
            + + GA  +  IK    +  LIP+    VL+VN+ ENK++   +  GL
Sbjct: 123 EILSPGANDVWVIKRPKGQDLLIPYIDDVVLQVNI-ENKLVTIHVMEGL 170


>gi|124266297|ref|YP_001020301.1| 16S rRNA-processing protein RimM [Methylibium petroleiphilum PM1]
 gi|166226450|sp|A2SES7|RIMM_METPP RecName: Full=Ribosome maturation factor rimM
 gi|124259072|gb|ABM94066.1| 16S rRNA processing protein RimM [Methylibium petroleiphilum PM1]
          Length = 193

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 59/124 (47%), Gaps = 10/124 (8%)

Query: 48  LRILKMYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEME 107
           LRI     +    +AT   + + ++A  LR   ++  R  F   ++  DE++  DL  + 
Sbjct: 67  LRITNAREQGDVIVATAQDVADRNAAEALRGCSVFVSRASFPTADV--DEYYWIDLIGLA 124

Query: 108 TFDRQGKYWGQVCGVYNFGAGSILEIKN--------TMEKTFLIPFTKFAVLEVNLQENK 159
             +R+G+  G V  + + GA S+L +          ++E+  LIPF    +  V+L++  
Sbjct: 125 VVNREGQALGNVADLLDTGAHSVLRVTQVETDDQGRSLERERLIPFVAAYIDAVSLEQRC 184

Query: 160 ILID 163
           I +D
Sbjct: 185 ITVD 188


>gi|84622877|ref|YP_450249.1| 16S rRNA-processing protein [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|67461247|sp|Q5H391|RIMM_XANOR RecName: Full=Ribosome maturation factor rimM
 gi|109893069|sp|Q2P652|RIMM_XANOM RecName: Full=Ribosome maturation factor rimM
 gi|209573732|sp|B2SJV2|RIMM_XANOP RecName: Full=Ribosome maturation factor rimM
 gi|84366817|dbj|BAE67975.1| Probable 16S rRNA processing protein rimM [Xanthomonas oryzae pv.
           oryzae MAFF 311018]
          Length = 170

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/168 (20%), Positives = 79/168 (47%), Gaps = 8/168 (4%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY---VLYSNDNRELRI--LKMYR 55
           M + ++ +L+  +    G+ GE+ ++S+      + RY   ++ +   +E  I  ++   
Sbjct: 1   MKQTERRILLGRVVGAFGVKGELKLESWTEPRSAIFRYQPWIVRAPSGQESVINGVRGRD 60

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
           + K  IA F G+ +  +   +   ++Y  R      +   DE++  DLEE++    +G  
Sbjct: 61  QGKNLIAVFPGVADRDTVEAMHGTEIYVARSALPPPK--PDEYYWVDLEELQVETVEGVK 118

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
            G V  +++ G+  ++ ++   E+     F  F V  V+ + N I++D
Sbjct: 119 LGTVSHLFSTGSNDVVVVRGDRERMIPFVFPDF-VKSVDFEANLIVVD 165


>gi|253702082|ref|YP_003023271.1| 16S rRNA processing protein RimM [Geobacter sp. M21]
 gi|251776932|gb|ACT19513.1| 16S rRNA processing protein RimM [Geobacter sp. M21]
          Length = 172

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/162 (23%), Positives = 74/162 (45%), Gaps = 8/162 (4%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY--VLYSNDNRELR---ILKMYRKNKRF 60
           K +L+  I  T G+ G++ +  +A +   +++   V   +    L    ++      KR 
Sbjct: 5   KKLLIGKIQGTQGIKGQLRVIPFAGDASSISQLNEVFVKSPTGALEPFAVVSAKAHGKRV 64

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           I T    DNI+    L   ++YA R      EL +DEF+ +DL  ++     G+  G++ 
Sbjct: 65  ILTLRPFDNINQVLHLVGREIYADRVSLP--ELPDDEFYWSDLLGLQVATSDGEELGELV 122

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
            +   G+  +  +K    +  LIP  +  VL ++L E ++ +
Sbjct: 123 DIIETGSNDVYVVKKD-GREVLIPALEDVVLSIDLAEGRMTV 163


>gi|162452713|ref|YP_001615080.1| 16S rRNA processing protein [Sorangium cellulosum 'So ce 56']
 gi|209573621|sp|A9F3N7|RIMM_SORC5 RecName: Full=Ribosome maturation factor rimM
 gi|161163295|emb|CAN94600.1| 16S rRNA processing protein [Sorangium cellulosum 'So ce 56']
          Length = 170

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/161 (22%), Positives = 66/161 (40%), Gaps = 9/161 (5%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDL------NRYVLYSNDNRELRILKMYRKNKR 59
           + V +A +   HG+ GE+ +  Y N   DL       R  L     R+ +I+     +K 
Sbjct: 4   RYVPVADVARPHGVQGELRLRLY-NEASDLLLTRPPIRLRLPDGSARDAKIVATRPVDKA 62

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +   +GID+  +A  LR   +   R  F    L E EF+  D+E        G   G V
Sbjct: 63  LLVRIAGIDDRDAAEALRGATVCVPRDAFA--PLSEGEFYACDVEGARVMTPDGDLLGHV 120

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKI 160
             + ++    +L ++     +  +P T+  V  V+ +   +
Sbjct: 121 RSLQSYPTCDVLVVERQGADSIEVPLTESFVSSVDAERQVV 161


>gi|227892626|ref|ZP_04010431.1| 16S rRNA processing protein [Lactobacillus ultunensis DSM 16047]
 gi|227865558|gb|EEJ72979.1| 16S rRNA processing protein [Lactobacillus ultunensis DSM 16047]
          Length = 171

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 75/159 (47%), Gaps = 7/159 (4%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPID---LNRYVLYSNDNRELRILKMYRKNKRF-IATFS 65
           +A + TTHGLNGEV +    + P D   +  ++   N+  ++  +K  R  K+F +  F 
Sbjct: 6   VARVLTTHGLNGEVKVSVITDFPEDRFAVGMHLALKNNTEDVLTVKKGRPFKQFWLVQFE 65

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQ-GKYWGQVCGVYN 124
            I +I +A +LR   L     D    EL E  ++  D+ + +  D + G   G++  + +
Sbjct: 66  EIKDIDAAEKLRGQVLVVSEDDRG--ELPEGAYYYKDIFDCDVIDNESGARLGKITDIQS 123

Query: 125 FGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
            GA  +  +     K + IP     V +V++   K+ ++
Sbjct: 124 PGANDVWLVHEDSGKEYWIPNIADVVKKVDVANKKVYVE 162


>gi|300114670|ref|YP_003761245.1| 16S rRNA processing protein RimM [Nitrosococcus watsonii C-113]
 gi|299540607|gb|ADJ28924.1| 16S rRNA processing protein RimM [Nitrosococcus watsonii C-113]
          Length = 175

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 75/164 (45%), Gaps = 9/164 (5%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYA---NNPIDLNRYVLYSNDNRELR-ILKMYRKNKRF 60
           ++ VL+  I   +G+ G + + SY    +N +D   + L  N   + R ++K   + K  
Sbjct: 11  ERYVLVGRISGLYGVQGWLRVYSYTQSRDNILDYEPWYLRQNGAWQARRLMKGRVQGKGI 70

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +    GID    A+     ++   R      E  E E++  DL  ++    QG+  GQV 
Sbjct: 71  VVALEGIDERDVAALWVGCEIAVHRNQLPPPE--EGEYYWADLIGLQVITVQGEVLGQVD 128

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPF-TKFAVLEVNLQENKILID 163
            +   GA  +L ++   E+  L+PF     V +V+LQ+  + +D
Sbjct: 129 RLLETGANDVLVVRGERER--LLPFLMGMIVKQVDLQQGLLTVD 170


>gi|254796524|ref|YP_003081360.1| 16S rRNA processing protein RimM [Neorickettsia risticii str.
           Illinois]
 gi|254589761|gb|ACT69123.1| 16S rRNA processing protein RimM [Neorickettsia risticii str.
           Illinois]
          Length = 160

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 68/157 (43%), Gaps = 4/157 (2%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIATFSG 66
           +V    + +THG+ G V   SY +         +              R    F+ T S 
Sbjct: 1   MVCAGRVTSTHGVRGCVRFRSYMSVDFKFPGIDVSIGGVSYTVCGAFGRGFPMFVLTLSR 60

Query: 67  IDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFG 126
           + +   A +L  L ++          L+  E++  DL  +  +D +G+  G V  +YNFG
Sbjct: 61  VGSACEAEKLVGLDVFLSESLLP--PLQVGEYYCKDLVGLAVYDSEGRV-GHVSMLYNFG 117

Query: 127 AGS-ILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
           A + +LEI     K  +IPFT   V +++L + ++ +
Sbjct: 118 AAAEVLEIVLLSGKKVMIPFTSACVTDIDLNKKRLAV 154


>gi|86146311|ref|ZP_01064635.1| 16S rRNA-processing protein [Vibrio sp. MED222]
 gi|218710518|ref|YP_002418139.1| 16S rRNA-processing protein RimM [Vibrio splendidus LGP32]
 gi|254797771|sp|B7VK28|RIMM_VIBSL RecName: Full=Ribosome maturation factor rimM
 gi|85835790|gb|EAQ53924.1| 16S rRNA-processing protein [Vibrio sp. MED222]
 gi|218323537|emb|CAV19735.1| 16S rRNA processing protein RimM [Vibrio splendidus LGP32]
          Length = 184

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/173 (22%), Positives = 83/173 (47%), Gaps = 12/173 (6%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRK 56
           M + ++ ++M  +G+T+G+ G + + SY +N   +  Y  +      +  E ++    R 
Sbjct: 9   MSEQNERIVMGKLGSTYGIRGWLKVFSYTDNAESIFDYSPWYLKLKGEWVEYKVESWKRH 68

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
            + ++   +G+D    A  + + ++          EL EDEF+  +L  M+ F  +G   
Sbjct: 69  GQGYVCKLAGLDVREDAQLMTNFEIAIDPASLP--ELSEDEFYWRELFGMQVFTTKGYNL 126

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTF-----LIPFTKFAVL-EVNLQENKILID 163
           G+V  +   G+  +L IK  ++  F     LIP+ +  V+ +V+ +  +I +D
Sbjct: 127 GEVTDLLETGSNDVLVIKANLKDAFGQKERLIPYLEEQVIKKVDREARRIEVD 179


>gi|229098311|ref|ZP_04229258.1| Ribosome maturation factor rimM [Bacillus cereus Rock3-29]
 gi|229104404|ref|ZP_04235073.1| Ribosome maturation factor rimM [Bacillus cereus Rock3-28]
 gi|229117328|ref|ZP_04246706.1| Ribosome maturation factor rimM [Bacillus cereus Rock1-3]
 gi|228666228|gb|EEL21692.1| Ribosome maturation factor rimM [Bacillus cereus Rock1-3]
 gi|228679102|gb|EEL33310.1| Ribosome maturation factor rimM [Bacillus cereus Rock3-28]
 gi|228685209|gb|EEL39140.1| Ribosome maturation factor rimM [Bacillus cereus Rock3-29]
          Length = 171

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 80/169 (47%), Gaps = 14/169 (8%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNRELRILKM----YRKNKRF- 60
           +  I  THG+ GE+ + S  + P +  RY     LY ++ +    L +    +R++K F 
Sbjct: 7   VGKIVNTHGVRGEIRVISRTDFPEE--RYKVGNTLYISNEKSTDFLPVKVTSHRQHKTFD 64

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           + TF G +N+  A + +   +    +     EL E E++  ++        +G+  G + 
Sbjct: 65  LLTFEGYNNVDEAEKFKGSLIKVPEEQLG--ELAEGEYYYHEIIGCSVVTEEGEALGTIK 122

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
            + + GA  +  IK    +  LIP+    VL+VN+ ENK++   +  GL
Sbjct: 123 EILSPGANDVWVIKRPKGQDLLIPYIDDVVLQVNI-ENKLVTIHVMEGL 170


>gi|294669689|ref|ZP_06734756.1| hypothetical protein NEIELOOT_01590 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291308602|gb|EFE49845.1| hypothetical protein NEIELOOT_01590 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 169

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 73/162 (45%), Gaps = 7/162 (4%)

Query: 6   KLVLMATIGTTHGLNGEVYIDS---YANNPIDLNRYVLYSN-DNRELRILKMYRKNKRFI 61
           + V M  I    G+ G V + +   Y+++ +D   + L  + D R + +           
Sbjct: 6   QWVAMGYIKGAFGVKGWVKVAADTEYSDSLLDYPEWRLRKDKDVRTVAVESGKLNGDGLQ 65

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
             FSGID+  +A  LR   +   R+DF     +EDE++  DL  M   +R+G   G V  
Sbjct: 66  VKFSGIDDRDAAHLLRGYTVEISREDFA--PADEDEYYWADLVGMTVTNREGNVLGVVDN 123

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
           +   GA  IL ++    +  LIPF    + +VN +   I+ D
Sbjct: 124 MMETGAHDILVVRGECGQK-LIPFVGRFIDDVNRESKTIIAD 164


>gi|325924837|ref|ZP_08186272.1| 16S rRNA processing protein RimM [Xanthomonas perforans 91-118]
 gi|325544767|gb|EGD16115.1| 16S rRNA processing protein RimM [Xanthomonas perforans 91-118]
          Length = 170

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/168 (20%), Positives = 75/168 (44%), Gaps = 8/168 (4%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY-----SNDNRELRILKMYR 55
           M + ++ +L+  I    G+ GE+ ++S+      + RY  +     S     +  ++   
Sbjct: 1   MKQTERRILLGRIVGAFGVKGELKLESWTEPRTAIFRYQPWIVRAPSGQESVVSGVRGRD 60

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
           + K  IA F G+ +  +   +   ++Y  R      +   DE++  DLEE++    +G  
Sbjct: 61  QGKNLIAVFPGVTDRDTVEAMHGTEIYVARSALPPPK--PDEYYWVDLEELQVETVEGVK 118

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
            G V  +++ G+  ++ ++   E+     F  F V  V+   N I++D
Sbjct: 119 LGTVSHLFSTGSNDVVVVRGDRERMIPFVFPDF-VKSVDFDANLIVVD 165


>gi|308081839|ref|NP_001183438.1| hypothetical protein LOC100501868 [Zea mays]
 gi|238011556|gb|ACR36813.1| unknown [Zea mays]
          Length = 661

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 46/190 (24%), Positives = 87/190 (45%), Gaps = 32/190 (16%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNP-----IDLNRYV-LYSNDNRELRILKMYRK-- 56
           ++LV +  +   HG+ G+V +    + P         R++   +   +++R  ++ R   
Sbjct: 91  EELVEVGYVSGAHGVRGDVLVTPRTDFPELRLATPGTRWLRARAAGKQQVREFELVRGRA 150

Query: 57  ---NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQ- 112
               K +I +F G++N+  A ++    +  K +D    E+E+DEF++ DL  M    +  
Sbjct: 151 HTGKKSWIVSFDGVNNLDEARQIVGSAVLVKARD--RPEIEDDEFYSLDLVGMRVIVKDT 208

Query: 113 GKYWGQVCGVYNFGAGSILE-IKNTMEKTFL-----------------IPFTKFAVLEVN 154
           GK  G V  V+NFG G +L+ I  + E T +                 IPF +  V +V+
Sbjct: 209 GKLVGTVGQVFNFGGGDLLQVIMGSSEGTAVDPDSENQDSISSREHVWIPFAEDIVPDVD 268

Query: 155 LQENKILIDP 164
           +   ++ I P
Sbjct: 269 MASREMRITP 278


>gi|332686530|ref|YP_004456304.1| 16S rRNA processing protein RimM [Melissococcus plutonius ATCC
           35311]
 gi|332370539|dbj|BAK21495.1| 16S rRNA processing protein RimM [Melissococcus plutonius ATCC
           35311]
          Length = 175

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 71/154 (46%), Gaps = 12/154 (7%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNRY------VLYSNDNRELR-ILKMYRKNKRF-I 61
           +  I  T G+ GEV + S  + P +  RY       L++ D   +  ++K +RK+K F I
Sbjct: 8   VGKIVNTQGIKGEVRVISQTDFPEE--RYKRGAKLTLFNKDKEPIELVIKSHRKHKNFDI 65

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
            +F    +I+     RD  L  K+    D  L E+EF+  ++  +   D QG+  G +  
Sbjct: 66  LSFENHPSINDVENYRDGILKVKKSQLSD--LPENEFYYHEIIGLTVIDDQGQKIGHIKE 123

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNL 155
           + + GA  +  +K       L+P+    +  V+L
Sbjct: 124 ILSPGANDVWVVKQNDGTELLLPYIDSVIQSVDL 157


>gi|291550680|emb|CBL26942.1| 16S rRNA processing protein RimM [Ruminococcus torques L2-14]
          Length = 169

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/162 (26%), Positives = 79/162 (48%), Gaps = 7/162 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPI---DLNRYVLYSNDNRELRILKMYRKNKRF 60
           +++ + +  I +THGL GEV +    ++      L   VL +   +    ++  R  K+F
Sbjct: 1   MEQFLQVGVISSTHGLRGEVKVFPTTDDAARFQTLKNVVLDTGREKLDLEIQSVRFFKQF 60

Query: 61  -IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETF-DRQGKYWGQ 118
            I  F GIDNI+   + +   L+  R++    ELEEDE++  DL  ME + D   + +G 
Sbjct: 61  VIVKFKGIDNINDIEKYKGKSLFVTRENAV--ELEEDEYYIGDLIGMEVYTDDSEERFGV 118

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKI 160
           +  V   GA  +  I +      L+P     +L+++++  K+
Sbjct: 119 LKDVMETGANEVYIITSENHGEVLLPAIHECILDIDVEAKKM 160


>gi|119511287|ref|ZP_01630402.1| 16S rRNA-processing protein [Nodularia spumigena CCY9414]
 gi|119464078|gb|EAW45000.1| 16S rRNA-processing protein [Nodularia spumigena CCY9414]
          Length = 223

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 53/185 (28%), Positives = 86/185 (46%), Gaps = 28/185 (15%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNP----IDLNRYVLYSNDNRELRILKM----YR 55
           LD+ + +  I    GL+GE+ +   ++ P    +   R++ +  D RE + +++    Y 
Sbjct: 33  LDEWLEIGKIVAPQGLSGELRVYPESDFPERFEVPGTRWLWHPGD-REPQPVELLSGRYV 91

Query: 56  KNKRF-IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQ-G 113
           + K   I + +G+ N + A  LRD KL     D    +L EDE+  TDL  M  F ++ G
Sbjct: 92  EGKNLCIISLAGVRNRNDAEALRDYKLMVPASD--RPQLGEDEYHVTDLIGMLVFMQESG 149

Query: 114 KYWGQVCGVYNFGAGSILEIK----------NTME----KTFLIPFTKFAVLEVNLQENK 159
           +  G+V  V   G   +LE+K           T++    K  LIPF K     V+L   +
Sbjct: 150 ELVGEVVDVIPAG-NFLLEVKLHQQIPDVESETLQPQSPKKLLIPFVKAIAPVVDLPSRR 208

Query: 160 ILIDP 164
           I I P
Sbjct: 209 IEITP 213


>gi|225419754|ref|ZP_03762057.1| hypothetical protein CLOSTASPAR_06092 [Clostridium asparagiforme
           DSM 15981]
 gi|225041591|gb|EEG51837.1| hypothetical protein CLOSTASPAR_06092 [Clostridium asparagiforme
           DSM 15981]
          Length = 193

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 77/165 (46%), Gaps = 10/165 (6%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPI---DLNRYVLYSND---NRELRILKMYRKN 57
           ++ ++ +  I + HG+ GEV +    ++      L + VL +     + E+  +K ++  
Sbjct: 24  MEDMLRVGVITSPHGVRGEVKVFPTTDDAARFKTLKQVVLDTGKETISLEIEHVKFFKN- 82

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              I  F G DNI+   + R   L  +R+  +  ELEEDE+F  DL  +      G+  G
Sbjct: 83  -MVILKFKGYDNINDIEKYRSKDLLIRRE--QAVELEEDEYFIADLIGLAVVTDAGEALG 139

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
            V  V   GA  +  ++    +  L+P     +L+VNL E ++ +
Sbjct: 140 TVKDVMETGANDVYIVEMKDGRELLLPAIGDCILDVNLDEGRMTV 184


>gi|269926737|ref|YP_003323360.1| 16S rRNA processing protein RimM [Thermobaculum terrenum ATCC
           BAA-798]
 gi|269790397|gb|ACZ42538.1| 16S rRNA processing protein RimM [Thermobaculum terrenum ATCC
           BAA-798]
          Length = 179

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/166 (23%), Positives = 76/166 (45%), Gaps = 5/166 (3%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKRFIAT 63
           D  V++  I + HG+ GEV ++   +NP    +   +Y  D    +++ +    K  +  
Sbjct: 14  DNYVIVGRILSPHGVRGEVKVEPITDNPERFKQLRQVYVGDALH-KVVSVRVLPKFVLVR 72

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F G+++   A  L  + LY  ++      L ED F++ DL+ ME     G+  G +  + 
Sbjct: 73  FEGMESPEQAKALSGMYLYIPKEQVMP--LPEDTFYHFDLQGMEVVSTSGEPLGTLREIL 130

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
              A  +  + +      LIP  K  V +V+L+  +++++ I   L
Sbjct: 131 IREANDVFVVDHP-RGEILIPAIKDVVKDVDLENRRLVVELIPGLL 175


>gi|300854477|ref|YP_003779461.1| putative 16S rRNA processing protein [Clostridium ljungdahlii DSM
           13528]
 gi|300434592|gb|ADK14359.1| predicted 16S rRNA processing protein [Clostridium ljungdahlii DSM
           13528]
          Length = 162

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 76/166 (45%), Gaps = 10/166 (6%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSN---DNRELRILKMYRKNKRFIAT 63
            + +  I  THG+ GE+ +    +   D+ R+    +   D     I++   ++K+ I  
Sbjct: 4   FITVGQIINTHGIKGELKVYPLTD---DIERFKKLKSAYIDGTLKNIIECKLQSKKVILK 60

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
             GID+I  A   +   +   R D    +LEE  +F TD+      D  G ++G+V  V 
Sbjct: 61  IEGIDSIEEAMAYKQKYIEIPRNDAV--KLEEGTYFITDIIGCSVVDEDGTFYGKVGDVI 118

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           +     +  IK   E   LIP  +  V+ +++++ +I+I P+   +
Sbjct: 119 HTHNNDVYWIKG--ENELLIPAIENVVVSIDVEKEEIVIKPVKTWM 162


>gi|229174508|ref|ZP_04302040.1| Ribosome maturation factor rimM [Bacillus cereus MM3]
 gi|228609068|gb|EEK66358.1| Ribosome maturation factor rimM [Bacillus cereus MM3]
          Length = 171

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 80/169 (47%), Gaps = 14/169 (8%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNRELRILKM----YRKNKRF- 60
           +  I  THG+ GE+ + S  + P +  RY     LY ++ +    L +    +R++K F 
Sbjct: 7   VGKIVNTHGVRGEIRVISRTDFPEE--RYKVGNTLYISNEKSTDYLPVKVTSHRQHKTFD 64

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           + TF G +N+  A + +   +    +     EL E E++  ++        +G+  G + 
Sbjct: 65  LLTFEGYNNVDEAEKFKGSLIKVPEEQLG--ELAEGEYYYHEIIGCSVVTEEGEALGTIK 122

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
            + + GA  +  IK    +  LIP+    VL+VN+ ENK++   +  GL
Sbjct: 123 EILSPGANDVWVIKRPKGQDLLIPYIDDVVLQVNI-ENKLVTIHVMEGL 170


>gi|296274035|ref|YP_003656666.1| 16S rRNA processing protein RimM [Arcobacter nitrofigilis DSM 7299]
 gi|296098209|gb|ADG94159.1| 16S rRNA processing protein RimM [Arcobacter nitrofigilis DSM 7299]
          Length = 175

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 86/173 (49%), Gaps = 10/173 (5%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIATFSGI 67
           + +A +G + GLNGE+ I   ++ P    +  ++  +      +  + +++  I  F  I
Sbjct: 5   IYVAKLGKSVGLNGEIKIFLDSDFPEQFKKGAIFITNKGNSLTVNSFNESRGTI-NFVEI 63

Query: 68  DNIHSASELRDLKLYAKRQDFKDE-ELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFG 126
           +NI  A +L + +L+  +++ K+  +L +D+FF  DL +   F+ + +  G +  ++ + 
Sbjct: 64  NNIDDAKKLTNQQLFTSQENTKENCKLNKDQFFWFDLIDCMVFENE-ENLGTIIEIHRYP 122

Query: 127 AGSILEIKN-------TMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNT 172
            G   EIK         + KTFL+P+ K  +  V+++  KI      A L N+
Sbjct: 123 LGDYFEIKTETSLVEKNLPKTFLLPYEKNYIKSVDIKSKKIEAKDAKAILENS 175


>gi|229824951|ref|ZP_04451020.1| hypothetical protein GCWU000182_00300 [Abiotrophia defectiva ATCC
           49176]
 gi|229790954|gb|EEP27068.1| hypothetical protein GCWU000182_00300 [Abiotrophia defectiva ATCC
           49176]
          Length = 181

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/166 (27%), Positives = 74/166 (44%), Gaps = 20/166 (12%)

Query: 10  MATIGTTHGLNGEVYI----------DSYANNPIDLN--RYVLYSNDNRELRILKM-YRK 56
           +  + +THGL G + +          DS     IDL+  +  +  N   E+ +  + Y K
Sbjct: 7   VGVLTSTHGLTGGIKVFPTTDCLDRFDSLKRAFIDLSSGKGTIKGNGMLEVEVENVKYFK 66

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           N   I TF GIDN+   ++ + + L   R+D     L E E + +D+   +     GK +
Sbjct: 67  NTP-IVTFKGIDNVDLVAKYKGMDLLVAREDAL--PLAEGEHYVSDVIGCKVITDTGKEY 123

Query: 117 GQVCGVYNFGAGSILEIK----NTMEKTFLIPFTKFAVLEVNLQEN 158
           G V  V   GA  +L +K    +   K F +P     VLE+N +E 
Sbjct: 124 GVVSEVIETGANKVLVVKPNEAHKELKEFCLPHIPECVLEINTEEG 169


>gi|166713047|ref|ZP_02244254.1| 16S rRNA-processing protein [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 170

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/168 (20%), Positives = 79/168 (47%), Gaps = 8/168 (4%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY---VLYSNDNRELRI--LKMYR 55
           M + ++ +L+  +    G+ GE+ ++S+      + RY   ++ +   +E  I  ++   
Sbjct: 1   MKQTERRILLGRVVGAFGVKGELKLESWTEPRSAIFRYQPWIVRAPSGQESVISGVRGRD 60

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
           + K  IA F G+ +  +   +   ++Y  R      +   DE++  DLEE++    +G  
Sbjct: 61  QGKNLIAVFPGVADRDTVEAMHGTEIYVARGALPPPK--PDEYYWVDLEELQVETVEGVK 118

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
            G V  +++ G+  ++ ++   E+     F  F V  V+ + N I++D
Sbjct: 119 LGTVSHLFSTGSNDVVVVRGDRERMIPFVFPDF-VKSVDFEANLIVVD 165


>gi|161507705|ref|YP_001577661.1| 16S rRNA-processing protein RimM [Lactobacillus helveticus DPC
           4571]
 gi|172048318|sp|A8YVT3|RIMM_LACH4 RecName: Full=Ribosome maturation factor rimM
 gi|160348694|gb|ABX27368.1| rRNA processing protein [Lactobacillus helveticus DPC 4571]
 gi|328465658|gb|EGF36875.1| 16S rRNA-processing protein RimM [Lactobacillus helveticus MTCC
           5463]
          Length = 171

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 80/169 (47%), Gaps = 12/169 (7%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNRYV------LYSNDNRELRILKMYRKNKRFIAT 63
           +A I TTHGLNGEV ++   + P    R+       L S+ NR L + K     + ++  
Sbjct: 6   VARILTTHGLNGEVKVNVITDFP--EERFAEGMHLSLRSDTNRTLTVEKSRPFKQFWLIQ 63

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQ-GKYWGQVCGV 122
           F  I +I  A +LR   L    +D    EL +  ++  D+ + +  D + GK  G++  +
Sbjct: 64  FKEITDIDQAEKLRGQILVVSEEDRG--ELPDGVYYYKDIFDCDVIDEETGKRIGKIVDI 121

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN 171
            + GA  I  ++    K + IP     V +V++   K+ ++ +  GL +
Sbjct: 122 QSPGANDIWLVREDDGKEYWIPNIADVVKKVDVAAKKVYVE-LMEGLRD 169


>gi|225351185|ref|ZP_03742208.1| hypothetical protein BIFPSEUDO_02775 [Bifidobacterium
           pseudocatenulatum DSM 20438]
 gi|225158641|gb|EEG71883.1| hypothetical protein BIFPSEUDO_02775 [Bifidobacterium
           pseudocatenulatum DSM 20438]
          Length = 195

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/181 (26%), Positives = 80/181 (44%), Gaps = 25/181 (13%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNRELRILKMYRKNK-RF 60
           +L+ +  IG   GL GEV +  + + P    R+    VLY+ D  E  +++  R  K R+
Sbjct: 10  ELLRVCRIGRAQGLKGEVTVQIFTDEP--EYRFAPGAVLYTKDGEEEYVVENSRTFKNRW 67

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           I  F GIDN   +     + LY +  D +D  LE DE++  DL  +E    +    G   
Sbjct: 68  IIKFEGIDNRDQSEAANGIVLYGEADDPEDM-LEADEWYPKDLIGLEARLAEDNMLGLEP 126

Query: 121 GVYNFGAGSILEIKN-----------------TMEKTFLIPFTKFAVLEVNLQENKILID 163
           GV       ++E+                    +E + L+PF    V +++L+E  + +D
Sbjct: 127 GVVVGKVVDVIEVAQWLLKIRLANPVKDADGVVVENSALVPFVDELVPDIDLEEGYLTLD 186

Query: 164 P 164
           P
Sbjct: 187 P 187


>gi|125553343|gb|EAY99052.1| hypothetical protein OsI_21009 [Oryza sativa Indica Group]
          Length = 644

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 44/188 (23%), Positives = 84/188 (44%), Gaps = 32/188 (17%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNP-----IDLNRYVLYSNDNR------ELRILKMYR 55
           LV++  +   HG+ G+V +    + P         R++      +      EL   + + 
Sbjct: 76  LVVVGYVSGAHGVRGDVLVSPRTDFPQLRFATPGKRWLRARAAGKQQVKEFELVRGRAHT 135

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQ-GK 114
             K +I TF G+D++  A ++    +  K  D    ++EEDE ++ DL  M    +  GK
Sbjct: 136 GKKSWIVTFDGVDSVDEARQIVGSAILVKAGD--RPKMEEDEIYSLDLVGMRVIVKDTGK 193

Query: 115 YWGQVCGVYNFGAGSILEI-----KNTMEKT-------------FLIPFTKFAVLEVNLQ 156
             G V  V+NFGAG +L++     ++T+ +                IPF +  V +++++
Sbjct: 194 LVGTVGQVFNFGAGDLLQVMVGGTEDTVSQPNSENQDSTPSGEHVWIPFAEDIVPDIDME 253

Query: 157 ENKILIDP 164
             ++ I P
Sbjct: 254 SREMWITP 261


>gi|294815372|ref|ZP_06774015.1| 16S rRNA-processing protein RimM [Streptomyces clavuligerus ATCC
           27064]
 gi|294327971|gb|EFG09614.1| 16S rRNA-processing protein RimM [Streptomyces clavuligerus ATCC
           27064]
          Length = 244

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/163 (22%), Positives = 74/163 (45%), Gaps = 9/163 (5%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNP---IDLNRYVLYSNDNRELRILKMYR-KNKRFIAT 63
           +++  IG  HG+ GEV ++   + P   +     +L     R    ++  R  + R +  
Sbjct: 28  LVVGRIGRAHGVKGEVSVEVRTDEPELRLGPGAVLLTDPPARGPLTIETGRVHSGRLLLR 87

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEE--DEFFNTDLEEMETFDRQGKYWGQVCG 121
           F+G+ + + A  LR+  L A   D   E   E  DE+++  L +++     G   G++  
Sbjct: 88  FAGVRDRNGAEALRETLLIA---DVDPEASPEGDDEYYDHQLIDLDVVTVDGTEVGRITE 144

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           + +  +  +  ++       +IPF    V  ++L+E + +IDP
Sbjct: 145 ISHLPSQDLFIVERPDGTEVMIPFVTEIVTSIDLEEQRAVIDP 187


>gi|171463910|ref|YP_001798023.1| 16S rRNA processing protein RimM [Polynucleobacter necessarius
           subsp. necessarius STIR1]
 gi|209573588|sp|B1XVN2|RIMM_POLNS RecName: Full=Ribosome maturation factor rimM
 gi|171193448|gb|ACB44409.1| 16S rRNA processing protein RimM [Polynucleobacter necessarius
           subsp. necessarius STIR1]
          Length = 184

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 78/181 (43%), Gaps = 25/181 (13%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDL--NRYVLYSNDNR--------------- 46
           L+ L+ +  I    GL G+V I  +++ P+ L  ++ V  S   R               
Sbjct: 6   LNDLIELGAISEAQGLRGQVKIRPHSSEPVALLSSKSVWLSLIPRRDAGLSSPVEQASLT 65

Query: 47  --ELRILKMYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLE 104
             +++  KM+  N   +    G+ +   A  L+  ++   R  F   ++E D ++  DL 
Sbjct: 66  QYKVKSAKMHSGN--VVIALEGVTDRDQALALKGARILVARDAFP--KVETDSYYWIDLI 121

Query: 105 EMETFDRQGKYWGQVCGVYNFGAGSILEIKNTMEKT--FLIPFTKFAVLEVNLQENKILI 162
                + Q +  G+V  V   GA  ++ I +   KT  +L+PF K  V +V+L    I +
Sbjct: 122 GCNAINLQNETLGEVIDVTENGAHGVIAIGDASTKTIQYLVPFVKQVVQDVDLSNKTISL 181

Query: 163 D 163
           D
Sbjct: 182 D 182


>gi|254000094|ref|YP_003052157.1| 16S rRNA processing protein RimM [Methylovorus sp. SIP3-4]
 gi|253986773|gb|ACT51630.1| 16S rRNA processing protein RimM [Methylovorus sp. SIP3-4]
          Length = 164

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 54/107 (50%), Gaps = 2/107 (1%)

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
            K  +    GID+  +A   +  ++   R+     E EE E++ +DL  +   + Q   +
Sbjct: 55  GKTLLVKLVGIDDRDAAFAAKGKQVSVPREQLP--EAEEGEYYWSDLIGLRVSNLQQVDF 112

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
           G V  V+  GA  ++ +K+   +  L+PFT  AV EVN++   +L+D
Sbjct: 113 GTVVDVFETGANDVVVVKDDAGRERLVPFTAEAVPEVNVEAGTMLVD 159


>gi|332981638|ref|YP_004463079.1| 16S rRNA processing protein RimM [Mahella australiensis 50-1 BON]
 gi|332699316|gb|AEE96257.1| 16S rRNA processing protein RimM [Mahella australiensis 50-1 BON]
          Length = 168

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/170 (22%), Positives = 80/170 (47%), Gaps = 13/170 (7%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNREL---RILKMYRKNKRF 60
           +++  I   HG++GE+ I    +   D+ R+      Y  D  ++   R+ ++   N   
Sbjct: 5   LIIGRILKPHGVSGEMKIQPLTD---DIRRFDDLKCAYIKDKDDMFPHRVERVKYGNDVV 61

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
                GID++++A EL +  L+  RQ      L E  ++  D+     +   G Y G+V 
Sbjct: 62  YIKLEGIDDMNAARELVNKHLWVDRQHAA--PLPEGSYYVGDIIGCRVYTVDGVYLGEVK 119

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
            V   G+  + ++ +  +K  LIP  K  +  ++++  +I+I+P+   L+
Sbjct: 120 EVLPTGSNDVYDVVDG-QKQVLIPAIKDVIKTIDIEGERIVIEPMEGLLD 168


>gi|302386487|ref|YP_003822309.1| 16S rRNA processing protein RimM [Clostridium saccharolyticum WM1]
 gi|302197115|gb|ADL04686.1| 16S rRNA processing protein RimM [Clostridium saccharolyticum WM1]
          Length = 169

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/166 (26%), Positives = 72/166 (43%), Gaps = 12/166 (7%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-------VLYSNDNRELRILKMYRK 56
           ++ L+ +  I +THG+ GEV +    +   D+NR+       +    + REL I  +   
Sbjct: 1   MENLLRVGVISSTHGVRGEVKVYPTTD---DVNRFNELKKVILDAGQERRELEIQGVKFF 57

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
               I  F G D+I+   + +   L   R   +  EL  DE F  DL  +     +G+  
Sbjct: 58  KNMVILKFKGYDSINDIEKYKGKDLLITRD--QAVELGPDENFIVDLIGLRVVTEEGEEL 115

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
           G +  V   GA  + E+K    K  L+P  K  V  V+L E  + +
Sbjct: 116 GILTDVIKTGANDVYEVKTAEGKEVLLPAIKECVRNVDLTEGLVTV 161


>gi|254393818|ref|ZP_05008930.1| 16S rRNA processing protein [Streptomyces clavuligerus ATCC 27064]
 gi|326443724|ref|ZP_08218458.1| 16S rRNA-processing protein RimM [Streptomyces clavuligerus ATCC
           27064]
 gi|197707417|gb|EDY53229.1| 16S rRNA processing protein [Streptomyces clavuligerus ATCC 27064]
          Length = 219

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/163 (22%), Positives = 74/163 (45%), Gaps = 9/163 (5%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNP---IDLNRYVLYSNDNRELRILKMYR-KNKRFIAT 63
           +++  IG  HG+ GEV ++   + P   +     +L     R    ++  R  + R +  
Sbjct: 3   LVVGRIGRAHGVKGEVSVEVRTDEPELRLGPGAVLLTDPPARGPLTIETGRVHSGRLLLR 62

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEE--DEFFNTDLEEMETFDRQGKYWGQVCG 121
           F+G+ + + A  LR+  L A   D   E   E  DE+++  L +++     G   G++  
Sbjct: 63  FAGVRDRNGAEALRETLLIA---DVDPEASPEGDDEYYDHQLIDLDVVTVDGTEVGRITE 119

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           + +  +  +  ++       +IPF    V  ++L+E + +IDP
Sbjct: 120 ISHLPSQDLFIVERPDGTEVMIPFVTEIVTSIDLEEQRAVIDP 162


>gi|313202053|ref|YP_004040711.1| 16S rRNA processing protein rimm [Methylovorus sp. MP688]
 gi|312441369|gb|ADQ85475.1| 16S rRNA processing protein RimM [Methylovorus sp. MP688]
          Length = 161

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 54/107 (50%), Gaps = 2/107 (1%)

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
            K  +    GID+  +A   +  ++   R+     E EE E++ +DL  +   + Q   +
Sbjct: 52  GKTLLVKLVGIDDRDAAFAAKGKQVSVPREQLP--EAEEGEYYWSDLIGLRVSNLQQVDF 109

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
           G V  V+  GA  ++ +K+   +  L+PFT  AV EVN++   +L+D
Sbjct: 110 GTVVDVFETGANDVVVVKDDAGRERLVPFTAEAVPEVNVEAGTMLVD 156


>gi|257125792|ref|YP_003163906.1| 16S rRNA processing protein RimM [Leptotrichia buccalis C-1013-b]
 gi|257049731|gb|ACV38915.1| 16S rRNA processing protein RimM [Leptotrichia buccalis C-1013-b]
          Length = 169

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/167 (30%), Positives = 84/167 (50%), Gaps = 8/167 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANN--PIDLNRYVLYSNDNRELRILKMYRK--NKR 59
           ++ L+ + TI  TH L G V I+S   N   I+  R +L  N+ ++L ++K  ++   K+
Sbjct: 1   MENLINIGTIVGTHHLRGSVKINSIFENIEVIENERVLLEKNEKKKLLVVKKVKRLNEKK 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F GI+NI  A EL   K+  +R      E  E+EF+  DL  +E F    K  G+V
Sbjct: 61  AILDFEGIENIDEAKELNGFKVKIRRDLLP--ERNENEFYIKDLFGIEVFSENEKI-GEV 117

Query: 120 CGVYNFGAGSILEIKNT-MEKTFLIPFTKFAVLEVNLQENKILIDPI 165
             V    A +IL I++   +K  ++P     V +++   N+I +  I
Sbjct: 118 VDVMETAAHNILIIEDIETKKEIMVPLIDEFVTKIDFPNNRIEVSLI 164


>gi|84394291|ref|ZP_00993016.1| 16S rRNA-processing protein [Vibrio splendidus 12B01]
 gi|84375094|gb|EAP92016.1| 16S rRNA-processing protein [Vibrio splendidus 12B01]
          Length = 184

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/166 (22%), Positives = 80/166 (48%), Gaps = 12/166 (7%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNR----ELRILKMYRKNKRFIAT 63
           ++M  +G+T+G+ G + + SY +N   +  Y  +  + +    E ++    R  + ++  
Sbjct: 16  IVMGKLGSTYGIRGWLKVFSYTDNAESIFDYSPWYLNQKGKWVEYKVESWKRHGQGYVCK 75

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
            +G+D    A  + + ++          EL EDEF+  +L  M+ F  +G   G+V  + 
Sbjct: 76  LAGLDVREDAQLMTNFEIAIDPASLP--ELSEDEFYWRELFGMQVFTTKGYDLGEVTDLL 133

Query: 124 NFGAGSILEIKNTMEKTF-----LIPFTKFAVL-EVNLQENKILID 163
             G+  +L IK  ++  F     L+P+ +  V+ +V+ +  +I +D
Sbjct: 134 ETGSNDVLVIKANLKDAFGQKERLVPYLEEQVIKKVDREARRIEVD 179


>gi|89900196|ref|YP_522667.1| 16S rRNA-processing protein RimM [Rhodoferax ferrireducens T118]
 gi|109893040|sp|Q21YL7|RIMM_RHOFD RecName: Full=Ribosome maturation factor rimM
 gi|89344933|gb|ABD69136.1| 16S rRNA processing protein RimM [Rhodoferax ferrireducens T118]
          Length = 187

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 76/165 (46%), Gaps = 16/165 (9%)

Query: 13  IGTTHGLNGEVYIDSYANNPIDL---NRYVLYSNDN--------RELRILKMYRKNKRFI 61
           I    G+ G   +  Y+ +P  L    R+ L   +          +L I +    +   +
Sbjct: 20  IADAWGIKGWFKVLPYSADPEALFSARRWFLLPAEKGAKTFSGVAQLAIKEAKVHSDTVV 79

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
           A+   +D+  +A  LR  +++  R  F   E  +DE++  DL  +   +R+G   G V  
Sbjct: 80  ASAQAVDDRTAAEALRGARIFVARSSFPSAE--KDEYYWVDLIGLNVVNREGVAMGTVKE 137

Query: 122 VYNFGAGSILEIKNTME---KTFLIPFTKFAVLEVNLQENKILID 163
           + + GA ++L ++ + +   +  +IPF    + EV+L  ++IL+D
Sbjct: 138 LLSTGAQTVLVLEYSQDGKAQERMIPFVSVYIDEVDLPGHRILVD 182


>gi|170693744|ref|ZP_02884902.1| 16S rRNA processing protein RimM [Burkholderia graminis C4D1M]
 gi|170141526|gb|EDT09696.1| 16S rRNA processing protein RimM [Burkholderia graminis C4D1M]
          Length = 248

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 73/165 (44%), Gaps = 21/165 (12%)

Query: 16  THGLNGEVYIDSYANNP------IDLNRYVLYSNDNRE-LRILKMYRKNKRFIATFSGID 68
            +GL G V + ++A+        +   R+ L     R+    L+    +   +A   G+ 
Sbjct: 83  AYGLKGWVKVAAHADAGHGGDALLSAKRWWLMKGRERQSAPSLQAKTHSDSVVALLGGVA 142

Query: 69  NIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFGAG 128
           +  +A  LR  ++Y  R +F    LE DEF+  DL  ++  +  G   G+V  + + GA 
Sbjct: 143 DRDAALALRGSRVYVSRSEFP--ALEADEFYWVDLLGLDVVNLAGVNLGKVADMIDNGAH 200

Query: 129 SILEIK----------NTMEKTFLIPFTKFAVLEVNLQENKILID 163
           S+L I+           T E+  LIPF    V  V+    +I++D
Sbjct: 201 SVLRIEYAAADKTGKPGTAER--LIPFVGVFVKTVDQAAKQIIVD 243


>gi|257438678|ref|ZP_05614433.1| 16S rRNA processing protein RimM [Faecalibacterium prausnitzii
           A2-165]
 gi|257198907|gb|EEU97191.1| 16S rRNA processing protein RimM [Faecalibacterium prausnitzii
           A2-165]
          Length = 184

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 72/172 (41%), Gaps = 7/172 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPI---DLNRYVLYSNDNRELRILKMYRKNKRF 60
           + K +    + TTHG+ GE+ ++ + +       + R        R  +I  +  + +  
Sbjct: 7   MQKYLEAGKVVTTHGVRGEMKLELWCDGVAFLKKVGRLYTTPQGGRCYKITSIRPQGQMA 66

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQ-GKYWGQV 119
           +    G+ ++ +A  LR    Y  R    D  L   +++  DL   E  D   GK +G V
Sbjct: 67  LLQLEGVSDMDAARALRGQVFYFDRD---DATLPAGKWYVADLIGCEVRDADTGKVYGVV 123

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN 171
             V + GA  I  +K    K ++ P     + E N  E  +L+ PI   L++
Sbjct: 124 TSVDHPGAQDIYTVKAPSGKEYMFPGVDAFLKERNPPEGYLLVTPIPGLLDD 175


>gi|15615043|ref|NP_243346.1| 16S rRNA processing protein [Bacillus halodurans C-125]
 gi|14423895|sp|Q9KA14|RIMM_BACHD RecName: Full=Ribosome maturation factor rimM
 gi|10175100|dbj|BAB06199.1| 16S rRNA processing protein [Bacillus halodurans C-125]
          Length = 173

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/172 (25%), Positives = 80/172 (46%), Gaps = 10/172 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDL-----NRYVLYSNDNRELRI-LKMYRKN 57
           + K + +  I  THG+ GEV + S  +   D        YV+  N N  + + +  +RK+
Sbjct: 1   MSKWLNVGKIVNTHGVRGEVRVLSTTDFEDDRFSSGKTLYVMRPNQNERVAVTVASHRKH 60

Query: 58  KRF-IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           K F +  F G  +I+     +  +L    +D    EL E EFF  ++         G+  
Sbjct: 61  KNFDLLCFEGYPSINDVEAFKGGRLQVPIED--RPELGEGEFFYHEIIGCSVVTIAGEEL 118

Query: 117 GQVCGVYNFGAGSILEIK-NTMEKTFLIPFTKFAVLEVNLQENKILIDPIAA 167
           G+V  + + GA  +  ++     K  LIP+ +  V +V+L++ +I I+P+  
Sbjct: 119 GKVKEILSPGANDVWVVQCRRGGKDLLIPYIEQVVKQVDLEKQQITIEPMEG 170


>gi|259047125|ref|ZP_05737526.1| 16S rRNA processing protein RimM [Granulicatella adiacens ATCC
           49175]
 gi|259036175|gb|EEW37430.1| 16S rRNA processing protein RimM [Granulicatella adiacens ATCC
           49175]
          Length = 171

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 75/159 (47%), Gaps = 8/159 (5%)

Query: 10  MATIGTTHGLNGEVYIDS---YANNPIDLNRYVLYSNDNRELRILKM--YRKNKRF-IAT 63
           +  I  T GL GEV + S   +A         +    D   L  + +  +R++K F + T
Sbjct: 7   VGKIVNTQGLRGEVRVISTTDFAEERYKKGTELAIFKDGEFLTFVTVASHRRHKNFDLLT 66

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F G++ I    + ++  L    +     ELE+DEF+  ++  +E    +G+  G+V  + 
Sbjct: 67  FEGMNRIEDVEKYKECLLKVAEEQLT--ELEDDEFYYHEIIGLEIVTDEGEVLGKVTEIL 124

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
           + G+  +  +K   +K  LIPF +  V +V+ +E K  I
Sbjct: 125 SPGSNDVWVVKQKGKKELLIPFIEPVVYKVDKEEKKAYI 163


>gi|319790555|ref|YP_004152188.1| 16S rRNA processing protein RimM [Thermovibrio ammonificans HB-1]
 gi|317115057|gb|ADU97547.1| 16S rRNA processing protein RimM [Thermovibrio ammonificans HB-1]
          Length = 190

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 76/165 (46%), Gaps = 7/165 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDS----YANNPIDLNRYVLYSNDNRELRILKMYRKNKR-FIA 62
           VL+  +   HGL GE+ + S    +      ++   LY    +E   ++  +  K  ++ 
Sbjct: 25  VLIGKVVGVHGLKGELKVKSESDIFERQLEAVDSLTLYRGTRKEEVTVESVKPYKDIYLI 84

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F  I++   A E    +L+    +    ELEE EF+  +L  ++ F   G+  G +  +
Sbjct: 85  KFKEINDRSQAEETIGGELWIDENE--RVELEEGEFYYEELLGLKVFTEDGRELGVIKNI 142

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAA 167
               A  ILE++ +  KT LIPF +  V E++L+  K+ +  I  
Sbjct: 143 LEQPASHILEVEKSDGKTVLIPFIEQFVKEIDLKNGKVTVSLIEG 187


>gi|260101391|ref|ZP_05751628.1| 16S rRNA processing protein RimM [Lactobacillus helveticus DSM
           20075]
 gi|260084802|gb|EEW68922.1| 16S rRNA processing protein RimM [Lactobacillus helveticus DSM
           20075]
          Length = 184

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 81/169 (47%), Gaps = 12/169 (7%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNRYV------LYSNDNRELRILKMYRKNKRFIAT 63
           +A I TTHGLNGEV ++   + P +  R+       L S+ NR L + K     + ++  
Sbjct: 19  VARILTTHGLNGEVKVNVITDFPEE--RFAEGMHLSLRSDTNRTLTVEKSRPFKQFWLIQ 76

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQ-GKYWGQVCGV 122
           F  I +I  A +LR   L    +D    EL +  ++  D+ + +  D + GK  G++  +
Sbjct: 77  FKEITDIDQAEKLRGQILVVSEEDRG--ELPDGVYYYKDIFDCDVIDEETGKRIGKIVDI 134

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN 171
            + GA  I  ++    K + IP     V +V++   K+ ++ +  GL +
Sbjct: 135 QSPGANDIWLVREDDGKEYWIPNIADVVKKVDVAAKKVYVE-LMEGLRD 182


>gi|330964076|gb|EGH64336.1| 16S rRNA-processing protein RimM [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 179

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/168 (20%), Positives = 83/168 (49%), Gaps = 11/168 (6%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYAN---NPIDLNRYVLYSNDN--RELRILKMYRKNKR 59
           D L+++  I + HG+ GEV + S+ +   N +D   + L    +  +++ ++    ++K 
Sbjct: 9   DDLIVIGKIYSVHGVRGEVKVYSFTDPIGNLLDYKTWTLRREGSVEKQVELVSGRLQSKF 68

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +     +D+   A  L   ++   R  F D  L++ E++   LE ++  D+ G+  G++
Sbjct: 69  LVVKLKDLDDREEARLLSGYEICVPRNLFPD--LDDGEYYWYQLEGLKVIDQLGQLLGKI 126

Query: 120 CGVYNFGAGSILEIKNTM----EKTFLIPFTKFAVLEVNLQENKILID 163
             +   G+  ++ +K       ++  L+P+T+  VL +N+   ++ ++
Sbjct: 127 DHLLETGSNDVMVVKPCAGSLDDRERLLPYTEQCVLAINMAAGEMKVE 174


>gi|78356144|ref|YP_387593.1| 16S rRNA processing protein RimM [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
 gi|109893013|sp|Q313J8|RIMM_DESDG RecName: Full=Ribosome maturation factor rimM
 gi|78218549|gb|ABB37898.1| 16S rRNA processing protein RimM [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
          Length = 176

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 70/169 (41%), Gaps = 13/169 (7%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNREL---RILKMYRKNKRF 60
           +DK V +  I   HGL GEV + SYA++P  +   +            R+    R +   
Sbjct: 1   MDKYVQIGLITKPHGLRGEVCVVSYADSPFLMQERIFLQAGKGPCVPYRVRSSRRHSGTE 60

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEME-TFDRQGKYWGQV 119
           +    GID+ ++A +LR  K+     +    ELE+DE +  D+       D  G   G +
Sbjct: 61  LLLLEGIDDRNAAEKLRQHKVLIPHAELP--ELEDDEVYIEDILGFTVVLDEDGSTLGTL 118

Query: 120 CGVYNFGAGS----ILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
                F A +    + EI     K  L P  +  V E+++    I I P
Sbjct: 119 TA---FSAPTPEQEVWEITTPDGKEVLFPAAEEFVAEIDVDSETIRITP 164


>gi|23098990|ref|NP_692456.1| 16S rRNA processing protein [Oceanobacillus iheyensis HTE831]
 gi|33301526|sp|Q8EQZ8|RIMM_OCEIH RecName: Full=Ribosome maturation factor rimM
 gi|22777218|dbj|BAC13491.1| 16S rRNA processing protein [Oceanobacillus iheyensis HTE831]
          Length = 170

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 78/165 (47%), Gaps = 9/165 (5%)

Query: 10  MATIGTTHGLNGEVYIDSYAN--NPIDLNRYVLYSNDNRELR--ILKMYRKNKRF-IATF 64
           +  I  THG+ GEV +    +  +  D    V Y  DN+E +  ++  +R +K F +  F
Sbjct: 8   IGKIVNTHGIRGEVKVVRITDFEDRFDPGNTV-YLQDNKEYKPLVIATHRVHKGFDLLQF 66

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
            G  NI+     + L L        D  LEED ++  ++   +    +G+  G+V  + +
Sbjct: 67  KGYGNINEVEAFKGLMLSIDEDQLTD--LEEDAYYYHEIVGCKVVTSEGEELGKVKEILS 124

Query: 125 FGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
            GA  +  ++    K  LIP+ +  V +V++ ENKI+   +  G+
Sbjct: 125 PGANDVWVVQRMNAKDLLIPYIEQVVKQVDI-ENKIIKVQLMEGM 168


>gi|152965368|ref|YP_001361152.1| 16S rRNA processing protein RimM [Kineococcus radiotolerans
           SRS30216]
 gi|209573564|sp|A6W7U9|RIMM_KINRD RecName: Full=Ribosome maturation factor rimM
 gi|151359885|gb|ABS02888.1| 16S rRNA processing protein RimM [Kineococcus radiotolerans
           SRS30216]
          Length = 174

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/161 (22%), Positives = 75/161 (46%), Gaps = 9/161 (5%)

Query: 9   LMATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNR-ELRILKMYRKNKRFIAT 63
           ++A +G  HG+ GEV ++   ++P    R+    VL ++ +R  L +      N   + T
Sbjct: 4   VVARVGRPHGVRGEVTVEVRTDDPD--TRFAPGAVLRTDPDRGPLTVATARWHNGTLLLT 61

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F G+++  +   LR+ +L        + + ++D ++   L+ +      G   G V  + 
Sbjct: 62  FQGVEDRTAVEGLRNTRLVVDLD--DEADPDDDAWYPHQLQGLAAVTTTGTPLGTVKDLL 119

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
             GA  +L +  T  +  L+PF    V  V+++  K+++ P
Sbjct: 120 TGGAQDVLVVTGTDGREVLVPFVTPLVPRVDVKRGKVVLSP 160


>gi|323700098|ref|ZP_08112010.1| 16S rRNA processing protein RimM [Desulfovibrio sp. ND132]
 gi|323460030|gb|EGB15895.1| 16S rRNA processing protein RimM [Desulfovibrio desulfuricans
           ND132]
          Length = 195

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/168 (23%), Positives = 67/168 (39%), Gaps = 6/168 (3%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDN----RELRILKMYRK 56
           M K    + +  +   HG+ GE  I SYA++P   +R  L+ +D     R + +      
Sbjct: 1   MKKEPGFIPVGGVVKAHGIRGEFGIKSYADSPALFDRTPLFLSDGKGRPRPIEVTSWREH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
               + T   + +   A  LR  +L  +  D    E +E E +   +         G   
Sbjct: 61  KGLVLMTSPQVTDRDQAEALRGRELLVREADLP--EPDEGEHYLYQMIGCRVVLTDGTEV 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           G++ G Y  G      I+N      L+P     VL+V+L    I+++P
Sbjct: 119 GELVGFYETGEQDTWVIENGEGTEILLPAVPEFVLDVDLDTETIVVEP 166


>gi|324999613|ref|ZP_08120725.1| 16S rRNA processing protein RimM [Pseudonocardia sp. P1]
          Length = 187

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/152 (22%), Positives = 67/152 (44%), Gaps = 8/152 (5%)

Query: 20  NGEVYIDSYANNPID--LNRYVLYSNDNR-----ELRILKMYRKNKRFIATFSGIDNIHS 72
            GEV ++S  ++P +      VL+ +  R      L +      + R++  F G+ +   
Sbjct: 28  RGEVVVESRTDSPEERFAPGAVLHGSRRRGSGPGPLTVATSRAHSGRWLVLFEGVGDRDG 87

Query: 73  ASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFGAGSILE 132
           A ELR ++L     +  + + + +EF    L  +      G   G +  V +   GS+L 
Sbjct: 88  AEELRGVQLLLPTTELAEPD-DPEEFHVHRLTGLRAELTDGTPAGTITDVVHGPGGSLLV 146

Query: 133 IKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           +        ++PF    V EV+L+  ++++DP
Sbjct: 147 VTRPAGHEAMVPFVGEIVPEVDLEGGRVVLDP 178


>gi|256390712|ref|YP_003112276.1| 16S rRNA-processing protein RimM [Catenulispora acidiphila DSM
           44928]
 gi|256356938|gb|ACU70435.1| 16S rRNA processing protein RimM [Catenulispora acidiphila DSM
           44928]
          Length = 187

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/167 (20%), Positives = 73/167 (43%), Gaps = 5/167 (2%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNP----IDLNRYVLYSNDNRELRILKMYRKNKRFIAT 63
           +++  IG  HG+ G+  ++   ++P       +R +    +   L +  M   +   +  
Sbjct: 17  LVVGRIGRAHGIRGQATVEVRTDDPELRFAPGSRLLTEPAERGPLVVTDMRFHSGILLLA 76

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F G+ + ++   LR+  L  +  D  +   + +EF++  L  +      G   G++  + 
Sbjct: 77  FEGVADRNAVEALRNTILVVE-ADPDETPEDPEEFYDHQLVGLPVELADGTVLGEIADLL 135

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           +     +L +K       LIPF K  V  V++   +I++DP A  L+
Sbjct: 136 HLPGQDVLAVKRPDRPEVLIPFIKQFVPVVDVANKRIVVDPPAGLLD 182


>gi|332307107|ref|YP_004434958.1| 16S rRNA processing protein RimM [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332174436|gb|AEE23690.1| 16S rRNA processing protein RimM [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 176

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/147 (23%), Positives = 68/147 (46%), Gaps = 11/147 (7%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRKNKRFIAT 63
           +++  IG  +G+ G V I SY +    +  Y  +      + +E+ + +    NK  +A 
Sbjct: 8   LVIGKIGAPYGVKGWVKITSYTDELDGIFSYTPWLVGQEGNTKEIVVDQWRTHNKGLVAK 67

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
             G++    A  +++L +  K Q     +L+ DEF+  +L  M+    QG   G V  ++
Sbjct: 68  LVGVETRDDAESIKNLDISIKAQQLP--QLDGDEFYWRELVGMQVVTEQGYNLGVVKELF 125

Query: 124 NFGAGSILEIKNTMEKTF-----LIPF 145
             GA  ++ IK  ++  F     ++P+
Sbjct: 126 ETGANDVMLIKANLKDAFGQKERMVPY 152


>gi|222632582|gb|EEE64714.1| hypothetical protein OsJ_19570 [Oryza sativa Japonica Group]
          Length = 644

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 44/188 (23%), Positives = 84/188 (44%), Gaps = 32/188 (17%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNP-----IDLNRYVLYSNDNR------ELRILKMYR 55
           LV++  +   HG+ G+V +    + P         R++      +      EL   + + 
Sbjct: 76  LVVVGYVSGAHGVRGDVLVSPRTDFPQLRFATPGKRWLRARAAGKQQVKEFELVRGRAHT 135

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQ-GK 114
             K +I TF G+D++  A ++    +  K  D    ++EEDE ++ DL  M    +  GK
Sbjct: 136 GKKSWIVTFDGVDSVDEARQIVGSAILVKVGD--RPKMEEDEIYSLDLVGMRVIVKDTGK 193

Query: 115 YWGQVCGVYNFGAGSILEI-----KNTMEKT-------------FLIPFTKFAVLEVNLQ 156
             G V  V+NFGAG +L++     ++T+ +                IPF +  V +++++
Sbjct: 194 LVGTVGQVFNFGAGDLLQVMVGGTEDTVSQPNSENQGSTPSGEHVWIPFAEDIVPDIDME 253

Query: 157 ENKILIDP 164
             ++ I P
Sbjct: 254 SREMWITP 261


>gi|170723317|ref|YP_001751005.1| 16S rRNA-processing protein RimM [Pseudomonas putida W619]
 gi|229564325|sp|B1JDE4|RIMM_PSEPW RecName: Full=Ribosome maturation factor rimM
 gi|169761320|gb|ACA74636.1| 16S rRNA processing protein RimM [Pseudomonas putida W619]
          Length = 178

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/169 (20%), Positives = 81/169 (47%), Gaps = 10/169 (5%)

Query: 3   KLDKLVLMATIGTTHGLNGEVYIDSYAN---NPIDLNRYVL-YSNDNRELRILKMYRKNK 58
           K D L+++  I + HG+ GEV + S+ +   N +D  R+ L +    +++ ++      K
Sbjct: 7   KADDLIVVGKIFSVHGVRGEVKVYSFTDPIENLLDYPRWTLRHEGKVKQVELVSGRGSQK 66

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
             +    G+D+   A  L   ++   R    +  L  DE++   L+ ++  ++  + +G+
Sbjct: 67  GLVVKLKGLDDRDEARLLSGFEICIPRSLLPN--LAADEYYWYQLQGLKVINQDEQLFGK 124

Query: 119 VCGVYNFGAGSILEIKNTM----EKTFLIPFTKFAVLEVNLQENKILID 163
           V  +   GA  ++ +K       ++  L+P+T   VL ++L+   + ++
Sbjct: 125 VDHLLETGANDVMVVKPCAGSLDDRERLLPYTAQCVLAIDLEAGVMRVE 173


>gi|258543989|ref|ZP_05704223.1| 16S rRNA processing protein RimM [Cardiobacterium hominis ATCC
           15826]
 gi|258520767|gb|EEV89626.1| 16S rRNA processing protein RimM [Cardiobacterium hominis ATCC
           15826]
          Length = 182

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 65/146 (44%), Gaps = 8/146 (5%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY-----SNDNRELRILKMYRKNKRFIA 62
           +++  I   HG+ G+V + S       L +Y  +        +  L++L+     K  +A
Sbjct: 8   IIVGRIVGVHGIRGQVKVHSDCRPRESLFQYRQFIARQNGRPDIALQLLRGQTSGKGLVA 67

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F+GI++   A  L    LY  R      +  + E++  DL  +   +RQG   G+V  +
Sbjct: 68  AFTGINDRDQALALGGYTLYISRDQLPAPQ--DGEYYWADLIGLRVENRQGITLGRVSEL 125

Query: 123 YNFGAGSILEIKNTMEKT-FLIPFTK 147
           +  GA  IL +K    K   LIPF +
Sbjct: 126 FETGANDILVVKADNSKAEILIPFVR 151


>gi|310658881|ref|YP_003936602.1| 16S rRNA-processing protein rimm [Clostridium sticklandii DSM 519]
 gi|308825659|emb|CBH21697.1| putative 16S rRNA-processing protein rimM [Clostridium sticklandii]
          Length = 168

 Score = 49.3 bits (116), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 75/158 (47%), Gaps = 4/158 (2%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLN--RYVLYSNDNRELRILKMYRKNKRFIATFSGI 67
           +  I  THGL GEV +  Y + P      +Y+   N + ++ +  +       I   S I
Sbjct: 8   IGKIVNTHGLKGEVKVYPYTDYPERFKEIQYLYMENSDEKISVENVKISKNMVILKLSNI 67

Query: 68  DNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFGA 127
             I  A + R+  L+  R + +  +L+EDE    DL   + +D   KY G +  V  + A
Sbjct: 68  LTIDDAEKNRNNYLFIDRDNAR--KLDEDEHLIADLIGCKVYDVSEKYIGVLEDVLQYSA 125

Query: 128 GSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPI 165
             +  IK+   KT+L+P  K  V  +++   KI+IDPI
Sbjct: 126 NDVYSIKSENGKTYLVPAIKKFVPVIDIDNKKIIIDPI 163


>gi|223039527|ref|ZP_03609815.1| 16S rRNA processing protein RimM [Campylobacter rectus RM3267]
 gi|222879323|gb|EEF14416.1| 16S rRNA processing protein RimM [Campylobacter rectus RM3267]
          Length = 175

 Score = 49.3 bits (116), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/166 (27%), Positives = 82/166 (49%), Gaps = 12/166 (7%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-YVLYSNDNRELRILKMYRKNKRFIA 62
           + +LV +A +G T GL G V + +  + P    +  + Y  D  EL ++K Y      I 
Sbjct: 1   MSELVEVALLGKTVGLKGFVRLHNRGDFPNQFKKNAIFYDGDGNEL-VVKNYNSANDTIV 59

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDF-KDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
            F G ++I SA  L +  +Y  +++  K+ +L++ EFF  D+   E ++   +  G+V  
Sbjct: 60  -FCGFEDIDSAKTLTNKTIYTTKEETRKNCKLKKGEFFYFDVIGCEIYENNQR-LGEVED 117

Query: 122 VYNFGAGSILEIKN-------TMEKTFLIPFTKFAVLEVNLQENKI 160
           +   GA  +  IK         +EK+F IP+    V +V+++  KI
Sbjct: 118 IDEVGANHLFLIKTDGNLIAKGLEKSFYIPYIDVYVEKVDVENKKI 163


>gi|88860522|ref|ZP_01135160.1| 16S rRNA processing protein [Pseudoalteromonas tunicata D2]
 gi|88817720|gb|EAR27537.1| 16S rRNA processing protein [Pseudoalteromonas tunicata D2]
          Length = 176

 Score = 49.3 bits (116), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 38/166 (22%), Positives = 78/166 (46%), Gaps = 12/166 (7%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPI---DLNRYVLYSNDN-RELRILKMYRKNKRFIAT 63
           +++  +G  +G+ G + + S+ ++P+   D + +++      +  +++   R +K FIA 
Sbjct: 8   IVVGKLGAPYGIKGWLKVHSFTDDPVGIFDFSPWLIGQQGKWQSFKVVDWRRHSKGFIAK 67

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F+ ID+   A    + +++ +       EL + EF+  DL  M     +G   G V  + 
Sbjct: 68  FANIDDRDQALVYTNAEIFVELSQLP--ELPQGEFYWRDLIGMSVTTDKGYSLGIVDDLM 125

Query: 124 NFGAGSILEIKNTMEKTF-----LIPF-TKFAVLEVNLQENKILID 163
             G+  +L +K      F     LIPF T   +L V+ +  +I +D
Sbjct: 126 ETGSNDVLVVKANNNDGFGQAERLIPFLTDTVILNVDAEARQITVD 171


>gi|229086395|ref|ZP_04218571.1| Ribosome maturation factor rimM [Bacillus cereus Rock3-44]
 gi|228696911|gb|EEL49720.1| Ribosome maturation factor rimM [Bacillus cereus Rock3-44]
          Length = 174

 Score = 49.3 bits (116), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 81/176 (46%), Gaps = 10/176 (5%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDL----NRYVLYSNDNRELRILKM--Y 54
           M+ + K   +  I  THG+ GE+ + S  + P +     N   ++S+   E   +K+  +
Sbjct: 1   MLFMTKWFNVGKIVNTHGVRGEIRVISRTDFPEERYKVGNTLYIWSDKGTEPLPVKITSH 60

Query: 55  RKNKRF-IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQG 113
           R++K F + TF G  N+    + +   L    +     EL E E++  ++         G
Sbjct: 61  RQHKTFDLLTFEGYGNVDEVEKFKGSLLKVPEEQLG--ELAEGEYYYHEIIGCNVVTEDG 118

Query: 114 KYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           +  G +  + + GA  +  IK    +  LIP+    VL+VN+ ENK++   +  GL
Sbjct: 119 EALGTIKEILSPGANDVWVIKRPKGQDLLIPYIDDVVLQVNV-ENKLVTIHVMEGL 173


>gi|312878369|ref|ZP_07738279.1| 16S rRNA processing protein RimM [Caldicellulosiruptor
           lactoaceticus 6A]
 gi|311794854|gb|EFR11273.1| 16S rRNA processing protein RimM [Caldicellulosiruptor
           lactoaceticus 6A]
          Length = 169

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 80/169 (47%), Gaps = 6/169 (3%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNP---IDLNRYVLYSNDNRELRILKMYRKNKRFIA 62
           K + +  I  T GL GEV +    +      +L   +L  N + +L I +   K+   I 
Sbjct: 3   KYLQVGKIVNTFGLKGEVKVIPLTDEVDRFSELEYVLLEDNLSTKLTIERYRVKDNIVII 62

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F  I NI  A +L++  +  +R+  K  +L ED +F  D+  +E +D  G+  G++  V
Sbjct: 63  KFKEISNIDEAQKLKNRYIVIERERAK--KLPEDTYFICDIIGLEVYDLDGRKLGRIKDV 120

Query: 123 YNFGAGSILEIKNTM-EKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
              G+  +    + + +K  LIP  K  V EVN++E  + I  +   L+
Sbjct: 121 LKTGSNDVYICDSYIGKKDILIPALKDIVKEVNIEEGYMKIKVVEGLLD 169


>gi|228909667|ref|ZP_04073490.1| Ribosome maturation factor rimM [Bacillus thuringiensis IBL 200]
 gi|228849956|gb|EEM94787.1| Ribosome maturation factor rimM [Bacillus thuringiensis IBL 200]
          Length = 171

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 80/169 (47%), Gaps = 14/169 (8%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNRELRILKM----YRKNKRF- 60
           +  I  THG+ GE+ + S  + P +  RY     LY ++ ++   L +    +R++K F 
Sbjct: 7   VGKIVNTHGVRGEIRVISRTDFPEE--RYKVGNTLYISNEKDTDYLPVKVTSHRQHKTFD 64

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           + TF G +N+    + +   +    +     EL E E++  ++        +G+  G + 
Sbjct: 65  LLTFEGYNNVDEVEKFKGSLIKVPEEQLG--ELSEGEYYYHEIIGCSVVTEEGEALGTIK 122

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
            + + GA  +  IK    +  LIP+    VL+VN+ ENK++   +  GL
Sbjct: 123 EILSPGANDVWVIKRPKGQDLLIPYIDDVVLQVNI-ENKLVTIHVMEGL 170


>gi|118443705|ref|YP_878283.1| 16S rRNA-processing protein RimM [Clostridium novyi NT]
 gi|209573572|sp|A0Q0Y1|RIMM_CLONN RecName: Full=Ribosome maturation factor rimM
 gi|118134161|gb|ABK61205.1| 16S rRNA processing protein RimM [Clostridium novyi NT]
          Length = 162

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/162 (22%), Positives = 72/162 (44%), Gaps = 4/162 (2%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIAT 63
           +++ + +  I  THG+ GE+ +    +N            D   + I     +  + I  
Sbjct: 1   MEQFLAVGKIINTHGIKGEIKVMPSTDNVERFKELNEAYIDGNIVEIEGCKFQPGKVILK 60

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
             GID+I  A  L++  +   R++     L+ED ++  D+     +D   K  G +  + 
Sbjct: 61  IKGIDSIEDAQRLKNKYIKVSRENAA--TLDEDCYYEADIVGCTVYDENEKQLGNIDEII 118

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPI 165
           + G+  +  IK   E   LIP  K  ++++++   KI+I P+
Sbjct: 119 HTGSNDVYWIKGPNE--LLIPAIKSVIVDIDVNNKKIIIKPL 158


>gi|186475535|ref|YP_001857005.1| 16S rRNA-processing protein RimM [Burkholderia phymatum STM815]
 gi|209573554|sp|B2JF30|RIMM_BURP8 RecName: Full=Ribosome maturation factor rimM
 gi|184191994|gb|ACC69959.1| 16S rRNA processing protein RimM [Burkholderia phymatum STM815]
          Length = 231

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 74/174 (42%), Gaps = 17/174 (9%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNP------IDLNRYVLYSNDNRE-LRILKMYRKN 57
           D  V +  I   +GL G V + ++A+        +   R+ L     R+    L+     
Sbjct: 55  DDAVEVGAIVDAYGLKGWVKVAAHADAGHGGDALLSTKRWWLEKGRERQSTPCLQSKVHG 114

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              +A   G  +  +A  LR  ++Y +R+DF    L  DE++  DL  ++  +  G   G
Sbjct: 115 DSIVAQLGGTADRDAALALRGHRVYVRRRDFP--ALGTDEYYWVDLVGLDVVNEAGIELG 172

Query: 118 QVCGVYNFGAGSILEIK--------NTMEKTFLIPFTKFAVLEVNLQENKILID 163
           +V  + + GA S+L I+          +    LIPF    V  V+    KI++D
Sbjct: 173 KVADLIDNGAQSVLRIEYPAIGKDGKPVIGERLIPFVGVYVKTVDQAAKKIIVD 226


>gi|240170572|ref|ZP_04749231.1| 16S rRNA-processing protein [Mycobacterium kansasii ATCC 12478]
          Length = 177

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 38/162 (23%), Positives = 70/162 (43%), Gaps = 16/162 (9%)

Query: 16  THGLNGEVYIDSYANNPIDLNRY----VLYSNDNRELRILKMY------RKNKRFIATFS 65
            HG+ GE+ ++   ++P   NR+    +L +  +R+    + Y          R +    
Sbjct: 11  AHGIGGELVVEIRTDDPD--NRFAPGTLLRAKSSRDPGHERSYVIDSVRDHGARLLVRLV 68

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNF 125
           G+ +  +A  LR         D    E E D +++  LE +      G+  G V  V + 
Sbjct: 69  GVTDRDAADALRGSVFVIDSDDLPPIE-EADTYYDHQLEGLRVRTATGQDVGVVAEVLHT 127

Query: 126 GAGSILEIK---NTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
            AG +L ++    + E   L+PF +  V  V+L++  + IDP
Sbjct: 128 AAGELLAVRPADGSQEGEVLVPFVRAIVTSVSLEDGVLQIDP 169


>gi|93007145|ref|YP_581582.1| 16S rRNA processing protein RimM [Psychrobacter cryohalolentis K5]
 gi|109893037|sp|Q1Q8A5|RIMM_PSYCK RecName: Full=Ribosome maturation factor rimM
 gi|92394823|gb|ABE76098.1| 16S rRNA processing protein RimM [Psychrobacter cryohalolentis K5]
          Length = 177

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/154 (22%), Positives = 77/154 (50%), Gaps = 10/154 (6%)

Query: 17  HGLNGEVYIDSYANNP---IDLNRYVLYSNDNRELRILKMYR-KNKRFIATFSGIDNIHS 72
           +G+ G +++ S  ++     D+  + + +    +   +K +R +    +A F  I + + 
Sbjct: 20  YGIKGWLWVFSETDDRTAIFDIKPWWMKTATGMKPLTVKAWREQGTGIVAQFEQIPDRNV 79

Query: 73  ASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFGAGSILE 132
           A  +  + L+ + QD   E   EDE++ +DL  +   + Q +Y G +  ++  GA +I+ 
Sbjct: 80  AETMNGVTLWVE-QDILPEP-AEDEYYWSDLVSLRVMNEQDEYLGDITEMFETGAHAIMR 137

Query: 133 IKNTME----KTFLIPFTKFAVLEVNLQENKILI 162
           +  T +    +  LIP+ K  V++V+L E  +L+
Sbjct: 138 VAATTDSLDKEERLIPWHKQTVVKVDLTEKTVLV 171


>gi|212716749|ref|ZP_03324877.1| hypothetical protein BIFCAT_01686 [Bifidobacterium catenulatum DSM
           16992]
 gi|212660453|gb|EEB21028.1| hypothetical protein BIFCAT_01686 [Bifidobacterium catenulatum DSM
           16992]
          Length = 195

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 47/181 (25%), Positives = 80/181 (44%), Gaps = 25/181 (13%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNRELRILKMYRKNK-RF 60
           +L+ +  IG   GL GEV +  + + P    R+    VLY+ D  E  +++  R  K R+
Sbjct: 10  ELLRVCRIGRAQGLKGEVTVQIFTDEP--EYRFAPGAVLYTKDGEEEYVVENSRTFKNRW 67

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           I  F GIDN   +     + LY +  D +D  LE DE++  DL  +E    +    G   
Sbjct: 68  IVKFEGIDNRDQSEAANGIVLYGEADDPED-MLEADEWYPKDLIGLEARLAENNMLGLEP 126

Query: 121 GVYNFGAGSILEIKN-----------------TMEKTFLIPFTKFAVLEVNLQENKILID 163
           GV       ++E+                    +E + L+PF    V +++L++  + +D
Sbjct: 127 GVVVGKVVDVIEVAQWLLKIRLANPVKDADGVVVENSALVPFVDELVPDIDLEKGYLTLD 186

Query: 164 P 164
           P
Sbjct: 187 P 187


>gi|253578960|ref|ZP_04856231.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|251849903|gb|EES77862.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA]
          Length = 167

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 54/169 (31%), Positives = 91/169 (53%), Gaps = 19/169 (11%)

Query: 4   LDKLVLMATIGTTHGLNGEV--YIDSYANNPIDLNRYVLYSNDNRELRILKM----YRKN 57
           ++ L+ +  I TTHG+ GEV  Y  + A+  +DL  YVL     RE R L++    Y KN
Sbjct: 1   MEDLLKVGVITTTHGIRGEVKVYPTTDADRFLDLE-YVLLDT-GREKRKLEIENVKYFKN 58

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDF----KDEELEEDEFFNTDLEEMETFDRQG 113
              I  F GIDNI+      D+++Y KR+ +    + +ELEEDE++  DL  M+     G
Sbjct: 59  -LVILKFRGIDNIN------DIEMYKKRELWIPREEAQELEEDEYYIADLIGMDVVLEDG 111

Query: 114 KYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
             +G +  V   GA  +  +++   +  L+P  +  +L+V++++N + I
Sbjct: 112 SKFGTLKDVMETGANDVYVVEDAKGEEILLPAIRECILDVDVEKNVMTI 160


>gi|325295593|ref|YP_004282107.1| ribosome maturation factor rimM [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325066041|gb|ADY74048.1| Ribosome maturation factor rimM [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 188

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 45/165 (27%), Positives = 74/165 (44%), Gaps = 7/165 (4%)

Query: 8   VLMATIGTTHGLNGEVYI----DSYANNPIDLNRYVLYSNDNRE-LRILKMYRKNKRFIA 62
           V++  I   HG+ GEV I    D +      L+   +Y    RE L + K+      +I 
Sbjct: 24  VMIGKIVGVHGIKGEVKIKPESDIFEKQMEALDLIPVYRGTKREELCVEKLKPYKNLYIV 83

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F  I++   A E    +L+  +   K  EL E EF+ +DL   + F   GK  G +  +
Sbjct: 84  KFKEINDRGEAEERVGGELWIDKN--KQVELGEGEFYFSDLIGSKVFTDDGKEVGILKEI 141

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAA 167
               AG I E++ +     LIPF    V +V+++  +I++  I  
Sbjct: 142 LEQPAGHIFEVEKSDGSKILIPFISQFVKDVDIENKRIVVSLIEG 186


>gi|295836290|ref|ZP_06823223.1| 16S rRNA processing protein RimM [Streptomyces sp. SPB74]
 gi|197697345|gb|EDY44278.1| 16S rRNA processing protein RimM [Streptomyces sp. SPB74]
          Length = 235

 Score = 48.9 bits (115), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 37/161 (22%), Positives = 78/161 (48%), Gaps = 5/161 (3%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNP-IDLNRYVLYSNDNR---ELRILKMYRKNKRFIAT 63
           +++A IG  HG+ GEV ++   + P + L    + + D      L I +    + R +  
Sbjct: 3   LVVARIGRAHGIKGEVTVEVRTDEPELRLPPGAVLATDPPGAGPLTIEQGRVHSGRLLLR 62

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F+G+ +   A  LR++ L A+    +  E  E EF++  L +++     G+  G++  + 
Sbjct: 63  FAGVKDRTGAEALRNILLIAEIDPEEVPEDPE-EFYDYQLMDLDVITEDGQEIGRITEIS 121

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           +  +  +  ++       +IPF +  V E++L E + +I+P
Sbjct: 122 HLPSQDLFIVERPDGSEVMIPFVEEIVTEIDLHEQRAVINP 162


>gi|157692281|ref|YP_001486743.1| 16S rRNA-processing protein RimM [Bacillus pumilus SAFR-032]
 gi|166985924|sp|A8FD66|RIMM_BACP2 RecName: Full=Ribosome maturation factor rimM
 gi|157681039|gb|ABV62183.1| 16S rRNA processing protein [Bacillus pumilus SAFR-032]
          Length = 174

 Score = 48.9 bits (115), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 37/161 (22%), Positives = 77/161 (47%), Gaps = 9/161 (5%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNR-----YVLYSNDNRELRI-LKMYRKNKRF-IA 62
           +  I  THG+ GEV + S  + P +  +     Y+        L++ +  +R++K+F + 
Sbjct: 8   VGKIVNTHGVRGEVRVVSKTDFPEERYKKGSVLYIFKQGQGEPLKVTVASHRQHKQFDLL 67

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
           TF  I +++ A  L++  L  +++      L+E EF+   +   E +D + +  GQ+  +
Sbjct: 68  TFEEISSLNEAELLKESILKVEKEHLGS--LDEGEFYFHQIIGCEVYDEENQLVGQIKEI 125

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
              GA  +  +    +K  LIP+    V ++++    I I+
Sbjct: 126 LTPGANDVWVVGRKGKKDALIPYIPSVVKKIDISSKTIHIE 166


>gi|218898995|ref|YP_002447406.1| 16S rRNA processing protein RimM [Bacillus cereus G9842]
 gi|228902345|ref|ZP_04066502.1| Ribosome maturation factor rimM [Bacillus thuringiensis IBL 4222]
 gi|228940930|ref|ZP_04103489.1| Ribosome maturation factor rimM [Bacillus thuringiensis serovar
           berliner ATCC 10792]
 gi|228966787|ref|ZP_04127831.1| Ribosome maturation factor rimM [Bacillus thuringiensis serovar
           sotto str. T04001]
 gi|228973859|ref|ZP_04134435.1| Ribosome maturation factor rimM [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228980449|ref|ZP_04140759.1| Ribosome maturation factor rimM [Bacillus thuringiensis Bt407]
 gi|226694908|sp|B7IUK1|RIMM_BACC2 RecName: Full=Ribosome maturation factor rimM
 gi|218544507|gb|ACK96901.1| 16S rRNA processing protein RimM [Bacillus cereus G9842]
 gi|228779269|gb|EEM27526.1| Ribosome maturation factor rimM [Bacillus thuringiensis Bt407]
 gi|228785884|gb|EEM33887.1| Ribosome maturation factor rimM [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228792886|gb|EEM40444.1| Ribosome maturation factor rimM [Bacillus thuringiensis serovar
           sotto str. T04001]
 gi|228818766|gb|EEM64832.1| Ribosome maturation factor rimM [Bacillus thuringiensis serovar
           berliner ATCC 10792]
 gi|228857314|gb|EEN01817.1| Ribosome maturation factor rimM [Bacillus thuringiensis IBL 4222]
 gi|326941611|gb|AEA17507.1| 16S rRNA-processing protein [Bacillus thuringiensis serovar
           chinensis CT-43]
          Length = 171

 Score = 48.9 bits (115), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 80/169 (47%), Gaps = 14/169 (8%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNRELRILKM----YRKNKRF- 60
           +  I  THG+ GE+ + S  + P +  RY     LY ++ ++   L +    +R++K F 
Sbjct: 7   VGKIVNTHGVRGEIRVISRTDFPEE--RYKVGNTLYISNEKDTDYLPVKVTSHRQHKTFD 64

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           + TF G +N+    + +   +    +     EL E E++  ++        +G+  G + 
Sbjct: 65  LLTFEGYNNVDEVEKFKGSLIKVPEEQLG--ELAEGEYYYHEIIGCSVVTEEGEALGTIK 122

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
            + + GA  +  IK    +  LIP+    VL+VN+ ENK++   +  GL
Sbjct: 123 EILSPGANDVWVIKRPKGQDLLIPYIDDVVLQVNI-ENKLVTIHVMEGL 170


>gi|114320046|ref|YP_741729.1| 16S rRNA processing protein RimM [Alkalilimnicola ehrlichii MLHE-1]
 gi|122312116|sp|Q0AA98|RIMM_ALHEH RecName: Full=Ribosome maturation factor rimM
 gi|114226440|gb|ABI56239.1| 16S rRNA processing protein RimM [Alkalilimnicola ehrlichii MLHE-1]
          Length = 170

 Score = 48.9 bits (115), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/169 (23%), Positives = 76/169 (44%), Gaps = 10/169 (5%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNP---IDLNRYVLYSNDNRELRILKMYRK- 56
           M   D +V M  +   HG+ G V + S+       +D   + L  +D   + + +   + 
Sbjct: 1   MEGADDIVPMGEVVGLHGVRGWVKVYSHTEPREAILDYPHWYLRRDDGDWVPVERTAGRC 60

Query: 57  -NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
             K  +A F  +++   A     L++   R+D    EL E +++  DLE +  +   G+ 
Sbjct: 61  QGKGLVAAFRDVEDRDRARAYIGLQIGVPRRDLP--ELPEGQYYWADLEGLAAYTTGGEP 118

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFT-KFAVLEVNLQENKILID 163
            G+V  ++  GA  +L ++   E+  L+PF     V  V+L   +I +D
Sbjct: 119 LGRVSHLFATGANDVLVLQGDRER--LVPFVYGQTVRRVDLTAGRIELD 165


>gi|296171461|ref|ZP_06852747.1| 16S rRNA processing protein RimM [Mycobacterium parascrofulaceum
           ATCC BAA-614]
 gi|295894147|gb|EFG73907.1| 16S rRNA processing protein RimM [Mycobacterium parascrofulaceum
           ATCC BAA-614]
          Length = 173

 Score = 48.5 bits (114), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 35/162 (21%), Positives = 61/162 (37%), Gaps = 8/162 (4%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPI-------DLNRYVLYSNDNRELRILKMYRKNKRFIA 62
           +  +   HG+ GEV ++   ++P         L          R+  +        R + 
Sbjct: 5   VGRVAKAHGIGGEVVVEIRTDDPGARFAPGNTLRGRASRGGGERDFVVESAREHGGRLLL 64

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
             +G+ +  SA  LR         D    + E D +++  LE +      G   G V  V
Sbjct: 65  RLAGVTDRDSADALRGTVFVVDSDDLPPID-EPDTYYDHQLEGLHVRTVAGHDVGVVAEV 123

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
            +  AG +L ++       L+PF    V  V+L +  + IDP
Sbjct: 124 LHTAAGELLAVRRGDGGEALVPFVGAIVTSVSLDDRVVEIDP 165


>gi|299821782|ref|ZP_07053670.1| 16S rRNA processing protein RimM [Listeria grayi DSM 20601]
 gi|299817447|gb|EFI84683.1| 16S rRNA processing protein RimM [Listeria grayi DSM 20601]
          Length = 171

 Score = 48.5 bits (114), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 38/167 (22%), Positives = 79/167 (47%), Gaps = 9/167 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYAN------NPIDLNRYVLYSNDNRELRILKMYRKN 57
           ++K+  +  I  THGL GEV + S  +       P ++  YV  +  + +   +K +R++
Sbjct: 1   MEKMYKVGKIVNTHGLMGEVRVISTTDFAAERYVPGNILYYVPKTGGSAQPLTIKSHRQH 60

Query: 58  KRF-IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           K F + TF G   I+    L++  L  K  + + + LEE+ ++  ++        +G+  
Sbjct: 61  KTFDLLTFEGYTGINQVEHLKEGVL--KVTESQLQPLEENAYYFHEIIGCTVVTTEGETL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
           G++  +   GA  +  ++   +K  LIP+    V  +++    I I+
Sbjct: 119 GEIKEILTPGANDVWVVETAAKKEILIPYIADVVKTIDIPTKTITIE 165


>gi|227504775|ref|ZP_03934824.1| 16S rRNA-processing protein [Corynebacterium striatum ATCC 6940]
 gi|227198625|gb|EEI78673.1| 16S rRNA-processing protein [Corynebacterium striatum ATCC 6940]
          Length = 174

 Score = 48.5 bits (114), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 46/171 (26%), Positives = 82/171 (47%), Gaps = 15/171 (8%)

Query: 2   VKLDKLVLM-ATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNR---ELRILKM 53
           +K++++ LM   +  +HG+ GE+ +++  + P    R+    VL+    +   EL I  +
Sbjct: 4   IKVEQMELMIGRVIKSHGIKGELSVEATTDEP--EIRFAVGEVLHGRQGKKEHELTIKAV 61

Query: 54  YRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQG 113
                R + TF  + +  +A  LR  + +A   D  D+    D F++ +LE +      G
Sbjct: 62  RVHKGRLLITFEEVKDRTAADSLRGTQFFAPPLDDPDD----DGFYDHELEGLRVI-HDG 116

Query: 114 KYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
              G+V G+ +    S+LE++    K  LIPF +  V EV+L E    I P
Sbjct: 117 NDIGEVTGLTHGPTQSLLEVRLESGKEALIPFVEEIVPEVDLDEGTCTITP 167


>gi|319649587|ref|ZP_08003743.1| 16S rRNA processing protein RimM [Bacillus sp. 2_A_57_CT2]
 gi|317398749|gb|EFV79431.1| 16S rRNA processing protein RimM [Bacillus sp. 2_A_57_CT2]
          Length = 173

 Score = 48.5 bits (114), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 82/171 (47%), Gaps = 14/171 (8%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDL----NRYVLYSNDNRELRI---LKMYRKNKRF-I 61
           +  I  THG+ GE  + S  +   +     N+  L+  D +   I   +K +R +K F +
Sbjct: 7   VGKIVNTHGIKGEARVISKTDFAEERYKPGNKLYLFMPDTKGDPIELTVKTHRTHKTFDL 66

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLE--EMETFDRQGKYWGQV 119
            TF G +NI+   +++   L        D  LEEDEF+  ++    +ET D  G   G++
Sbjct: 67  LTFEGYENINGIEKMKGGILKISEDQLGD--LEEDEFYYHEIIGCTVETLD--GAEVGKI 122

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
             + + GA  +  IK    K  LIP+ +  V EVN+++  + I+ I   L+
Sbjct: 123 KEILSPGANDVWVIKAKGGKEILIPYIEDVVKEVNVKDKLVKINAIEGLLS 173


>gi|260773520|ref|ZP_05882436.1| 16S rRNA processing protein RimM [Vibrio metschnikovii CIP 69.14]
 gi|260612659|gb|EEX37862.1| 16S rRNA processing protein RimM [Vibrio metschnikovii CIP 69.14]
          Length = 176

 Score = 48.5 bits (114), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 76/166 (45%), Gaps = 12/166 (7%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNP---IDLNRYVLYSNDNR-ELRILKMYRKNKRFIAT 63
           +++   G ++G+ G + + SY +N     D + +++  N    E ++    R NK  +A 
Sbjct: 8   IVVGKFGASYGIRGWLKVLSYTDNAESIFDYSPWLVNQNGEWVEYKVESWKRHNKGLVAK 67

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
             G+D    A  L + ++          EL EDEF+  +L  M     QG   G+V  + 
Sbjct: 68  LEGLDVREDAHLLTNFEISIDPASLP--ELSEDEFYWRELFGMRVVTTQGYDLGEVVDML 125

Query: 124 NFGAGSILEIKNTMEKTF-----LIPFTKFAVL-EVNLQENKILID 163
             G+  +L +K  ++  F     LIPF +  V+ +++    +I +D
Sbjct: 126 ETGSNDVLVVKANLKDAFGQKERLIPFLEEQVIKQIDRTAQRIEVD 171


>gi|187933452|ref|YP_001885446.1| 16S rRNA-processing protein RimM [Clostridium botulinum B str.
           Eklund 17B]
 gi|238691615|sp|B2TJ30|RIMM_CLOBB RecName: Full=Ribosome maturation factor rimM
 gi|187721605|gb|ACD22826.1| 16S rRNA processing protein RimM [Clostridium botulinum B str.
           Eklund 17B]
          Length = 165

 Score = 48.5 bits (114), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 73/165 (44%), Gaps = 10/165 (6%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSN---DNRELRILKMYRKNKRF 60
           ++++  +  I  THG+ GEV +        D+N++    N   D +E  I  +  +  R 
Sbjct: 1   MEEIFKVGQIVNTHGIKGEVKVYPLTE---DVNKFKKLKNVLIDGKERNIQSVKFQKDRV 57

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           I    GID ++ A   +   +   R +    +LE D  +  DL     +D      G++ 
Sbjct: 58  ILKIEGIDTMNDAETYKQKYIEIFRSNA--PKLEADTHYVVDLVGCMVYDSDNVELGKIF 115

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPI 165
            V +  +  +  IK    K  LIP  K  VL++N+   KI+I P+
Sbjct: 116 DVISTPSNDVYWIKEP--KQLLIPVLKDIVLDINIDNKKIVIKPV 158


>gi|292491048|ref|YP_003526487.1| 16S rRNA processing protein RimM [Nitrosococcus halophilus Nc4]
 gi|291579643|gb|ADE14100.1| 16S rRNA processing protein RimM [Nitrosococcus halophilus Nc4]
          Length = 175

 Score = 48.5 bits (114), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 77/164 (46%), Gaps = 9/164 (5%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNREL---RILKMYRKNKRF 60
           ++ VL+  I   +G+ G V + SY     ++ RY   Y   N +    R+L+   + K  
Sbjct: 11  NRYVLIGRISGVYGIQGWVRVYSYTEPRDNILRYEPWYLQQNGKWIARRLLEGRTQGKGI 70

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +    GID+   A++    ++   R+     E  E E++  DL  +     QG   G+V 
Sbjct: 71  VVALDGIDDRDVATQWIGREIAVHREQLPPPE--EGEYYWADLIGLRVITVQGVELGRVE 128

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVL-EVNLQENKILID 163
            +   GA  +L ++   E+  LIPF K  ++ +V+L++  + +D
Sbjct: 129 RLLETGANDVLVVQGERER--LIPFRKDTIVKQVDLEQGLLRVD 170


>gi|209521546|ref|ZP_03270247.1| 16S rRNA processing protein RimM [Burkholderia sp. H160]
 gi|209498016|gb|EDZ98170.1| 16S rRNA processing protein RimM [Burkholderia sp. H160]
          Length = 244

 Score = 48.5 bits (114), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 75/171 (43%), Gaps = 17/171 (9%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNP------IDLNRY-VLYSNDNRELRILKMYRKNKRF 60
           V +  I   +GL G V + ++A+        +   R+ +L   + R    L+    +   
Sbjct: 71  VEVGAIVDAYGLKGWVKVAAHADAGQGGDALLSAKRWWLLKGQERRSAPSLQAKTHSDSV 130

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +A   G+ +   A  LR  ++Y  R +F    LE DEF+  DL  ++  +  G   G+V 
Sbjct: 131 VARLGGVADRDVALALRGSRVYISRSEFP--ALEADEFYWVDLIGLDVVNLAGLNLGKVA 188

Query: 121 GVYNFGAGSILEI------KN--TMEKTFLIPFTKFAVLEVNLQENKILID 163
            + + GA S+L I      KN   +    LIPF    V  V+    +I++D
Sbjct: 189 SMIDNGAQSVLRIDYPATDKNGKPVAGERLIPFVGVFVKTVDQAAKQIVVD 239


>gi|159904270|ref|YP_001551614.1| 16S rRNA-processing protein RimM [Prochlorococcus marinus str. MIT
           9211]
 gi|238687125|sp|A9BD47|RIMM_PROM4 RecName: Full=Ribosome maturation factor rimM
 gi|159889446|gb|ABX09660.1| possible 16S rRNA processing protein RimM [Prochlorococcus marinus
           str. MIT 9211]
          Length = 176

 Score = 48.5 bits (114), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 79/172 (45%), Gaps = 11/172 (6%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNP---IDLNRYVLYSNDNRELRI-LKMYRK 56
           M + D  + +  +    GL GEV ++  ++ P   I+     L  N     RI LK  R+
Sbjct: 1   MSRKDSWLTIGKLVGAQGLRGEVKVNPSSDFPERFINPGERWLQKNTEEPSRIELKSGRQ 60

Query: 57  ---NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMET-FDRQ 112
                 +I +F GI + + A  +   KL       +  +L+E EF   DL  ++  F + 
Sbjct: 61  LPGKSIYIVSFIGITDRNKAESIVGNKLLVPSD--QKPKLKEGEFHLVDLLGLKAKFTQD 118

Query: 113 GKYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           G   G+V  + + G   +L IK    KT LIPF K  V  +NL++  +LI P
Sbjct: 119 GSDVGEVIDLTSAG-NDLLVIKLVEGKTVLIPFVKEIVPVINLKQGWLLIKP 169


>gi|194014273|ref|ZP_03052890.1| 16S rRNA processing protein RimM [Bacillus pumilus ATCC 7061]
 gi|194013299|gb|EDW22864.1| 16S rRNA processing protein RimM [Bacillus pumilus ATCC 7061]
          Length = 174

 Score = 48.5 bits (114), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 37/161 (22%), Positives = 77/161 (47%), Gaps = 9/161 (5%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNR-----YVLYSNDNRELRI-LKMYRKNKRF-IA 62
           +  I  THG+ GEV + S  + P +  +     Y+        L++ +  +R++K+F + 
Sbjct: 8   VGKIVNTHGVRGEVRVVSKTDFPEERYKKGSVLYIFKQGQGEPLKVTVASHRQHKQFDLL 67

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
           TF  I +++ A  L++  L  +++      L+E EF+   +   E +D + +  GQ+  +
Sbjct: 68  TFEEISSLNEAELLKESILKVEKEHLGS--LDEGEFYFHQIIGCEVYDEEDQLVGQIKEI 125

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
              GA  +  +    +K  LIP+    V ++++    I I+
Sbjct: 126 LTPGANDVWVVGRKGKKDALIPYIPSVVKKIDIASKTIHIE 166


>gi|116492615|ref|YP_804350.1| 16S rRNA processing protein RimM [Pediococcus pentosaceus ATCC
           25745]
 gi|122265921|sp|Q03FW4|RIMM_PEDPA RecName: Full=Ribosome maturation factor rimM
 gi|116102765|gb|ABJ67908.1| 16S rRNA processing protein RimM [Pediococcus pentosaceus ATCC
           25745]
          Length = 171

 Score = 48.5 bits (114), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 38/170 (22%), Positives = 81/170 (47%), Gaps = 13/170 (7%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNR----YVLYSNDNRELRILKMYRKNKR-----F 60
           +A I  T GL GE+ + SY + P +  +      ++  +  E+ +  +  KN +     F
Sbjct: 6   VAKIVNTRGLRGELKVISYTDFPEERFKSGAELQIFKTEKDEVPVQTVTVKNAKEYKGSF 65

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           I T  G+++I+   + + + L  +    +D  LEE EF+   +  ++  +   K  G + 
Sbjct: 66  IVTLEGMNSINDVEKFKGMILKVEEDQLQD--LEEGEFYLHQIIGLDVIENDQKI-GTIK 122

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
            V ++G   +  +K   +   L+P+ K  +L V+L++  + +  +  GL+
Sbjct: 123 EVLSYGPNDVWVVKRPNQNDLLLPYLKDVILNVDLEQGAVQVS-VPEGLD 171


>gi|325914813|ref|ZP_08177148.1| 16S rRNA processing protein RimM [Xanthomonas vesicatoria ATCC
           35937]
 gi|325538904|gb|EGD10565.1| 16S rRNA processing protein RimM [Xanthomonas vesicatoria ATCC
           35937]
          Length = 170

 Score = 48.5 bits (114), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 35/168 (20%), Positives = 77/168 (45%), Gaps = 8/168 (4%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY---VLYSNDNRELRI--LKMYR 55
           M   ++ +L+  I    G+ GE+ ++S+      + RY   ++ S   +E  +  ++   
Sbjct: 1   MKPTERRILLGRIVGAFGVKGELKLESWTEPRSAIFRYQPWIVRSPSGQETVVSGVRGRD 60

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
           + K  IA F  + +  +   +   ++Y  R          DE++  DLEE++    +G  
Sbjct: 61  QGKNLIAVFPDVTDRDTVEAMHGTEIYVARSALPPPN--PDEYYWVDLEELQVETVEGVK 118

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
            G V  +++ G+  ++ ++   E+     F +F V  V+ + N I++D
Sbjct: 119 LGTVSHLFSTGSNDVVVVRGDRERMIPFVFPEF-VKSVDFEANLIVVD 165


>gi|290957098|ref|YP_003488280.1| 16S rRNA processing protein [Streptomyces scabiei 87.22]
 gi|260646624|emb|CBG69721.1| putative 16S rRNA processing protein [Streptomyces scabiei 87.22]
          Length = 195

 Score = 48.5 bits (114), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 42/189 (22%), Positives = 87/189 (46%), Gaps = 9/189 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNP-IDLNRYVLYSND---NRELRILKMYRKNKRFIAT 63
           +++A IG  HG+ GEV ++   + P + L    +   D      L I      + R +  
Sbjct: 3   LVVARIGRAHGIKGEVTVEVRTDEPELRLGPGAVLLTDPASTGPLTIETGRVHSGRLLLR 62

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F G+ + + A  LR+  L A+    +  E E+ E+++  L +++   R G   G++  + 
Sbjct: 63  FEGVRDRNGAEALRNTLLIAEVDPEELPEEED-EYYDHQLMDLDVVTRDGLEVGRITEIS 121

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN----TTMKNPQY 179
           +  +  +  ++       +IPF +  V E++L E + +IDP    +++     + ++   
Sbjct: 122 HLPSQDLFIVERPDGSEVMIPFVESIVTEIDLTEQRAVIDPPPGLIDDRAEIASARDAAE 181

Query: 180 DCPLDSAGK 188
           +   DSAG 
Sbjct: 182 ESTTDSAGP 190


>gi|302522159|ref|ZP_07274501.1| 16S rRNA processing protein RimM [Streptomyces sp. SPB78]
 gi|302431054|gb|EFL02870.1| 16S rRNA processing protein RimM [Streptomyces sp. SPB78]
          Length = 236

 Score = 48.5 bits (114), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 37/161 (22%), Positives = 78/161 (48%), Gaps = 5/161 (3%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNP-IDLNRYVLYSNDNR---ELRILKMYRKNKRFIAT 63
           +++A IG  HG+ GEV ++   + P + L    + + D      L I +    + R +  
Sbjct: 3   LVVARIGRAHGIKGEVTVEVRTDEPELRLPPGAVLATDPPGAGPLTIEQGRVHSGRLLLR 62

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F+G+ +  +A  LR+  L A+    +  E  E EF++  L +++     G+  G++  + 
Sbjct: 63  FAGVKDRTAAEALRNTLLIAETDPEEVPEDPE-EFYDYQLMDLDVVTEDGQEIGRITEIS 121

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           +  +  +  ++       +IPF +  V E++L E + +I+P
Sbjct: 122 HLPSQDLFIVERPDGSEVMIPFVEEIVTEIDLDEQRAVINP 162


>gi|257055029|ref|YP_003132861.1| 16S rRNA processing protein RimM [Saccharomonospora viridis DSM
           43017]
 gi|256584901|gb|ACU96034.1| 16S rRNA processing protein RimM [Saccharomonospora viridis DSM
           43017]
          Length = 174

 Score = 48.5 bits (114), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 70/168 (41%), Gaps = 14/168 (8%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYV--------LYSNDNRELRILKMYRKNKR 59
           V++  I   HG+ GEV +D   ++P    R+         +     R L +  +     R
Sbjct: 3   VVVGRIVKPHGIRGEVAVDVRTDSP--EERFAPETVLTGKMRDGRTRPLTVAAVRPHGGR 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +  F  + +  +A E+R   L     +    + + DEF++ +LE +      G   G V
Sbjct: 61  LLVRFLEVPDRTAAEEIRGATLLIDVDELPPID-DPDEFYDHELEGLRAELDDGTVVGTV 119

Query: 120 CGVYNFGAGSILEI---KNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
             V +   G +L +   ++   +  L+PF    V  V +   +I++DP
Sbjct: 120 REVVHSPGGELLAVEVEESGRRREVLVPFVAAIVPRVEVDRGRIVLDP 167


>gi|229162778|ref|ZP_04290735.1| Ribosome maturation factor rimM [Bacillus cereus R309803]
 gi|228620660|gb|EEK77529.1| Ribosome maturation factor rimM [Bacillus cereus R309803]
          Length = 171

 Score = 48.5 bits (114), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 80/169 (47%), Gaps = 14/169 (8%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNRELRILKM----YRKNKRF- 60
           +  I  THG+ GE+ + S  + P +  RY     LY ++ ++   L +    +R++K F 
Sbjct: 7   VGKIVNTHGVRGEIRVISRTDFPEE--RYKVGNTLYISNEKDTDYLPVKVTSHRQHKTFD 64

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           + T  G +N+    +L+   +    +     EL E E++  ++        +G+  G + 
Sbjct: 65  LLTLEGYNNVDEVEKLKGSLIKVPEEQLG--ELAEGEYYYHEIIGCSVVTEEGEALGTIK 122

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
            + + GA  +  IK    +  LIP+    VL+VN+ ENK++   +  GL
Sbjct: 123 EILSPGANDVWVIKRPKGQDLLIPYIDDVVLQVNI-ENKLVTIHVMEGL 170


>gi|220912967|ref|YP_002488276.1| 16S rRNA-processing protein RimM [Arthrobacter chlorophenolicus A6]
 gi|219859845|gb|ACL40187.1| 16S rRNA processing protein RimM [Arthrobacter chlorophenolicus A6]
          Length = 181

 Score = 48.5 bits (114), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 41/160 (25%), Positives = 71/160 (44%), Gaps = 9/160 (5%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDL----NRYVLYSNDNRELRILKMYRKNKRFIATFS 65
           +A IG  HG+ GEV +    + P D       +V+    +  L +          +  F 
Sbjct: 5   VARIGKPHGIRGEVTVQVMTDAPGDRFVPGVEFVVEPAQSGPLTVSSARWNKDILLLAFE 64

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGK-YWGQVCGVYN 124
            I++ + A  LR  KL+ +  +  +++  ED ++  +L  +E   R G    G+V  +  
Sbjct: 65  EIEDRNQAETLRGAKLFIETAELDEDD--EDGWYEHELVGLEA--RVGSTVVGKVTALNT 120

Query: 125 FGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
             A  +L +     +  LIPF +  V EVN+ E  IL+ P
Sbjct: 121 APAQDLLMVTTPDGEEILIPFVEQIVPEVNVGEGYILLTP 160


>gi|225180941|ref|ZP_03734389.1| 16S rRNA processing protein RimM [Dethiobacter alkaliphilus AHT 1]
 gi|225168422|gb|EEG77225.1| 16S rRNA processing protein RimM [Dethiobacter alkaliphilus AHT 1]
          Length = 169

 Score = 48.1 bits (113), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 34/166 (20%), Positives = 77/166 (46%), Gaps = 7/166 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNP---IDLNRYVLYSNDNRELR-ILKMYRKNKR 59
           +++ V +  + TTHG+ G + +   ++NP    +L R  +  + +   R +++ +   + 
Sbjct: 1   MEQSVAIGKVVTTHGVKGGMKVQPLSDNPERIKELIRVFVEKDGHSAARDVVEAFVHGRA 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
           ++    GID+  +A EL    L     +     L E+ ++   +  ++ +   G Y G +
Sbjct: 61  WVIRLEGIDSCDAARELVGAMLTIPISERL--PLPENSYYLDQIIGLDVYTVDGTYLGSI 118

Query: 120 CGVYNFGAGSILEIKNTME-KTFLIPFTKFAVLEVNLQENKILIDP 164
             V   G+  +  ++N  + +  LIP  K  V  ++L   ++ +DP
Sbjct: 119 INVLETGSNDVYVVENKADGRQVLIPALKAVVKSIDLDTGRMEVDP 164


>gi|284032645|ref|YP_003382576.1| 16S rRNA processing protein RimM [Kribbella flavida DSM 17836]
 gi|283811938|gb|ADB33777.1| 16S rRNA processing protein RimM [Kribbella flavida DSM 17836]
          Length = 182

 Score = 48.1 bits (113), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 73/160 (45%), Gaps = 5/160 (3%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNP----IDLNRYVLYSNDNRELRILKMYRKNKRFIA 62
           LV +  IG  HG+ GEV +D   + P     D    V  +   R L +      + R + 
Sbjct: 2   LVTVGRIGRAHGIKGEVGLDVRTDEPDRRFADGATLVTDTKPPRTLTVESSRWHSGRLLV 61

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F    +  +A +LR+L L A+  + +  E  E E+++ +L  +      G+  G+V  V
Sbjct: 62  KFVESPDRTAAEQLRNLVLQAEIAEDERPEDPE-EYYDRELIGLSVRTTDGEQAGEVIDV 120

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
            +  +  +LEI+       L+P  +  V +++L E  +L+
Sbjct: 121 VHLPSQDLLEIRRPAGNAVLVPLVEQLVPKIDLDEKYVLV 160


>gi|71066572|ref|YP_265299.1| 16S rRNA processing protein RimM [Psychrobacter arcticus 273-4]
 gi|109893036|sp|Q4FQ43|RIMM_PSYA2 RecName: Full=Ribosome maturation factor rimM
 gi|71039557|gb|AAZ19865.1| 16S rRNA processing protein RimM [Psychrobacter arcticus 273-4]
          Length = 177

 Score = 48.1 bits (113), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 35/154 (22%), Positives = 77/154 (50%), Gaps = 10/154 (6%)

Query: 17  HGLNGEVYIDSYANNP---IDLNRYVLYSNDNRELRILKMYRKNKR-FIATFSGIDNIHS 72
           +G+ G +++ S  ++     D+  + + +    +   +K +R+     +A F  I + + 
Sbjct: 20  YGIKGWLWVFSETDDRTAIFDIKPWWMKTATGMKPLTVKAWRQQGTGVVAQFEQIPDRNV 79

Query: 73  ASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFGAGSILE 132
           A  +  + L+ + QD   E   EDE++ +DL  +   + Q +Y G +  ++  GA +I+ 
Sbjct: 80  AETMNGVTLWVE-QDILPEP-AEDEYYWSDLVTLRVINEQDEYLGDITEMFETGAHAIMR 137

Query: 133 IKNTME----KTFLIPFTKFAVLEVNLQENKILI 162
           +  T +    +  LIP+ K  V++V+L E  +L+
Sbjct: 138 VAATSDSLDKEERLIPWHKQTVVKVDLTEKTVLV 171


>gi|251779615|ref|ZP_04822535.1| 16S rRNA processing protein RimM [Clostridium botulinum E1 str.
           'BoNT E Beluga']
 gi|243083930|gb|EES49820.1| 16S rRNA processing protein RimM [Clostridium botulinum E1 str.
           'BoNT E Beluga']
          Length = 165

 Score = 48.1 bits (113), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 41/167 (24%), Positives = 77/167 (46%), Gaps = 14/167 (8%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-----VLYSNDNRELRILKMYRKNK 58
           ++++  +  I  THG+ GEV +        D+N++     VL   ++R ++ +K  +   
Sbjct: 1   MEEIFKIGQIVNTHGIKGEVKVYPLTE---DVNKFKKLKTVLIDGEDRNIQSVKFQK--D 55

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
           R I    GID ++ A   +   +   R +    ELE D  +  DL     +D      G+
Sbjct: 56  RVILKIEGIDTMNDAETYKQKYIEIFRSNAP--ELEADTHYIVDLIGCMVYDADNMELGK 113

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPI 165
           +  V +  +  +  IK    K  LIP  K  VL+++++  KI++ P+
Sbjct: 114 IFDVISTPSNDVYWIKQP--KELLIPVLKDIVLDIDIENKKIVVKPV 158


>gi|213964701|ref|ZP_03392901.1| 16S rRNA processing protein RimM [Corynebacterium amycolatum SK46]
 gi|213952894|gb|EEB64276.1| 16S rRNA processing protein RimM [Corynebacterium amycolatum SK46]
          Length = 169

 Score = 48.1 bits (113), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 78/164 (47%), Gaps = 13/164 (7%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNP---IDLNRYVLYSNDNRELRI-LKMYRKNK-RFI 61
           +VL+  +   HG+ GEV +D+  ++P     +   +L     RE ++ +K  R ++ R +
Sbjct: 6   MVLIGRVIKPHGVRGEVVVDATTDDPEGRFAVGTTLLGVQAGREEQLTVKTARPHQGRLL 65

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
             F  I   + A   R +K YA+   F+DE     +F++ +L  +      G   G+V  
Sbjct: 66  VRFEEIPGRNEAERHRGMKFYAE-PVFEDE-----DFYDFELVGLHVV-HNGTDIGEVTS 118

Query: 122 VYNFGAGSILEIK-NTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           +    A  +LE+  +   +  LIP  +  V EV+L+ + + I P
Sbjct: 119 IVRAPAHRLLEVTLDAGGREVLIPLVEEIVPEVDLENSTVTITP 162


>gi|313896374|ref|ZP_07829927.1| 16S rRNA processing protein RimM [Selenomonas sp. oral taxon 137
           str. F0430]
 gi|312975173|gb|EFR40635.1| 16S rRNA processing protein RimM [Selenomonas sp. oral taxon 137
           str. F0430]
          Length = 175

 Score = 48.1 bits (113), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 33/153 (21%), Positives = 62/153 (40%), Gaps = 2/153 (1%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIATFSGI 67
           +++  +G  HG+ G+V +    + P    R       +  L I++M  + K F+  F   
Sbjct: 13  IVIGRVGAPHGIAGDVRVIPLTDFPERFARLREVVVGDELLHIVRMKEQGKNFLMQFREY 72

Query: 68  DNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFGA 127
                A  L    L   R D     LEE E++  D+  +  +D  G   G V  V   G+
Sbjct: 73  PVREEAQRLTGRLLTVARTDAA--PLEEGEYYVFDIVGLSVYDEAGTLLGSVENVIRTGS 130

Query: 128 GSILEIKNTMEKTFLIPFTKFAVLEVNLQENKI 160
             +  ++    +  LIP  +  V  +++   ++
Sbjct: 131 NDVYAVRAEDGRELLIPALRSVVRNIDIAGGRM 163


>gi|188588501|ref|YP_001920593.1| 16S rRNA-processing protein RimM [Clostridium botulinum E3 str.
           Alaska E43]
 gi|238689674|sp|B2V4E4|RIMM_CLOBA RecName: Full=Ribosome maturation factor rimM
 gi|188498782|gb|ACD51918.1| 16S rRNA processing protein RimM [Clostridium botulinum E3 str.
           Alaska E43]
          Length = 165

 Score = 48.1 bits (113), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 41/167 (24%), Positives = 77/167 (46%), Gaps = 14/167 (8%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-----VLYSNDNRELRILKMYRKNK 58
           ++++  +  I  THG+ GEV +        D+N++     VL   ++R ++ +K  +   
Sbjct: 1   MEEIFKIGQIVNTHGIKGEVKVYPLTE---DVNKFKKLKTVLIDGEHRNIQSVKFQK--D 55

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
           R I    GID ++ A   +   +   R +    ELE D  +  DL     +D      G+
Sbjct: 56  RVILKIEGIDTMNDAETYKQKYIEIFRSNAP--ELEADTHYIVDLIGCMVYDADNMELGK 113

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPI 165
           +  V +  +  +  IK    K  LIP  K  VL+++++  KI++ P+
Sbjct: 114 IFDVISTPSNDVYWIKQP--KELLIPVLKDIVLDIDIENKKIVVKPV 158


>gi|227503361|ref|ZP_03933410.1| 16S rRNA-processing protein [Corynebacterium accolens ATCC 49725]
 gi|227075864|gb|EEI13827.1| 16S rRNA-processing protein [Corynebacterium accolens ATCC 49725]
          Length = 165

 Score = 48.1 bits (113), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 37/164 (22%), Positives = 71/164 (43%), Gaps = 15/164 (9%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVL-------YSNDNRELRILKMYRKNKRF 60
           +++  +  +HG+ GEV ++   + P    R+ +             EL I  +     R 
Sbjct: 3   LMIGRVIKSHGIKGEVVVEPTTDEP--EVRFAVGEKLQGRQGRKEHELTISAVRSHKGRL 60

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           + T   I +   A  LR  + +A   +  DE      F++ +LE +    R G+  G V 
Sbjct: 61  LVTCKEIADRTQADSLRGTQFFAAPLEDDDEG-----FYDHELEGLRVI-RDGEDIGAVV 114

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
            V +  +  +LE++ +   + L+PF    V EV+++     I+P
Sbjct: 115 SVVHGPSQDLLEVELSTGSSALVPFVHAIVPEVDVEAGTCTIEP 158


>gi|323702670|ref|ZP_08114331.1| 16S rRNA processing protein RimM [Desulfotomaculum nigrificans DSM
           574]
 gi|323532333|gb|EGB22211.1| 16S rRNA processing protein RimM [Desulfotomaculum nigrificans DSM
           574]
          Length = 169

 Score = 48.1 bits (113), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 34/155 (21%), Positives = 70/155 (45%), Gaps = 6/155 (3%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR----YVLYSNDNRELRILKMYRKNKRF 60
           ++ + +  I  T G+ GEV +    + P    +    ++L     R+L I + +   +  
Sbjct: 3   EEFITVGEIVNTQGIRGEVRVLPTTDFPERFKQTKKIFLLLQGQRRQLTINRAWEHKQFI 62

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           I  F  + ++  A +L+   L   R +  D  L +D ++  ++  ++  D +G+  G+V 
Sbjct: 63  ILKFDEVADMSEAEKLKGGLLQVPRTELTD--LPKDCYYIFEIVGLKVIDERGQELGKVA 120

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNL 155
            V   GA  +  +K    K  LIP  K  V ++++
Sbjct: 121 DVLRTGANDVYVVKRDQGKDILIPALKSVVKKIDV 155


>gi|269977897|ref|ZP_06184851.1| 16S rRNA processing protein RimM [Mobiluncus mulieris 28-1]
 gi|306819236|ref|ZP_07452947.1| 16S rRNA processing protein RimM [Mobiluncus mulieris ATCC 35239]
 gi|269933863|gb|EEZ90443.1| 16S rRNA processing protein RimM [Mobiluncus mulieris 28-1]
 gi|304648018|gb|EFM45332.1| 16S rRNA processing protein RimM [Mobiluncus mulieris ATCC 35239]
          Length = 196

 Score = 48.1 bits (113), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 74/175 (42%), Gaps = 20/175 (11%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSN--DNRELRILKMYRKNKRFI 61
           V +AT+G   G+ GE+ +    +NP    R+    VL ++  D   L + +     K F+
Sbjct: 3   VTVATLGRASGVRGEIRVALRTDNP--HTRFAPGAVLVTDHPDFPRLTVKQARHSGKHFV 60

Query: 62  ATFSGIDNIHSASELRDLKLY------AKRQDFKDEEL------EEDEFFNTDLEEMETF 109
           A+F  I +  +A  L  +KL       A      DE         ED F+  +L  +   
Sbjct: 61  ASFKEIPDRDTAETLGGVKLVIETDPEATNPPGPDETPGATESGSEDGFYRHELVGLSAQ 120

Query: 110 DRQGKYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
            + G+  G V  +    A  +LE+        LIPF    V EV+L   ++++ P
Sbjct: 121 TQTGESLGMVSDLIIGTAQDLLEVTTAEGHKVLIPFVFELVPEVDLAAGRVVMAP 175


>gi|291615193|ref|YP_003525350.1| 16S rRNA processing protein RimM [Sideroxydans lithotrophicus ES-1]
 gi|291585305|gb|ADE12963.1| 16S rRNA processing protein RimM [Sideroxydans lithotrophicus ES-1]
          Length = 166

 Score = 48.1 bits (113), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 39/164 (23%), Positives = 78/164 (47%), Gaps = 12/164 (7%)

Query: 7   LVLMATIGTTHGLNGEVYIDS---YANNPIDLNRYVLYSNDNRELRILKMYRKN----KR 59
           +V+M  +    G+ G V + +   Y ++ +D + +  Y  + +  R L++   N    K 
Sbjct: 1   MVVMGKVVGAQGIQGWVKVQAFTEYLDSLLDYSTW--YVGNEQSWRPLEVLEANVHGGKV 58

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            IA   GI +  +A + + L +   R    +++  E E++ +DL  +   +  G+ +G V
Sbjct: 59  LIAKLQGIVDRTAAEKCKGLLIAVPRDSLPEQQ--EGEYYWSDLIGLSVENLAGEKFGTV 116

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
             +   GA  +L +K    +T L+PF    + +V+LQ   I +D
Sbjct: 117 DSLLETGANDVLVVKGEGGET-LMPFIASVIRQVDLQNKLIRVD 159


>gi|320530765|ref|ZP_08031809.1| 16S rRNA processing protein RimM [Selenomonas artemidis F0399]
 gi|320137052|gb|EFW28990.1| 16S rRNA processing protein RimM [Selenomonas artemidis F0399]
          Length = 175

 Score = 48.1 bits (113), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 33/153 (21%), Positives = 62/153 (40%), Gaps = 2/153 (1%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIATFSGI 67
           +++  +G  HG+ G+V +    + P    R       +  L I++M  + K F+  F   
Sbjct: 13  IVIGRVGAPHGIAGDVRVIPLTDFPERFARLREVVVGDELLHIVRMKEQGKNFLMQFREY 72

Query: 68  DNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFGA 127
                A  L    L   R D     LEE E++  D+  +  +D+ G   G V  V   G+
Sbjct: 73  PVREEAQRLTGRLLTVARTDAA--PLEEGEYYVFDIVGLSVYDKAGTLLGSVENVIRTGS 130

Query: 128 GSILEIKNTMEKTFLIPFTKFAVLEVNLQENKI 160
             +  ++    +  LIP     V  +++   ++
Sbjct: 131 NDVYAVRAEDGRELLIPALHSVVRNIDIAGGRM 163


>gi|152976208|ref|YP_001375725.1| 16S rRNA-processing protein [Bacillus cereus subsp. cytotoxis NVH
           391-98]
 gi|189040125|sp|A7GRH2|RIMM_BACCN RecName: Full=Ribosome maturation factor rimM
 gi|152024960|gb|ABS22730.1| 16S rRNA processing protein RimM [Bacillus cytotoxicus NVH 391-98]
          Length = 171

 Score = 48.1 bits (113), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 38/160 (23%), Positives = 74/160 (46%), Gaps = 9/160 (5%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDL----NRYVLYSNDNRELRILKM--YRKNKRF-IA 62
           +  I  THG+ GEV + S  + P +     N   ++     E   +K+  +R++K F + 
Sbjct: 7   VGKIVNTHGVRGEVRVISRTDFPEERYKVGNTLYIWGEKGTEPLPVKVTSHRQHKTFDLL 66

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
           TF G  N++   + +   L    +     EL E E++  ++   +     G+  G +  +
Sbjct: 67  TFEGYSNVNEVEKFKGSLLKVPEEQLG--ELAEGEYYYHEVIGCKVVTENGEELGTITEI 124

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
            + GA  +  IK    +  LIP+    VL+VN+++ ++ I
Sbjct: 125 LSPGANDVWVIKRPKGQDLLIPYIDDIVLQVNVEQKQVTI 164


>gi|94270959|ref|ZP_01291860.1| 16S rRNA processing protein RimM [delta proteobacterium MLMS-1]
 gi|93450603|gb|EAT01724.1| 16S rRNA processing protein RimM [delta proteobacterium MLMS-1]
          Length = 184

 Score = 48.1 bits (113), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 34/145 (23%), Positives = 56/145 (38%), Gaps = 7/145 (4%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRE----LRILKMYRKNKR 59
           D L+ +  +    G+ GE+ I  Y+  P D   Y  L+  D         +L        
Sbjct: 12  DDLLAVGRVVKPQGIKGEIKIVPYSGRPADFREYHRLWPADGEAPGGGWELLATRESGGA 71

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            IA  +GI +  +A  LR   L  + +D         E +   L+ +   D QG+  G V
Sbjct: 72  VIARLAGIADRDAAEALRGRPLAIRSRDLPPA--PAGELYWHQLQGLPARDEQGREIGTV 129

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIP 144
            G+    A   + I +   +  L+P
Sbjct: 130 VGLLATPARPTMVIADGAGREILVP 154


>gi|330872810|gb|EGH06959.1| 16S rRNA-processing protein RimM [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 179

 Score = 48.1 bits (113), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 33/168 (19%), Positives = 83/168 (49%), Gaps = 11/168 (6%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYAN---NPIDLNRYVLYSNDN--RELRILKMYRKNKR 59
           D L+++  I + HG+ GEV + S+ +   N +D   + L    +  +++ ++    ++K 
Sbjct: 9   DDLIVIGKIYSVHGVRGEVKVYSFTDPIGNLLDYKTWTLRREGSVEKQVELVSGRLQSKF 68

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +     +D+   A  L   ++   R  F D  L++ E++   LE ++  D+ G+  G++
Sbjct: 69  LVVKLKDLDDREEARLLSGYEICVPRNLFPD--LDDGEYYWYQLEGLKVIDQLGQLLGKI 126

Query: 120 CGVYNFGAGSILEIKNTM----EKTFLIPFTKFAVLEVNLQENKILID 163
             +   G+  ++ +K       ++  L+P+T+  VL +++   ++ ++
Sbjct: 127 DHLLETGSNDVMVVKPCAGSLDDRERLLPYTEQCVLAIDMAAGEMKVE 174


>gi|300811726|ref|ZP_07092200.1| 16S rRNA processing protein RimM [Lactobacillus delbrueckii subsp.
           bulgaricus PB2003/044-T3-4]
 gi|300497302|gb|EFK32350.1| 16S rRNA processing protein RimM [Lactobacillus delbrueckii subsp.
           bulgaricus PB2003/044-T3-4]
          Length = 167

 Score = 48.1 bits (113), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 37/158 (23%), Positives = 76/158 (48%), Gaps = 6/158 (3%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNRY---VLYSNDNRELRILKMYRKNKRFIATFSG 66
           +  I  THGL GEV +    + P D  R    +   +D+RE+ +       + ++ TF+ 
Sbjct: 6   VGKIIATHGLKGEVKVALTTDFPEDRFRTGSRLYLGDDSREVTVAAGRPFKQFWLVTFAE 65

Query: 67  IDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQ-GKYWGQVCGVYNF 125
           I +I  A +L+  ++    +D    EL +  ++  DL   +  D + G+  G++  +   
Sbjct: 66  ITDIDQAKKLKGTEILISEED--QGELPDGVYYYRDLLGCKVLDDESGEEIGELTDIEAP 123

Query: 126 GAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
           GA  I E+ +   K+F +P+    V  V++ + ++ ++
Sbjct: 124 GANDIWEVTDEDGKSFWLPYIPQVVKSVDIDKKEVRVE 161


>gi|294339610|emb|CAZ87969.1| putative 16S rRNA processing protein RimM [Thiomonas sp. 3As]
          Length = 180

 Score = 48.1 bits (113), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 40/174 (22%), Positives = 72/174 (41%), Gaps = 15/174 (8%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR---YVL----YSNDNRELRILKM 53
           M   D L L+  I    G+ G V +   A     L +   + L    + N+   + +  +
Sbjct: 1   MAIPDNLYLVGHILDAWGVRGWVKVAPDAPQATALLKSKTWWLSRPGFENEPTPIAVRLV 60

Query: 54  YRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQG 113
            R     +A   G ++   A  LR  ++  +R DF   +  E EF+  DL   E    +G
Sbjct: 61  RRHGSALVALLEGPEDRSGAEALRGRQIAVRRADFPPPD--EGEFYWADLIGCEVRSPEG 118

Query: 114 KYWGQVCGVYNFGAGSILEIK------NTMEKTFLIPFTKFAVLEVNLQENKIL 161
              G+V G+    A ++L ++      +   +  LIPF +  ++ V+L    I+
Sbjct: 119 ADLGRVIGLMESAAHAVLRVQIPQASADAKPRERLIPFVEAYIVSVDLPAKTII 172


>gi|296135504|ref|YP_003642746.1| 16S rRNA processing protein RimM [Thiomonas intermedia K12]
 gi|295795626|gb|ADG30416.1| 16S rRNA processing protein RimM [Thiomonas intermedia K12]
          Length = 180

 Score = 47.8 bits (112), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 40/174 (22%), Positives = 72/174 (41%), Gaps = 15/174 (8%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR---YVL----YSNDNRELRILKM 53
           M   D L L+  I    G+ G V +   A     L +   + L    + N+   + +  +
Sbjct: 1   MAIPDDLYLVGHILDAWGVRGWVKVAPDAPQATALLKSKTWWLSRPGFENEPTPIAVRLV 60

Query: 54  YRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQG 113
            R     +A   G ++   A  LR  ++  +R DF   +  E EF+  DL   E    +G
Sbjct: 61  RRHGSALVALLEGPEDRSGAEALRGRQIAVRRADFPPPD--EGEFYWADLIGCEVRSPEG 118

Query: 114 KYWGQVCGVYNFGAGSILEIK------NTMEKTFLIPFTKFAVLEVNLQENKIL 161
              G+V G+    A ++L ++      +   +  LIPF +  ++ V+L    I+
Sbjct: 119 ADLGRVIGLMESAAHAVLRVQIPQASADAKPRERLIPFVEAYIVSVDLPAKTII 172


>gi|227875956|ref|ZP_03994079.1| 16S rRNA processing protein RimM [Mobiluncus mulieris ATCC 35243]
 gi|227843488|gb|EEJ53674.1| 16S rRNA processing protein RimM [Mobiluncus mulieris ATCC 35243]
          Length = 196

 Score = 47.8 bits (112), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 74/175 (42%), Gaps = 20/175 (11%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSN--DNRELRILKMYRKNKRFI 61
           V +AT+G   G+ GE+ +    +NP    R+    VL ++  D   L + +     K F+
Sbjct: 3   VTVATLGRASGVRGEIRVALRTDNP--HTRFAPGAVLVTDHPDFPRLTVKQARHSGKHFV 60

Query: 62  ATFSGIDNIHSASELRDLKLY------AKRQDFKDEEL------EEDEFFNTDLEEMETF 109
           A+F  I +  +A  L  +KL       A      DE         ED F+  +L  +   
Sbjct: 61  ASFKEIPDRDTAETLGGVKLVIETDPEATNPPGPDETPGATESGSEDGFYRHELVGLSAQ 120

Query: 110 DRQGKYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
            + G+  G V  +    A  +LE+        LIPF    V EV+L   ++++ P
Sbjct: 121 TQTGESLGMVSDLIIGTAQDLLEVTTADGHKVLIPFVFELVPEVDLAAGRVVMAP 175


>gi|295693162|ref|YP_003601772.1| ribosome maturation factor rimm [Lactobacillus crispatus ST1]
 gi|295031268|emb|CBL50747.1| Ribosome maturation factor rimM [Lactobacillus crispatus ST1]
          Length = 171

 Score = 47.8 bits (112), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 74/159 (46%), Gaps = 7/159 (4%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPID---LNRYVLYSNDNRELRILKMYRKNKRF-IATFS 65
           +A I TTHGLNGEV +    + P D   +  ++    +  ++  +   R  K+F +  F+
Sbjct: 6   VARILTTHGLNGEVKVSVITDFPEDRFAIGMHLAIKGETSQVLTVAKSRPFKQFWLVQFA 65

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQ-GKYWGQVCGVYN 124
            I +I  A +L+   L     D    EL E  ++  D+ + +  D + GK  G++  + +
Sbjct: 66  EITDIDQAEKLKGKILVVSEADRG--ELPEGVYYYKDIFDCDVIDEESGKRLGKITDIES 123

Query: 125 FGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
            GA  I  +     K + IP     V +V++   K+ ++
Sbjct: 124 PGANDIWLVHEDNGKEYWIPNIASVVKKVDVANKKVYVE 162


>gi|116490847|ref|YP_810391.1| 16S rRNA processing protein RimM [Oenococcus oeni PSU-1]
 gi|290890293|ref|ZP_06553372.1| hypothetical protein AWRIB429_0762 [Oenococcus oeni AWRIB429]
 gi|122276971|sp|Q04FP6|RIMM_OENOB RecName: Full=Ribosome maturation factor rimM
 gi|116091572|gb|ABJ56726.1| 16S rRNA processing protein RimM [Oenococcus oeni PSU-1]
 gi|290480079|gb|EFD88724.1| hypothetical protein AWRIB429_0762 [Oenococcus oeni AWRIB429]
          Length = 166

 Score = 47.8 bits (112), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 74/152 (48%), Gaps = 9/152 (5%)

Query: 16  THGLNGEVYIDSYANNP---IDLNRYVLYSNDNRELRILKMYRKNKRF-IATFSGIDNIH 71
           THG+ GE+ ID   + P      N  +L +    E  +++  R  K+F +  FS  +NI+
Sbjct: 12  THGIAGELKIDFNTDFPEQRFAKNSELLIAG---EKLVVQSSRPFKQFWLVKFSDHENIN 68

Query: 72  SASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFGAGSIL 131
              + +   ++   +  K+  L E EF  + +  ++  D +G   G++   ++ GA  + 
Sbjct: 69  LVEKYKGEDIFINER--KEPRLSEGEFLVSQIIGLKVIDEKGNSIGEIADSFHTGANDVW 126

Query: 132 EIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
            IK +  K  LIP+    V +V+LQ + + I+
Sbjct: 127 TIKKSNGKEILIPYIDQVVKKVDLQTSTVTIE 158


>gi|254821201|ref|ZP_05226202.1| 16S rRNA-processing protein RimM [Mycobacterium intracellulare ATCC
           13950]
          Length = 171

 Score = 47.8 bits (112), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 62/156 (39%), Gaps = 9/156 (5%)

Query: 16  THGLNGEVYIDSYANNPID-------LNRYVLYSNDNRELRILKMYRKNKRFIATFSGID 68
            HG+ GE+ ++   ++P         L          R+  +        R +   +GI 
Sbjct: 11  AHGIGGEIVVEIRTDDPDARFATGNALRGKASRGGGERDFVVESAREHGGRLLVRLAGIS 70

Query: 69  NIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFGAG 128
           +  +A  LR         D    + E D +++ +LE +      G+  G V  V +  AG
Sbjct: 71  DRDAADALRGTLFVVDSDDLPPID-EADTYYDHELEGLHVRTITGRDVGVVAEVLHTAAG 129

Query: 129 SILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
            +L ++    +  L+PF    V  V+L +  I IDP
Sbjct: 130 ELLAVRRESGEA-LVPFVTAIVTSVSLDDGTIEIDP 164


>gi|307700242|ref|ZP_07637283.1| 16S rRNA processing protein RimM [Mobiluncus mulieris FB024-16]
 gi|307614624|gb|EFN93852.1| 16S rRNA processing protein RimM [Mobiluncus mulieris FB024-16]
          Length = 196

 Score = 47.8 bits (112), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 74/175 (42%), Gaps = 20/175 (11%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSN--DNRELRILKMYRKNKRFI 61
           V +AT+G   G+ GE+ +    +NP    R+    VL ++  D   L + +     K F+
Sbjct: 3   VTVATLGRASGVRGEIRVALRTDNP--HTRFAPGAVLVTDHPDFPRLTVKQARHSGKHFV 60

Query: 62  ATFSGIDNIHSASELRDLKLY------AKRQDFKDEEL------EEDEFFNTDLEEMETF 109
           A+F  I +  +A  L  +KL       A      DE         ED F+  +L  +   
Sbjct: 61  ASFKEIPDRDTAETLGGVKLVIETDPEATNPPGSDETPGATESGSEDGFYRHELVGLSAQ 120

Query: 110 DRQGKYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
            + G+  G V  +    A  +LE+        LIPF    V EV+L   ++++ P
Sbjct: 121 TQTGESLGMVSDLIIGTAQDLLEVTTADGHKVLIPFVFELVPEVDLAAGRVVMAP 175


>gi|221632147|ref|YP_002521368.1| 16S rRNA processing protein RimM [Thermomicrobium roseum DSM 5159]
 gi|221155506|gb|ACM04633.1| 16S rRNA processing protein RimM [Thermomicrobium roseum DSM 5159]
          Length = 184

 Score = 47.8 bits (112), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 33/162 (20%), Positives = 71/162 (43%), Gaps = 5/162 (3%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNP--IDLNRYVLYSNDNRELRILKMYRKNKRFIA 62
           ++L +   +G  HG+ G V +  + + P  I    YV    +    R+L+   +      
Sbjct: 19  ERLSIGRIVGA-HGVRGTVKLKIWTHFPERIPHLEYVYLGEEPTPRRLLRARVQGDLAFL 77

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
              GI   + A  +R + +   R   +   L EDE++  ++  ++  D  G   G+V  +
Sbjct: 78  QLEGITTRNEAEAMRGVVVRIDRS--QAAPLGEDEYYQFEILGLQVVDEAGNVLGRVIEI 135

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
              GA  +  ++       L+P  +  +L V+L++ ++++ P
Sbjct: 136 LETGANDVYVVQRPDGSELLLPAIRSVILAVDLEQQRLVVRP 177


>gi|206972753|ref|ZP_03233683.1| 16S rRNA processing protein RimM [Bacillus cereus AH1134]
 gi|218235147|ref|YP_002368643.1| 16S rRNA-processing protein RimM [Bacillus cereus B4264]
 gi|228922596|ref|ZP_04085896.1| Ribosome maturation factor rimM [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228954118|ref|ZP_04116147.1| Ribosome maturation factor rimM [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
 gi|228960058|ref|ZP_04121722.1| Ribosome maturation factor rimM [Bacillus thuringiensis serovar
           pakistani str. T13001]
 gi|229047529|ref|ZP_04193119.1| Ribosome maturation factor rimM [Bacillus cereus AH676]
 gi|229071340|ref|ZP_04204563.1| Ribosome maturation factor rimM [Bacillus cereus F65185]
 gi|229081097|ref|ZP_04213607.1| Ribosome maturation factor rimM [Bacillus cereus Rock4-2]
 gi|229111313|ref|ZP_04240866.1| Ribosome maturation factor rimM [Bacillus cereus Rock1-15]
 gi|229129118|ref|ZP_04258091.1| Ribosome maturation factor rimM [Bacillus cereus BDRD-Cer4]
 gi|229146413|ref|ZP_04274784.1| Ribosome maturation factor rimM [Bacillus cereus BDRD-ST24]
 gi|229152041|ref|ZP_04280236.1| Ribosome maturation factor rimM [Bacillus cereus m1550]
 gi|229180118|ref|ZP_04307462.1| Ribosome maturation factor rimM [Bacillus cereus 172560W]
 gi|229192011|ref|ZP_04318981.1| Ribosome maturation factor rimM [Bacillus cereus ATCC 10876]
 gi|296504337|ref|YP_003666037.1| 16S rRNA-processing protein [Bacillus thuringiensis BMB171]
 gi|33301480|sp|Q819W5|RIMM_BACCR RecName: Full=Ribosome maturation factor rimM
 gi|226694909|sp|B7HDW5|RIMM_BACC4 RecName: Full=Ribosome maturation factor rimM
 gi|206732318|gb|EDZ49510.1| 16S rRNA processing protein RimM [Bacillus cereus AH1134]
 gi|218163104|gb|ACK63096.1| 16S rRNA processing protein RimM [Bacillus cereus B4264]
 gi|228591562|gb|EEK49411.1| Ribosome maturation factor rimM [Bacillus cereus ATCC 10876]
 gi|228603327|gb|EEK60804.1| Ribosome maturation factor rimM [Bacillus cereus 172560W]
 gi|228631390|gb|EEK88024.1| Ribosome maturation factor rimM [Bacillus cereus m1550]
 gi|228637046|gb|EEK93505.1| Ribosome maturation factor rimM [Bacillus cereus BDRD-ST24]
 gi|228654355|gb|EEL10220.1| Ribosome maturation factor rimM [Bacillus cereus BDRD-Cer4]
 gi|228672089|gb|EEL27380.1| Ribosome maturation factor rimM [Bacillus cereus Rock1-15]
 gi|228702141|gb|EEL54617.1| Ribosome maturation factor rimM [Bacillus cereus Rock4-2]
 gi|228711794|gb|EEL63746.1| Ribosome maturation factor rimM [Bacillus cereus F65185]
 gi|228723776|gb|EEL75131.1| Ribosome maturation factor rimM [Bacillus cereus AH676]
 gi|228799574|gb|EEM46527.1| Ribosome maturation factor rimM [Bacillus thuringiensis serovar
           pakistani str. T13001]
 gi|228805684|gb|EEM52274.1| Ribosome maturation factor rimM [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
 gi|228837025|gb|EEM82366.1| Ribosome maturation factor rimM [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|296325389|gb|ADH08317.1| 16S rRNA-processing protein [Bacillus thuringiensis BMB171]
          Length = 171

 Score = 47.8 bits (112), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 79/169 (46%), Gaps = 14/169 (8%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNRELRILKM----YRKNKRF- 60
           +  I  THG+ GE+ + S  + P +  RY     LY ++ +    L +    +R++K F 
Sbjct: 7   VGKIVNTHGVRGEIRVISRTDFPEE--RYKVGNTLYISNEKGTDYLPVKVTSHRQHKTFD 64

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           + TF G +N+    + +   +    +     EL E E++  ++        +G+  G + 
Sbjct: 65  LLTFEGYNNVDEVEKFKGSLIKVPEEQLG--ELAEGEYYYHEIIGCSVVTEEGEALGTIK 122

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
            + + GA  +  IK    +  LIP+    VL+VN+ ENK++   +  GL
Sbjct: 123 EILSPGANDVWVIKRPKGQDLLIPYIDDVVLQVNI-ENKLVTIHVMEGL 170


>gi|302542207|ref|ZP_07294549.1| 16S rRNA processing protein RimM [Streptomyces hygroscopicus ATCC
           53653]
 gi|302459825|gb|EFL22918.1| 16S rRNA processing protein RimM [Streptomyces himastatinicus ATCC
           53653]
          Length = 191

 Score = 47.8 bits (112), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 37/161 (22%), Positives = 77/161 (47%), Gaps = 5/161 (3%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNP-IDLNRYVLYSNDNRE---LRILKMYRKNKRFIAT 63
           +++A IG  HG+ GEV ++   + P + L    + + +      L I      + R +  
Sbjct: 11  LVVARIGRAHGIKGEVTVEVRTDEPELRLGPGAVLATEPASAGPLTIETGRVHSGRLLLR 70

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F G+ +   A  LR++ L A+  D ++   + +EF++  L +++     G   G++  + 
Sbjct: 71  FEGVRDRTGAEALRNVLLIAE-VDPEEVPEDPEEFYDHQLIDLDVVTVDGTAVGRISEIS 129

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           +     +L +K       +IPF    V E++L+E + ++DP
Sbjct: 130 HLPYQDLLIVKRPDGGEVMIPFVSEMVPEIDLEEQRAVVDP 170


>gi|225620955|ref|YP_002722213.1| putative RimM protein, required for 16S processing [Brachyspira
           hyodysenteriae WA1]
 gi|225215775|gb|ACN84509.1| putative RimM protein, required for 16S processing [Brachyspira
           hyodysenteriae WA1]
          Length = 168

 Score = 47.8 bits (112), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 65/146 (44%), Gaps = 7/146 (4%)

Query: 7   LVLMATIGTTHGLNGEVYI----DSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIA 62
           ++  A I   HGL GEV +     SY  +   L++      +N+   +L + +KNK F+ 
Sbjct: 1   MIFYAKITGLHGLKGEVEMAFTDKSYFTSLPVLSKNTPVIINNQTFTLLNVKKKNKSFVF 60

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
               I+ I  A +L  L ++          L++D F+  +L   +  D     +G++  V
Sbjct: 61  QLKDINTIDQAEKLIGLDIFIDSSHL--PILDDDTFYEAELIGYKIIDTDNNVYGEITDV 118

Query: 123 YNFGAGSILEIKNTMEKTFL-IPFTK 147
           Y+  +  + EIK       + IPF K
Sbjct: 119 YSLPSNYVFEIKLKENNNIVSIPFVK 144


>gi|217967917|ref|YP_002353423.1| 16S rRNA processing protein RimM [Dictyoglomus turgidum DSM 6724]
 gi|217337016|gb|ACK42809.1| 16S rRNA processing protein RimM [Dictyoglomus turgidum DSM 6724]
          Length = 166

 Score = 47.8 bits (112), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 38/163 (23%), Positives = 78/163 (47%), Gaps = 10/163 (6%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNR----YVLYSND---NRELRILKMYRKNKR 59
           +V +A +G   G+ G + I  + +    L +    Y+ + +     REL +  +   NK 
Sbjct: 1   MVRIAKLGEPFGIKGGIKIWPFFDLIDTLKKGQKIYLSWGDTLLVRRELSLENIREHNKG 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
           ++  FS I+    A ++R   L  + +D    +L E +++   +  +  ++  G+Y G+V
Sbjct: 61  YVIYFSEIETREDAEKIRGNWLLIEEEDLP--KLPEGQYYTYQIMGLSVYEESGEYLGKV 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
             +   G+  +  ++   E  + IP  K  ++E+NL E KI+I
Sbjct: 119 KEILETGSNDVYIVEGEDEDIY-IPAIKDVIVEINLDEGKIII 160


>gi|145588705|ref|YP_001155302.1| 16S rRNA processing protein RimM [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
 gi|209573589|sp|A4SW74|RIMM_POLSQ RecName: Full=Ribosome maturation factor rimM
 gi|145047111|gb|ABP33738.1| 16S rRNA processing protein RimM [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
          Length = 188

 Score = 47.8 bits (112), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 78/179 (43%), Gaps = 26/179 (14%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDL--NRYVLYSNDNR--------------- 46
           LD L+ +  I    GL G+V +  ++ +P+ L  ++ V  S   R               
Sbjct: 6   LDNLIELGAISEAQGLQGQVKVRPHSPDPVALLSSKVVWLSLLPRRSAGALSSTEEATLT 65

Query: 47  --ELRILKMYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLE 104
             +++  KM+  N   + T  G+ +   A  L+  ++   R  F   + E D ++  DL 
Sbjct: 66  QYKVKSAKMHSGN--VVLTLDGVSDRDQALALKGARILLDRDAFP--KAESDSYYWVDLI 121

Query: 105 EMETFDRQGKYWGQVCGVYNFGAGSILEIKNTMEKT--FLIPFTKFAVLEVNLQENKIL 161
             +  + Q +  G V  V   GA  ++ I +   KT  +L+PF K  V  V+L  NK+L
Sbjct: 122 GCKAKNLQDEILGDVIDVTENGAHGVIAIGDISTKTIQYLVPFVKEVVRNVDL-PNKLL 179


>gi|227551891|ref|ZP_03981940.1| 16S rRNA processing protein RimM [Enterococcus faecium TX1330]
 gi|257895518|ref|ZP_05675171.1| ribosome maturation factor rimM [Enterococcus faecium Com12]
 gi|293378383|ref|ZP_06624552.1| 16S rRNA processing protein RimM [Enterococcus faecium PC4.1]
 gi|293570324|ref|ZP_06681384.1| 16S rRNA processing protein RimM [Enterococcus faecium E980]
 gi|227178963|gb|EEI59935.1| 16S rRNA processing protein RimM [Enterococcus faecium TX1330]
 gi|257832083|gb|EEV58504.1| ribosome maturation factor rimM [Enterococcus faecium Com12]
 gi|291609603|gb|EFF38865.1| 16S rRNA processing protein RimM [Enterococcus faecium E980]
 gi|292643247|gb|EFF61388.1| 16S rRNA processing protein RimM [Enterococcus faecium PC4.1]
          Length = 174

 Score = 47.8 bits (112), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 81/168 (48%), Gaps = 13/168 (7%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNRY------VLYSNDNRELRI-LKMYRKNKRF-I 61
           +  I  T G+ GEV + S  + P +  RY       L+ +    + + +K +RK+K F +
Sbjct: 7   VGKIVNTQGIKGEVRVISTTDFPEE--RYKKGTVLTLFQDGKAPIELTVKSHRKHKNFDL 64

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
            +F G  +I+   + RD  L   + +  D  L+E+EF+  ++  +   +  G   G+V  
Sbjct: 65  LSFEGHPSINDVEKYRDGILKVSKDNSVD--LDENEFYYHEIIGLRVVEEDGTELGKVKE 122

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           + + GA  +  ++   +   L+P+    V EV+L+   I ++ I  GL
Sbjct: 123 ILSPGANDVWVVQRPKKADILLPYIASVVKEVDLEAGVIRVE-IPEGL 169


>gi|318056566|ref|ZP_07975289.1| 16S rRNA-processing protein RimM [Streptomyces sp. SA3_actG]
 gi|318077468|ref|ZP_07984800.1| 16S rRNA-processing protein RimM [Streptomyces sp. SA3_actF]
          Length = 235

 Score = 47.4 bits (111), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 37/161 (22%), Positives = 78/161 (48%), Gaps = 5/161 (3%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNP-IDLNRYVLYSNDNR---ELRILKMYRKNKRFIAT 63
           +++A IG  HG+ GEV ++   + P + L    + + D      L I +    + R +  
Sbjct: 3   LVVARIGRAHGIKGEVTVEVRTDEPELRLPPGAVLATDPPGAGPLTIEQGRVHSGRLLLR 62

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F+G+ +  +A  LR+  L A+    +  E  E EF++  L +++     G+  G++  + 
Sbjct: 63  FAGVKDRTAAEALRNTLLIAEIDPEEVPEDPE-EFYDYQLMDLDVVTEDGQEIGRITEIS 121

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           +  +  +  ++       +IPF +  V E++L E + +I+P
Sbjct: 122 HLPSQDLFIVERPDGSEVMIPFVEEIVTEIDLDEQRAVINP 162


>gi|326791388|ref|YP_004309209.1| 16S rRNA processing protein RimM [Clostridium lentocellum DSM 5427]
 gi|326542152|gb|ADZ84011.1| 16S rRNA processing protein RimM [Clostridium lentocellum DSM 5427]
          Length = 173

 Score = 47.4 bits (111), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 83/170 (48%), Gaps = 19/170 (11%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNP--------IDLNRYVLYSNDNRELRILKMYR 55
           ++++ ++  I  THG+ GE+ +    ++P        I + R  L S + + +R    Y 
Sbjct: 1   MNEMFIVGKIVNTHGVKGELKVMPSTDDPTRFEQLKEIYVERKKLESYEIQSVR----YH 56

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEME--TFDRQG 113
           K    +    GID++ +A   +   L   R+D     LEEDE++  DL  M+  T+D + 
Sbjct: 57  KG-MVLLKLKGIDDMTTAELFKGALLKIDRKD--SLPLEEDEYYIADLYGMQVYTYDEE- 112

Query: 114 KYWGQVCGVYNFGAGSILEI-KNTMEKTFLIPFTKFAVLEVNLQENKILI 162
           +Y G++  V   G+  +  + K    K  L+P  K  +  V++++NK+ +
Sbjct: 113 RYLGEIVDVIYTGSNDVYAVRKEDRAKDLLLPAIKQVIKSVDVKQNKMHV 162


>gi|22298609|ref|NP_681856.1| 16S rRNA-processing protein [Thermosynechococcus elongatus BP-1]
 gi|32129963|sp|Q8DK05|RIMM_THEEB RecName: Full=Ribosome maturation factor rimM
 gi|22294789|dbj|BAC08618.1| tlr1065 [Thermosynechococcus elongatus BP-1]
          Length = 183

 Score = 47.4 bits (111), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 39/175 (22%), Positives = 78/175 (44%), Gaps = 17/175 (9%)

Query: 3   KLDKLVLMATIGTTHGLNGEVYIDSYANNP----IDLNRYVLYSNDNRELRIL----KMY 54
           ++ + + +  I   HGL GEV +  +++ P    +   R++      +   +     +  
Sbjct: 7   EVSEWLCIGQIVGAHGLRGEVKVKPFSDFPERFTVPGCRWLRSPRQPQPYAVTLLRGRFL 66

Query: 55  RKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGK 114
            + ++F+ TF+ I +  +A  L+  ++     D     L  +E+   DL  +  +  QG+
Sbjct: 67  PRAEQFVVTFAEISDRTAAEALKGAEILVPASD--RPPLAANEYHLMDLIGLAVY-HQGE 123

Query: 115 YWGQVCGVYNFGAGSILEIK-----NTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
             G+V G+ N G   +LE++         ++  IPF    V  V+L   +I IDP
Sbjct: 124 RVGEVVGLVNAG-NDLLEVQLLDPAPKAPQSVYIPFVPAIVPVVDLAARRIEIDP 177


>gi|312793160|ref|YP_004026083.1| 16S rRNA processing protein rimm [Caldicellulosiruptor
           kristjanssonii 177R1B]
 gi|312180300|gb|ADQ40470.1| 16S rRNA processing protein RimM [Caldicellulosiruptor
           kristjanssonii 177R1B]
          Length = 169

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 81/171 (47%), Gaps = 6/171 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNP---IDLNRYVLYSNDNRELRILKMYRKNKRF 60
           + K + +  I  T GL GEV +    +      +L   +L  N + +L I +   K+   
Sbjct: 1   MHKYLQVGKIVNTFGLKGEVKVIPLTDEVDRFSELEYVLLEDNLSTKLTIERYRVKDNIV 60

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           I  F  I +I  A +L++  +  +R+  K  +L ED +F  D+  +E +D  G+  G++ 
Sbjct: 61  IIKFKEISSIDEAQKLKNRYIVIERERAK--KLPEDTYFICDIIGLEVYDLDGRKLGRIK 118

Query: 121 GVYNFGAGSILEIKNTM-EKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
            V   G+  +    + + +K  LIP  K  V EVN++E  + I  +   L+
Sbjct: 119 DVLKTGSNDVYICDSYIGKKDILIPALKDIVKEVNIEEGYMKIKVVEGLLD 169


>gi|333024168|ref|ZP_08452232.1| putative 16S rRNA-processing protein RimM [Streptomyces sp. Tu6071]
 gi|332744020|gb|EGJ74461.1| putative 16S rRNA-processing protein RimM [Streptomyces sp. Tu6071]
          Length = 236

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/161 (22%), Positives = 78/161 (48%), Gaps = 5/161 (3%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNP-IDLNRYVLYSNDNR---ELRILKMYRKNKRFIAT 63
           +++A IG  HG+ GEV ++   + P + L    + + D      L I +    + R +  
Sbjct: 3   LVVARIGRAHGIKGEVTVEVRTDEPELRLPPGAVLATDPPGAGPLTIEQGRVHSGRLLLR 62

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F+G+ +  +A  LR+  L A+    +  E  E EF++  L +++     G+  G++  + 
Sbjct: 63  FAGVKDRTAAEALRNTLLIAEIDPEEVPEDPE-EFYDYQLMDLDVVTEDGQEVGRITEIS 121

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           +  +  +  ++       +IPF +  V E++L E + +I+P
Sbjct: 122 HLPSQDLFIVERPDGSEVMIPFVEEIVTEIDLDEQRAVINP 162


>gi|26988196|ref|NP_743621.1| 16S rRNA-processing protein RimM [Pseudomonas putida KT2440]
 gi|37999637|sp|Q88MV5|RIMM_PSEPK RecName: Full=Ribosome maturation factor rimM
 gi|24982933|gb|AAN67085.1|AE016337_8 16S rRNA processing protein RimM [Pseudomonas putida KT2440]
 gi|313500312|gb|ADR61678.1| RimM [Pseudomonas putida BIRD-1]
          Length = 178

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/162 (21%), Positives = 78/162 (48%), Gaps = 10/162 (6%)

Query: 3   KLDKLVLMATIGTTHGLNGEVYIDSYAN---NPIDLNRYVL-YSNDNRELRILKMYRKNK 58
           K D L+++  I + HG+ GEV + S+ +   N +D  R+ L +    +++ ++      K
Sbjct: 7   KADDLIVVGKIFSVHGVRGEVKVYSFTDPIENLLDYPRWTLRHEGKVKQVELVSGRGSQK 66

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
             +    G+D+   A  L   ++   R    +  L  DE++   L  ++  ++  + +G+
Sbjct: 67  GLVVKLKGLDDRDEARLLSGYEICIPRSLLPN--LAADEYYWYQLVGLKVINQDEQLFGK 124

Query: 119 VCGVYNFGAGSILEIKNTM----EKTFLIPFTKFAVLEVNLQ 156
           V  +   GA  ++ +K       ++  L+P+T+  VL ++L+
Sbjct: 125 VDHLLETGANDVMVVKPCAGSLDDRERLLPYTEQCVLAIDLE 166


>gi|282855358|ref|ZP_06264684.1| 16S rRNA processing protein RimM [Pyramidobacter piscolens W5455]
 gi|282586819|gb|EFB92061.1| 16S rRNA processing protein RimM [Pyramidobacter piscolens W5455]
          Length = 175

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 71/164 (43%), Gaps = 13/164 (7%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNP---IDLNRYVLYSNDNR--ELRILKMYRKNKR--F 60
           V++  +  THGL GE+ I    + P    ++     Y +       R+  M     R  F
Sbjct: 7   VVVGQVQGTHGLRGEIKIRPLTDFPERFFEMESLSFYRDGKHAGSYRVTGMRDALTRGCF 66

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEE--LEEDEFFNTDLEEMETFDRQGKYWGQ 118
           +A   G++ I  A  LR   +    +   DE   L   EF+ +DL  +E  D +G   G 
Sbjct: 67  LAALEGVETIEQAELLRGCSV----EIAPDERVPLAPGEFWISDLIGLEACDDRGSKLGV 122

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
           V  + + GA  ++ +++   K  LIP     +L  +L+  ++ +
Sbjct: 123 VKDIVDSGASQLVVVRDDGGKDHLIPAAPEFLLGADLEARRVTL 166


>gi|256843366|ref|ZP_05548854.1| 16S rRNA processing protein RimM [Lactobacillus crispatus
           125-2-CHN]
 gi|293381188|ref|ZP_06627196.1| 16S rRNA processing protein RimM [Lactobacillus crispatus 214-1]
 gi|256614786|gb|EEU19987.1| 16S rRNA processing protein RimM [Lactobacillus crispatus
           125-2-CHN]
 gi|290922228|gb|EFD99222.1| 16S rRNA processing protein RimM [Lactobacillus crispatus 214-1]
          Length = 171

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 74/159 (46%), Gaps = 7/159 (4%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPID---LNRYVLYSNDNRELRILKMYRKNKRF-IATFS 65
           +A I TTHGLNGEV +    + P D   +  ++    +  ++  +   R  K+F +  F+
Sbjct: 6   VARILTTHGLNGEVKVSIITDFPEDRFAIGMHLAIKGETSQVLTVAKSRPFKQFWLVQFA 65

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQ-GKYWGQVCGVYN 124
            I +I  A +L+   L     D    EL E  ++  D+ + +  D + GK  G++  + +
Sbjct: 66  EITDIDQAEKLKGKILVVSEADRG--ELPEGVYYYKDIFDCDVIDEESGKRLGKITDIES 123

Query: 125 FGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
            GA  I  +     K + IP     V +V++   K+ ++
Sbjct: 124 PGANDIWLVHEDNGKEYWIPNIASVVKKVDVANKKVYVE 162


>gi|256822054|ref|YP_003146017.1| 16S rRNA processing protein RimM [Kangiella koreensis DSM 16069]
 gi|256795593|gb|ACV26249.1| 16S rRNA processing protein RimM [Kangiella koreensis DSM 16069]
          Length = 173

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/163 (20%), Positives = 77/163 (47%), Gaps = 7/163 (4%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRKNKRFI 61
           K +++  +    G+ G V + SY +   ++  Y  +        +++ I+    + K  +
Sbjct: 6   KPLIVGKLNGASGIKGWVKVFSYTDPKENILNYSPWYLKLDGQWQQVLIINGREQGKTVV 65

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
           A   G ++ ++A   R +++          +LEE E++  DL  +   +  G   G V  
Sbjct: 66  AQLEGCNDRNTAESYRGVEIAIDESQLP--QLEEGEYYWRDLVGLTVVNVAGDEMGTVEK 123

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFT-KFAVLEVNLQENKILID 163
           +   GA  +L +K   ++  LIP+  +++V++V+L+  +I +D
Sbjct: 124 MMETGANDVLVVKTASKEELLIPYVPEYSVIKVDLESKQITVD 166


>gi|332638246|ref|ZP_08417109.1| 16S rRNA processing protein, RimM [Weissella cibaria KACC 11862]
          Length = 167

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/152 (23%), Positives = 72/152 (47%), Gaps = 9/152 (5%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDL----NRYVLYSNDNRELRILKMYRKNKRFIA-TF 64
           + TI  THG+ GEV + +  + P +     N+ ++      E+ I  + R +K+F+  +F
Sbjct: 6   VGTIVNTHGIRGEVRVIATTDFPEERFAKGNKLIIDGKSPVEVEIATV-RNHKQFVLLSF 64

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQ-GKYWGQVCGVY 123
             + NI+   + +   L    +  +D  L EDEF+  ++  ++  D   G+  G+V  + 
Sbjct: 65  KDLQNINLVEQYKTHDLMVPEEALQD--LAEDEFYYHEIVGLDVIDNATGQVLGKVAEIM 122

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNL 155
              A  +  +K   +    IP+ +  V E++L
Sbjct: 123 ELPANDVWVVKAKGQDDLFIPYIENVVTEIDL 154


>gi|148549464|ref|YP_001269566.1| 16S rRNA-processing protein RimM [Pseudomonas putida F1]
 gi|166226468|sp|A5W8C2|RIMM_PSEP1 RecName: Full=Ribosome maturation factor rimM
 gi|148513522|gb|ABQ80382.1| 16S rRNA processing protein RimM [Pseudomonas putida F1]
          Length = 178

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/169 (20%), Positives = 81/169 (47%), Gaps = 10/169 (5%)

Query: 3   KLDKLVLMATIGTTHGLNGEVYIDSYAN---NPIDLNRYVL-YSNDNRELRILKMYRKNK 58
           K D L+++  I + HG+ GEV + S+ +   N +D  R+ L +    +++ ++      K
Sbjct: 7   KADDLIVVGKIFSVHGVRGEVKVYSFTDPIENLLDYPRWTLRHEGKVKQVELVSGRGSQK 66

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
             +    G+D+   A  L   ++   R    +  L  DE++   L  ++  ++  + +G+
Sbjct: 67  GLVVKLKGLDDRDEARLLSGYEICIPRSLLPN--LAADEYYWYQLVGLKVINQDEQLFGK 124

Query: 119 VCGVYNFGAGSILEIKNTM----EKTFLIPFTKFAVLEVNLQENKILID 163
           V  +   GA  ++ +K       ++  L+P+T+  VL ++L+   + ++
Sbjct: 125 VDHMLETGANDVMVVKPCAGSLDDRERLLPYTEQCVLAIDLEAGVMRVE 173


>gi|330807706|ref|YP_004352168.1| 16S rRNA processing protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327375814|gb|AEA67164.1| Putative 16S rRNA processing protein [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
          Length = 178

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/167 (22%), Positives = 80/167 (47%), Gaps = 10/167 (5%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYAN---NPIDLNRYVLYSNDNRELRILKMYRKNKRF- 60
           D L+++  I + HG+ GEV + S+ +   N +D   + L    + +   L   R N +F 
Sbjct: 9   DDLIVVGKIYSVHGVRGEVKVYSFTDPIKNLLDYKTWTLKREGSVKQVELVSGRGNDKFL 68

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +A    +D+   A  L   ++   R  F   EL + E++   L  ++  D  G+  G++ 
Sbjct: 69  VAKLKDLDDREEARLLAGYEICVPRNLFP--ELTDGEYYWYQLVGLKVIDHLGQLLGKID 126

Query: 121 GVYNFGAGSILEIKNTM----EKTFLIPFTKFAVLEVNLQENKILID 163
            +   G+  ++ +K  +    ++  L+P+T+  VL V+L   ++ ++
Sbjct: 127 HLLETGSNDVMVVKPCVGSLDDRERLLPYTEQCVLAVDLAAGEMKVE 173


>gi|315038604|ref|YP_004032172.1| 16S rRNA-processing protein RimM [Lactobacillus amylovorus GRL
           1112]
 gi|312276737|gb|ADQ59377.1| 16S rRNA-processing protein RimM [Lactobacillus amylovorus GRL
           1112]
          Length = 171

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 75/159 (47%), Gaps = 7/159 (4%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDL----NRYVLYSNDNRELRILKMYRKNKRFIATFS 65
           +A I TTHGLNGEV ++   + P D      +  L ++ +R L I K     + ++  F 
Sbjct: 6   VAKILTTHGLNGEVKVNVITDFPEDRFAEGMQLALKADTDRILTIKKSRPFKQFWLLQFD 65

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQ-GKYWGQVCGVYN 124
            +++I  A +LR   L     +    EL E  ++  D+ + +  D + GK  G++  + +
Sbjct: 66  EVNDIDEAEKLRGQILVVSEDNRG--ELPEGVYYYKDIFDCDVIDEESGKRLGKITDIQS 123

Query: 125 FGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
            GA  I  +     K + IP     V +V++   K+ ++
Sbjct: 124 PGANDIWLVHEDDGKEYWIPNIADVVKKVDVSNKKVYVE 162


>gi|220917153|ref|YP_002492457.1| 16S rRNA processing protein RimM [Anaeromyxobacter dehalogenans
           2CP-1]
 gi|219955007|gb|ACL65391.1| 16S rRNA processing protein RimM [Anaeromyxobacter dehalogenans
           2CP-1]
          Length = 164

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/149 (22%), Positives = 61/149 (40%), Gaps = 7/149 (4%)

Query: 18  GLNGEVYIDSYANNPIDLNRYVLYSN--DNRELRILKMYRKNKRFIATFSGIDNIHSASE 75
           GL G + +         L R VL        E R+L+   + + +     G+ +   A  
Sbjct: 14  GLKGHLGVAGSEGALGTLERVVLRHGAVGQAERRVLEARPQGRLWAVRIDGVADRTGAEA 73

Query: 76  LRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFGAGSILEIKN 135
           L   ++ A R+     E  E   +  DLE +     QG+  G V G+   GA  +L ++ 
Sbjct: 74  LVGAEVLAPREALG--EAGEGRHYWGDLEGLPVVTVQGEALGTVTGLMETGAVDVLVVQG 131

Query: 136 TMEKTFLIPFTKFAVLEVNLQENKILIDP 164
                 L+P   +  +EV+    ++++DP
Sbjct: 132 A-RGELLVPLAPY--VEVDRAAGRVVVDP 157


>gi|86158337|ref|YP_465122.1| 16S rRNA processing protein RimM [Anaeromyxobacter dehalogenans
           2CP-C]
 gi|109892997|sp|Q2IJ53|RIMM_ANADE RecName: Full=Ribosome maturation factor rimM
 gi|85774848|gb|ABC81685.1| 16S rRNA processing protein RimM [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 163

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/148 (22%), Positives = 63/148 (42%), Gaps = 6/148 (4%)

Query: 18  GLNGEVYIDSYANNPIDLNRYVL-YSNDNRELRILKMYRKNKRFIATFSGIDNIHSASEL 76
           GL G + +         L R VL +     E ++L+   + + +     G+ +   A  L
Sbjct: 14  GLKGHLGVAGSEGALGTLERVVLRHGAAEVERKVLEARPQGRLWAVRIDGVADRTGAEAL 73

Query: 77  RDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFGAGSILEIKNT 136
              ++ A R++    E  E   +  DLE +     QG+  G V G+   GA  +L ++  
Sbjct: 74  VGAEVLAPREELG--EAGEGRHYWGDLEGLPVVTVQGEALGTVTGLMETGAVDVLVVQGA 131

Query: 137 MEKTFLIPFTKFAVLEVNLQENKILIDP 164
                L+P   +  +EV+    ++++DP
Sbjct: 132 -RGELLVPLAPY--VEVDRAAGRVVVDP 156


>gi|157738179|ref|YP_001490863.1| 16S rRNA processing protein [Arcobacter butzleri RM4018]
 gi|172045654|sp|A8EW70|RIMM_ARCB4 RecName: Full=Ribosome maturation factor rimM
 gi|157700033|gb|ABV68193.1| 16S rRNA processing protein [Arcobacter butzleri RM4018]
          Length = 178

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/163 (27%), Positives = 81/163 (49%), Gaps = 13/163 (7%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIATFSGI 67
           V +A +G T GL G + +   ++ P    + V ++  NR L++  +   + R +  F   
Sbjct: 7   VYVAKLGKTVGLQGHLRLFIDSDFPEQFKKGVTFTT-NRNLQLKVLEYNSSRELVKFENY 65

Query: 68  DNIHSASELRDLKLYAKRQDFKDE-ELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFG 126
           +++  A +L + +LYA  +  K+  +L ++EFF  DL   E F+   K  G V  ++ + 
Sbjct: 66  EDVELAKKLTNQELYATIEQTKENCKLAKNEFFWFDLISCEVFENNLK-LGTVKEIHRYP 124

Query: 127 AGSILEI-------KNTMEKTFLIP--FTKFAVLEVNLQENKI 160
               LEI       K  + K FLIP  F KF +L ++++  +I
Sbjct: 125 LNDYLEIITDSELVKKALPKNFLIPHIFDKF-ILNIDIENKRI 166


>gi|30021930|ref|NP_833561.1| 16S rRNA-processing protein [Bacillus cereus ATCC 14579]
 gi|29897486|gb|AAP10762.1| 16S rRNA processing protein rimM [Bacillus cereus ATCC 14579]
          Length = 188

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 79/169 (46%), Gaps = 14/169 (8%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNRELRILKM----YRKNKRF- 60
           +  I  THG+ GE+ + S  + P +  RY     LY ++ +    L +    +R++K F 
Sbjct: 24  VGKIVNTHGVRGEIRVISRTDFPEE--RYKVGNTLYISNEKGTDYLPVKVTSHRQHKTFD 81

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           + TF G +N+    + +   +    +     EL E E++  ++        +G+  G + 
Sbjct: 82  LLTFEGYNNVDEVEKFKGSLIKVPEEQLG--ELAEGEYYYHEIIGCSVVTEEGEALGTIK 139

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
            + + GA  +  IK    +  LIP+    VL+VN+ ENK++   +  GL
Sbjct: 140 EILSPGANDVWVIKRPKGQDLLIPYIDDVVLQVNI-ENKLVTIHVMEGL 187


>gi|312194951|ref|YP_004015012.1| 16S rRNA processing protein RimM [Frankia sp. EuI1c]
 gi|311226287|gb|ADP79142.1| 16S rRNA processing protein RimM [Frankia sp. EuI1c]
          Length = 178

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/172 (22%), Positives = 72/172 (41%), Gaps = 15/172 (8%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNR-----ELRILKMYRKNK 58
           + + +++  IG  HG+ G+V ++   + P    R+   S  +R     +L I      + 
Sbjct: 1   MGEAIVVGRIGKPHGVRGDVTVEVRTDLPD--RRFAPGSKLDRSGGGPDLVIEDSRWHSG 58

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDE-------FFNTDLEEMETFDR 111
           R +  F G+ +   A  LR + L     D   + ++ DE       +++ DL  +     
Sbjct: 59  RLLVRFEGVADRTGAESLRGVVLTID-ADLAGDAVDPDEADEGGEFWWDRDLVGLRAVTP 117

Query: 112 QGKYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
            G   G+V  V +  AG +L I        L+PF +  V  V+     +++D
Sbjct: 118 DGSPLGEVTDVVHTAAGELLAIGTPTGGEHLVPFVREIVPTVDRAGGLLVVD 169


>gi|295399788|ref|ZP_06809769.1| 16S rRNA processing protein RimM [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|312111700|ref|YP_003990016.1| 16S rRNA processing protein RimM [Geobacillus sp. Y4.1MC1]
 gi|294978191|gb|EFG53788.1| 16S rRNA processing protein RimM [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|311216801|gb|ADP75405.1| 16S rRNA processing protein RimM [Geobacillus sp. Y4.1MC1]
          Length = 172

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 75/173 (43%), Gaps = 9/173 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-----YVLYSNDNRELR-ILKMYRKN 57
           ++K   +  I  THG+ GEV + S  + P +  +     Y+        +  I+K +R +
Sbjct: 1   MEKWFNVGKIVNTHGIRGEVRVISRTDFPEERYKKGNTLYIFMEKSQEPIEVIVKSHRVH 60

Query: 58  KRF-IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           K F + +F G DNI+   + +   L          EL E E++  ++        +G+  
Sbjct: 61  KSFDLLSFEGYDNINLVEKFKGAMLKVPESQLG--ELNEGEYYFHEIIGCTVVTEEGETV 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           G V  +   GA  +  +K    K  LIP+ +  V  V+++   I I P+   L
Sbjct: 119 GTVSEILTPGANDVWVVKRNNGKEALIPYIEDIVKNVDVEAKIITIRPMEGLL 171


>gi|77457247|ref|YP_346752.1| 16S rRNA-processing protein RimM [Pseudomonas fluorescens Pf0-1]
 gi|109893035|sp|Q3KHJ3|RIMM_PSEPF RecName: Full=Ribosome maturation factor rimM
 gi|77381250|gb|ABA72763.1| 16S rRNA processing protein [Pseudomonas fluorescens Pf0-1]
          Length = 178

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/163 (22%), Positives = 77/163 (47%), Gaps = 12/163 (7%)

Query: 3   KLDKLVLMATIGTTHGLNGEVYIDSYANNPID-----LNRYVLYSNDNRELRILKMYRKN 57
           K D L+++  I + HG+ GEV + S+  +PI+      N  +      +++ ++      
Sbjct: 7   KADDLIVVGKIFSVHGVRGEVKVFSF-TDPIENLLGYRNWTLRREGVVKQVELVSGRSTQ 65

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
           K  +    G+D+   A  L   ++   R    D  L  DE++   LE +   ++  + +G
Sbjct: 66  KDLVVKLKGLDDRDEARLLSGYEICIPRSLLPD--LTADEYYWYQLEGLSVINQDEQLFG 123

Query: 118 QVCGVYNFGAGSILEIKNTM----EKTFLIPFTKFAVLEVNLQ 156
           +V  +   GA  +L +K  +    ++  L+P+T+  VL ++L+
Sbjct: 124 KVDHLLETGANDVLVVKPCVGSLDDRERLLPYTEQCVLAIDLE 166


>gi|327183808|gb|AEA32255.1| 16S rRNA-processing protein RimM [Lactobacillus amylovorus GRL
           1118]
          Length = 186

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 75/159 (47%), Gaps = 7/159 (4%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDL----NRYVLYSNDNRELRILKMYRKNKRFIATFS 65
           +A I TTHGLNGEV ++   + P D      +  L ++ +R L I K     + ++  F 
Sbjct: 21  VAKILTTHGLNGEVKVNVITDFPEDRFAEGMQLALKADTDRILTIKKSRPFKQFWLLQFD 80

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQ-GKYWGQVCGVYN 124
            +++I  A +LR   L     +    EL E  ++  D+ + +  D + GK  G++  + +
Sbjct: 81  EVNDIDEAEKLRGQILVVSEDNRG--ELPEGVYYYKDIFDCDVIDEESGKRLGKITDIQS 138

Query: 125 FGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
            GA  I  +     K + IP     V +V++   K+ ++
Sbjct: 139 PGANDIWLVHEDDGKEYWIPNIADVVKKVDVPNKKVYVE 177


>gi|325273827|ref|ZP_08140012.1| 16S rRNA-processing protein RimM [Pseudomonas sp. TJI-51]
 gi|324101033|gb|EGB98694.1| 16S rRNA-processing protein RimM [Pseudomonas sp. TJI-51]
          Length = 178

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/169 (20%), Positives = 80/169 (47%), Gaps = 10/169 (5%)

Query: 3   KLDKLVLMATIGTTHGLNGEVYIDSYAN---NPIDLNRYVL-YSNDNRELRILKMYRKNK 58
           K D L+++  I + HG+ GEV + S+ +   N +D  R+ L +    +++ ++      K
Sbjct: 7   KADDLIVVGKIFSVHGVRGEVKVYSFTDPIENLLDYPRWTLRHEGKVKQVELVSGRGSQK 66

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
             +    G+D+   A  L   ++   R    +  L  DE++   L  ++  ++    +G+
Sbjct: 67  GLVVKLKGLDDRDEARLLSGYEICIARSLLPN--LAADEYYWYQLVGLKVINQDEHLFGK 124

Query: 119 VCGVYNFGAGSILEIKNTM----EKTFLIPFTKFAVLEVNLQENKILID 163
           V  +   GA  ++ +K       ++  L+P+T+  VL ++L+   + ++
Sbjct: 125 VDHLLETGANDVMVVKPCAGSLDDRERLLPYTEQCVLAIDLEAGTMRVE 173


>gi|163941580|ref|YP_001646464.1| 16S rRNA-processing protein [Bacillus weihenstephanensis KBAB4]
 gi|229013025|ref|ZP_04170190.1| Ribosome maturation factor rimM [Bacillus mycoides DSM 2048]
 gi|229061445|ref|ZP_04198790.1| Ribosome maturation factor rimM [Bacillus cereus AH603]
 gi|229134650|ref|ZP_04263459.1| Ribosome maturation factor rimM [Bacillus cereus BDRD-ST196]
 gi|229168581|ref|ZP_04296304.1| Ribosome maturation factor rimM [Bacillus cereus AH621]
 gi|229485581|sp|A9VT80|RIMM_BACWK RecName: Full=Ribosome maturation factor rimM
 gi|163863777|gb|ABY44836.1| 16S rRNA processing protein RimM [Bacillus weihenstephanensis
           KBAB4]
 gi|228614987|gb|EEK72089.1| Ribosome maturation factor rimM [Bacillus cereus AH621]
 gi|228648696|gb|EEL04722.1| Ribosome maturation factor rimM [Bacillus cereus BDRD-ST196]
 gi|228717868|gb|EEL69516.1| Ribosome maturation factor rimM [Bacillus cereus AH603]
 gi|228748279|gb|EEL98139.1| Ribosome maturation factor rimM [Bacillus mycoides DSM 2048]
          Length = 171

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 78/169 (46%), Gaps = 14/169 (8%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNRELRILKM----YRKNKRF- 60
           +  I  THG+ GE+ + S  + P +  RY     LY  D +    L +    +R++K F 
Sbjct: 7   VGKIVNTHGVKGEIRVISRTDFPEE--RYKVGNTLYIWDEKGTDYLTVKVTSHRQHKTFD 64

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           + T  G +N+    +L+   +    +     EL E E++  ++        +G+  G + 
Sbjct: 65  LLTLEGYNNVDEVEKLKGSLIKVPEEQLG--ELAEGEYYYHEIIGCNVVTEEGEALGTIK 122

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
            + + GA  +  IK    +  LIP+    VL+VN+ ENK++   +  GL
Sbjct: 123 EILSPGANDVWVIKRPKGQDLLIPYIDDVVLQVNI-ENKLVTIHVMEGL 170


>gi|81428332|ref|YP_395332.1| 16S rRNA processing protein, RimM [Lactobacillus sakei subsp. sakei
           23K]
 gi|109893021|sp|Q38XQ8|RIMM_LACSS RecName: Full=Ribosome maturation factor rimM
 gi|78609974|emb|CAI55021.1| 16S rRNA processing protein, RimM [Lactobacillus sakei subsp. sakei
           23K]
          Length = 176

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/175 (22%), Positives = 80/175 (45%), Gaps = 16/175 (9%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-------VLYSNDNRELRILKMYRKN 57
           +K   +  I  THG+ GEV +   A       R+       V   N    + +  M +  
Sbjct: 3   EKYYQVGKIVNTHGIRGEVRV--IATTDFTEERFKKGTHLAVEMPNGLTPVTVSAMRQHK 60

Query: 58  KRFIATFSGIDNIHSASELR--DLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQ-GK 114
           + ++  F G+ NI+     +  +LK+ A     +D++LE+DE++  D+  +E  +   G 
Sbjct: 61  QFYLLQFEGLGNINDVELFKGHNLKIAASE---RDDQLEDDEYYYGDIIGLEVIEESDGT 117

Query: 115 YWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
            +G+V  + + G   +  IK       L+PF K  + +++++  K  ++ +  GL
Sbjct: 118 SYGKVSEIIDPGPNDVWVIKRRGRSDLLLPFLKSVIKKIDIEAGKAYVE-VPEGL 171


>gi|169830843|ref|YP_001716825.1| 16S rRNA processing protein RimM [Candidatus Desulforudis
           audaxviator MP104C]
 gi|238688234|sp|B1I2N0|RIMM_DESAP RecName: Full=Ribosome maturation factor rimM
 gi|169637687|gb|ACA59193.1| 16S rRNA processing protein RimM [Candidatus Desulforudis
           audaxviator MP104C]
          Length = 170

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/162 (24%), Positives = 74/162 (45%), Gaps = 6/162 (3%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRK--NKRF- 60
           ++L+L+  I  T G  G V +    + P    R   +Y       R++ + R   +KRF 
Sbjct: 3   EELILIGEIVNTQGHRGAVRVLPLTDFPERFRRLKSVYLEQGPVRRLVHIGRVSYHKRFV 62

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           I  F  I ++++A +L+  +L   R +     L +   +  D+     FD +G+Y G V 
Sbjct: 63  ILEFREIPDMNAAEKLKGAQLKIHRSELVP--LPDGHHYVFDIVGSSVFDAEGEYLGVVE 120

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
            V   GA  +  +K+    + L+P  K  V +++L   +I +
Sbjct: 121 DVLRTGANDVYVVKSGEGDSLLVPALKTVVRDIDLARRRITV 162


>gi|30263845|ref|NP_846222.1| 16S rRNA-processing protein RimM [Bacillus anthracis str. Ames]
 gi|47529270|ref|YP_020619.1| 16S rRNA-processing protein RimM [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|227813250|ref|YP_002813259.1| 16S rRNA processing protein RimM [Bacillus anthracis str. CDC 684]
 gi|229600064|ref|YP_002868079.1| 16S rRNA processing protein RimM [Bacillus anthracis str. A0248]
 gi|254683450|ref|ZP_05147310.1| 16S rRNA-processing protein RimM [Bacillus anthracis str.
           CNEVA-9066]
 gi|254735880|ref|ZP_05193586.1| 16S rRNA-processing protein RimM [Bacillus anthracis str. Western
           North America USA6153]
 gi|254751179|ref|ZP_05203218.1| 16S rRNA-processing protein RimM [Bacillus anthracis str. Vollum]
 gi|254756727|ref|ZP_05208756.1| 16S rRNA-processing protein RimM [Bacillus anthracis str. Australia
           94]
 gi|33301488|sp|Q81WJ5|RIMM_BACAN RecName: Full=Ribosome maturation factor rimM
 gi|254797741|sp|C3P5P3|RIMM_BACAA RecName: Full=Ribosome maturation factor rimM
 gi|254797742|sp|C3L785|RIMM_BACAC RecName: Full=Ribosome maturation factor rimM
 gi|30258489|gb|AAP27708.1| 16S rRNA processing protein RimM [Bacillus anthracis str. Ames]
 gi|47504418|gb|AAT33094.1| 16S rRNA processing protein RimM [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|227005104|gb|ACP14847.1| 16S rRNA processing protein RimM [Bacillus anthracis str. CDC 684]
 gi|229264472|gb|ACQ46109.1| 16S rRNA processing protein RimM [Bacillus anthracis str. A0248]
          Length = 171

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 80/169 (47%), Gaps = 14/169 (8%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNR--ELRILKM--YRKNKRF- 60
           +  I  THG+ GE+ + S  + P +  RY     LY ++ +  E   +K+  +R++K F 
Sbjct: 7   VGKIVNTHGVKGEIRVVSRTDFPEE--RYKVGNTLYISNEKGGEPFPVKITSHRQHKTFD 64

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           + TF G  N++   + +   L          EL E E++  ++        +G+  G + 
Sbjct: 65  LLTFEGYGNVNEVEQFKGSLLKVPEDQLG--ELAEGEYYYHEIIGCNVVTEEGEALGTIK 122

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
            V + GA  +  IK    +  LIP+    VL+VN+ ENK++   +  GL
Sbjct: 123 EVLSPGANDVWVIKRPKGQDLLIPYIDDVVLQVNI-ENKLVTIHVTEGL 170


>gi|315636322|ref|ZP_07891572.1| 16S rRNA processing protein RimM [Arcobacter butzleri JV22]
 gi|315479411|gb|EFU70094.1| 16S rRNA processing protein RimM [Arcobacter butzleri JV22]
          Length = 177

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/163 (27%), Positives = 81/163 (49%), Gaps = 13/163 (7%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIATFSGI 67
           + +A +G T GL G + +   ++ P    + V +S  NR L++  +   + R +  F   
Sbjct: 6   IYVAKLGKTVGLQGHLRLFIDSDFPEQFKKGVTFST-NRNLQLKVLEYNSSRELVKFENY 64

Query: 68  DNIHSASELRDLKLYAKRQDFKDE-ELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFG 126
           +++  A +L + +LYA  +  K+  +L ++EFF  DL   E F+   K  G V  ++ + 
Sbjct: 65  EDVELAKKLTNQELYATIEQTKENCKLAKNEFFWFDLISCEVFENNLK-LGIVKEIHRYP 123

Query: 127 AGSILEI-------KNTMEKTFLIP--FTKFAVLEVNLQENKI 160
               LEI       K  + K FLIP  F KF +L ++++  +I
Sbjct: 124 LNDYLEIITDSELAKKALPKNFLIPHIFDKF-ILNIDIENKRI 165


>gi|88855265|ref|ZP_01129930.1| 16S rRNA processing protein [marine actinobacterium PHSC20C1]
 gi|88815793|gb|EAR25650.1| 16S rRNA processing protein [marine actinobacterium PHSC20C1]
          Length = 188

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/166 (24%), Positives = 71/166 (42%), Gaps = 17/166 (10%)

Query: 10  MATIGTTHGLNGEVYIDSYANNP-----------IDLNRYVLYSNDNRELRILKMYRKNK 58
           M  +   HGL G + ++ Y + P           + +     +     EL  LK Y  N 
Sbjct: 1   MGRLTKAHGLKGAIKVEMYTDAPERRFVPGAVFSLQVPTSSPWHGKTLELIELKWY--NA 58

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
           + +A F G+ +   A  L    L+       +EE EED +F+  L  ++   R G+  G 
Sbjct: 59  QPVAFFKGVLDRSDAEGLIKAILWIDHD--PNEEPEEDAWFDHQLVGLKVI-RDGQQVGT 115

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           +  V +F    +L +  T     L+PF K  V  V+L+  ++++ P
Sbjct: 116 LAQVDHFPVQDLLTV-TTENGDVLVPFVKSIVASVDLEAGEMVVTP 160


>gi|303248433|ref|ZP_07334692.1| 16S rRNA processing protein RimM [Desulfovibrio fructosovorans JJ]
 gi|302490144|gb|EFL50063.1| 16S rRNA processing protein RimM [Desulfovibrio fructosovorans JJ]
          Length = 183

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/171 (22%), Positives = 73/171 (42%), Gaps = 13/171 (7%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNP--IDLNRYVLYSNDNRELR----ILKMYRKNK 58
           +K +++  +   HG+ GE+ IDS+A++P   D    VL        R     ++  R +K
Sbjct: 4   EKYIIVGDVARPHGIRGELCIDSHADSPSYFDRGAEVLLCPPGSPGRGRVYTVRAARVHK 63

Query: 59  -RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY-- 115
            R + +F G+ + ++A  LR L +            + DE F   L  +     Q     
Sbjct: 64  ERLLVSFEGVPDRNAAELLRGLAVCVPASRLVPP--DPDEVFLHQLLGLRVRLAQAAPGS 121

Query: 116 --WGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
             +G +  V + G   +  I++      L P     V +++L+   ++IDP
Sbjct: 122 PDFGVIEDVRDSGGAELWVIRDAAGHEILFPAADELVPDIDLEAGFVVIDP 172


>gi|65321170|ref|ZP_00394129.1| COG0806: RimM protein, required for 16S rRNA processing [Bacillus
           anthracis str. A2012]
          Length = 171

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 77/169 (45%), Gaps = 14/169 (8%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNRELRILKM----YRKNKRF- 60
           +  I  THG+ GE+ + S  + P +  RY     LY ++ +      +    +R++K F 
Sbjct: 7   VGKIVNTHGVKGEIRVVSRTDFPEE--RYKVGNTLYISNEKGGEPFPVKXTSHRQHKTFD 64

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           + TF G  N++   + +   L          EL E E++  ++        +G+  G + 
Sbjct: 65  LLTFEGYGNVNEVEQFKGSLLKVPEDQLG--ELAEGEYYYHEIIGCNVVTEEGEALGTIK 122

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
            V + GA  +  IK    +  LIP+    VL+VN+ ENK++   +  GL
Sbjct: 123 EVLSPGANDVWVIKRPKGQDLLIPYIDDVVLQVNI-ENKLVTIHVTEGL 170


>gi|295677252|ref|YP_003605776.1| 16S rRNA processing protein RimM [Burkholderia sp. CCGE1002]
 gi|295437095|gb|ADG16265.1| 16S rRNA processing protein RimM [Burkholderia sp. CCGE1002]
          Length = 244

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 73/171 (42%), Gaps = 17/171 (9%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNP------IDLNRYVLYSNDNRE-LRILKMYRKNKRF 60
           V +  I   +GL G V + ++A+        +   R+ L     R+    L+    +   
Sbjct: 71  VEVGAIVDAYGLKGWVKVAAHADAGQGGDALLSAKRWWLLKGPERKSAPSLQAKTHSDSV 130

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +A   G+ +   A  LR  ++Y  R +F    LE DEF+  DL  ++  +  G   G+V 
Sbjct: 131 VARLGGVADRDVALGLRGSRVYISRSEF--PALEADEFYWVDLIGLDVVNLAGLNLGKVA 188

Query: 121 GVYNFGAGSILEIK--------NTMEKTFLIPFTKFAVLEVNLQENKILID 163
            + + GA S+L I+          +    LIPF    V  V+    +I++D
Sbjct: 189 SMVDNGAQSVLRIEYPATDKNGKPVAGERLIPFVGVFVKTVDQAAKQIVVD 239


>gi|52141646|ref|YP_085183.1| 16S rRNA-processing protein [Bacillus cereus E33L]
 gi|59798170|sp|Q636I4|RIMM_BACCZ RecName: Full=Ribosome maturation factor rimM
 gi|51975115|gb|AAU16665.1| 16S rRNA processing protein [Bacillus cereus E33L]
          Length = 171

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 80/169 (47%), Gaps = 14/169 (8%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNR--ELRILKM--YRKNKRF- 60
           +  I  THG+ GE+ + S  + P +  RY     LY ++ +  E   +K+  +R++K F 
Sbjct: 7   VGKIVNTHGVKGEIRVVSLTDFPEE--RYKVGNTLYISNEKGGEPFPVKITSHRQHKTFD 64

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           + TF G  N++   + +   L          EL E E++  ++        +G+  G + 
Sbjct: 65  LLTFEGYGNVNEVEQFKGSLLKVPEDQLG--ELAEGEYYYHEIIGCNVVTEEGEALGTIK 122

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
            V + GA  +  IK    +  LIP+    VL+VN+ ENK++   +  GL
Sbjct: 123 EVLSPGANDVWVIKRPKGQDLLIPYIDDVVLQVNI-ENKLVTIHVMEGL 170


>gi|298370120|ref|ZP_06981436.1| 16S rRNA processing protein RimM [Neisseria sp. oral taxon 014 str.
           F0314]
 gi|298281580|gb|EFI23069.1| 16S rRNA processing protein RimM [Neisseria sp. oral taxon 014 str.
           F0314]
          Length = 169

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/168 (27%), Positives = 72/168 (42%), Gaps = 9/168 (5%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDS---YANNPIDLNRYVLYSNDNRELRILKMYRK- 56
           M    + V M  I    G+ G + I +   Y ++ +D   ++L S + + L ++    K 
Sbjct: 1   MTDTQQRVAMGYIKGVFGIKGWLKIAADTEYPDSLLDYPEWLL-SKNGKTLNVVLETGKL 59

Query: 57  -NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
                   F GID+   A  LR   +   R +F      EDE++ TDL  M   +++G  
Sbjct: 60  VGDELQVKFEGIDDRDQAFALRGYTVEIPRAEFS--PAGEDEYYWTDLVGMTVVNKEGIT 117

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
            G V  +   GA  +L I+ T +K  LIPF    +  VN     I  D
Sbjct: 118 LGTVKNLMETGANDVLVIQGT-DKQILIPFVSNYIETVNHDSKTITAD 164


>gi|260886931|ref|ZP_05898194.1| 16S rRNA processing protein RimM [Selenomonas sputigena ATCC 35185]
 gi|260862993|gb|EEX77493.1| 16S rRNA processing protein RimM [Selenomonas sputigena ATCC 35185]
          Length = 169

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/159 (22%), Positives = 65/159 (40%), Gaps = 2/159 (1%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIATF 64
           D  V++   G  HGL GEV +    + P             R   +  ++   +  + T 
Sbjct: 3   DGRVVIGKAGAPHGLRGEVRVIPLTDFPERFESLREVFIGERVFHVEHVHYHRQFVLLTL 62

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
           +   +  +A++L    L   R+D     L E EF+  D+  +   D  G+  G+V  V  
Sbjct: 63  AECTSREAAAKLTGELLRVAREDAAP--LAEGEFYTFDIIGLAVLDMAGERLGEVTNVLK 120

Query: 125 FGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
            G+  +  +K T     L+P  K  V E+++    + +D
Sbjct: 121 TGSNDVYVVKKTDGAELLVPALKKVVREIDIAGGFLRVD 159


>gi|302389632|ref|YP_003825453.1| 16S rRNA processing protein RimM [Thermosediminibacter oceani DSM
           16646]
 gi|302200260|gb|ADL07830.1| 16S rRNA processing protein RimM [Thermosediminibacter oceani DSM
           16646]
          Length = 170

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/158 (27%), Positives = 74/158 (46%), Gaps = 22/158 (13%)

Query: 18  GLNGEVYIDSYANNPIDLNRY-----VLYSNDNRELRILKMYRKN------KRFIA-TFS 65
           G+ G+V +++  +   D+NR+     VL   D      LK Y  N      K F+A    
Sbjct: 15  GVRGQVKVEALTD---DVNRFRKLKSVLVEEDE----ALKSYVVNSVVFLKKDFVALKLE 67

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETF-DRQGKYWGQVCGVYN 124
           GID + SA  LR   L   R+D    +L E  +F  D+  ME + +  G+  G+V  V  
Sbjct: 68  GIDTVESAERLRGRYLMVHRKDAV--KLPEGHYFICDIIGMEVYREEDGELLGRVRDVLK 125

Query: 125 FGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
            GA  +  +     +  L+P  +  V +++L+ NK+++
Sbjct: 126 TGANDVYVVDLKGGRELLLPAIRDVVRKIDLENNKMVV 163


>gi|241763736|ref|ZP_04761784.1| 16S rRNA processing protein RimM [Acidovorax delafieldii 2AN]
 gi|241367041|gb|EER61426.1| 16S rRNA processing protein RimM [Acidovorax delafieldii 2AN]
          Length = 189

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/172 (23%), Positives = 77/172 (44%), Gaps = 20/172 (11%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDL---NRYVLYSNDNRE--------LRILKMYRK 56
           V +  I    G+ G   + S++ +P  L    R+ L  ++           L+I +    
Sbjct: 17  VEVGRIADAWGVKGWFKVLSHSASPEALFSSKRWYLQPSERGAKTFSGTALLQIRQAKDH 76

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           +   +A   GID+  +A  LR  +++  R  F      EDE++  DL  ++  +R+G   
Sbjct: 77  SDTVVAWAQGIDDRDAAEALRGARIFVPRSSFPSTT--EDEYYWVDLIGLQVVNREGVAL 134

Query: 117 GQVCGVYNFGAGSILEIK-----NTMEKTFLIPFTKFAVLEVNLQENKILID 163
           G V  + + G  ++L +        +E+  +IPF    V +V+L E +I +D
Sbjct: 135 GLVRELMSTGPQTVLVLAYEQDGKALER--MIPFVSAFVDKVDLPEKRITVD 184


>gi|156975744|ref|YP_001446651.1| 16S rRNA-processing protein [Vibrio harveyi ATCC BAA-1116]
 gi|166226487|sp|A7MYV0|RIMM_VIBHB RecName: Full=Ribosome maturation factor rimM
 gi|156527338|gb|ABU72424.1| hypothetical protein VIBHAR_03479 [Vibrio harveyi ATCC BAA-1116]
          Length = 182

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 76/166 (45%), Gaps = 12/166 (7%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNR----ELRILKMYRKNKRFIAT 63
           +++   G T+G+ G + + SY +N   +  Y  +  + +    E ++    R NK  +A 
Sbjct: 14  IVVGKFGATYGIRGWLKVFSYTDNAESIFDYSPWFINQKGTWVEYKVESWKRHNKGMVAK 73

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
             G+D    A  L + ++          EL EDEF+  +L  M+    +G   G V  + 
Sbjct: 74  LEGLDIREDAHLLTNFEIAIDPAVLP--ELSEDEFYWRELFGMQVVTTKGYDLGVVSDIL 131

Query: 124 NFGAGSILEIKNTMEKTF-----LIPFTKFAV-LEVNLQENKILID 163
             G+  +L +K  ++  F     LIPF +  V ++V+ +  +I +D
Sbjct: 132 ETGSNDVLVVKANLKDAFGQKERLIPFLEEQVIIKVDREAQRIEVD 177


>gi|118579529|ref|YP_900779.1| 16S rRNA processing protein RimM [Pelobacter propionicus DSM 2379]
 gi|118502239|gb|ABK98721.1| 16S rRNA processing protein RimM [Pelobacter propionicus DSM 2379]
          Length = 152

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 56/115 (48%), Gaps = 3/115 (2%)

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
           +  +F+  F G+D+I  A  L   ++  +R      E EEDE++  DL  +E    +G  
Sbjct: 40  RPGKFLIGFKGVDHIDQAQTLVGSEICLRRDQLP--EPEEDEYYWCDLIGLEVATVEGMA 97

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
            G +  ++  G+  I  ++    + +LIP     +  V+L+  ++LI P+   L+
Sbjct: 98  LGVLEEIFKAGSSDIYVVRGA-GREYLIPAIADVIHSVDLEMGRMLITPLEGLLD 151


>gi|325971133|ref|YP_004247324.1| ribosome maturation factor rimM [Spirochaeta sp. Buddy]
 gi|324026371|gb|ADY13130.1| Ribosome maturation factor rimM [Spirochaeta sp. Buddy]
          Length = 168

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 73/162 (45%), Gaps = 8/162 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR---YVLYSNDNRE--LRILKMYRKNK 58
           ++KL+  AT+ +  G+ GEV I  +  +   L +    +L + D  E  L I        
Sbjct: 1   MEKLLWTATVKSPFGIAGEVKIHPHNEDCSYLGKLKEVILCAKDGTEQLLTIQSFRMMGS 60

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
           + I  F G D+  +A  L    L  +R   K   L++ +F+  DL         GK+  +
Sbjct: 61  QPIMKFVGFDDPETARALNGQHLMVERS--KAAPLKKGQFYVNDLIGCSMM-HDGKFIAE 117

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKI 160
           V    +     +LE++   ++ +++P+ K  + EV+L+   I
Sbjct: 118 VVSSIDGAQAVLLEVRTAEDQLYMVPYLKEYIGEVDLENRTI 159


>gi|289704589|ref|ZP_06501022.1| 16S rRNA processing protein RimM [Micrococcus luteus SK58]
 gi|289558709|gb|EFD51967.1| 16S rRNA processing protein RimM [Micrococcus luteus SK58]
          Length = 200

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/168 (23%), Positives = 76/168 (45%), Gaps = 13/168 (7%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNP----IDLNRYVLYSND---NRELRILKMYRKN 57
           D LV +A IG  HG+ GEV +  + ++P        R V+         EL + +     
Sbjct: 7   DDLVRVARIGKPHGIRGEVTVQVFTDDPDARFAPGERLVVRDGAPGLPAELTVTRARWNK 66

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
           +  +  F+   + + A  LR  +L+A     +    E DE++  DL ++E    +G+  G
Sbjct: 67  QILVVGFAESPDRNVAETLRGAQLFAVPAAPE----ESDEWYEEDLVDLEVR-VEGERVG 121

Query: 118 QVCGVYNFGAGSILEIK-NTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
            V  +       +L +  + +E+  L+PF +  V E++ +   +++ P
Sbjct: 122 VVTALTTGAVQDLLHVALDGVEEEALVPFVEEIVPEIDPEAGVLVLTP 169


>gi|325957085|ref|YP_004292497.1| 16S rRNA-processing protein RimM [Lactobacillus acidophilus 30SC]
 gi|325333650|gb|ADZ07558.1| 16S rRNA-processing protein RimM [Lactobacillus acidophilus 30SC]
          Length = 171

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 75/159 (47%), Gaps = 7/159 (4%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDL----NRYVLYSNDNRELRILKMYRKNKRFIATFS 65
           +A I TTHGLNGEV ++   + P D      +  L ++ +R L I K     + ++  F 
Sbjct: 6   VAKILTTHGLNGEVKVNVITDFPEDRFAEGIQLALKADTDRILTIKKSRPFKQFWLLQFD 65

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQ-GKYWGQVCGVYN 124
            +++I  A +LR   L     +    EL E  ++  D+ + +  D + GK  G++  + +
Sbjct: 66  EVNDIDEAEKLRGQILVVSEDNRG--ELPEGVYYYKDIFDCDVIDEESGKRLGKITDIQS 123

Query: 125 FGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
            GA  I  +     K + IP     V +V++   K+ ++
Sbjct: 124 PGANDIWLVHEDDGKEYWIPNIADVVKKVDVSNKKVYVE 162


>gi|330839280|ref|YP_004413860.1| Ribosome maturation factor rimM [Selenomonas sputigena ATCC 35185]
 gi|329747044|gb|AEC00401.1| Ribosome maturation factor rimM [Selenomonas sputigena ATCC 35185]
          Length = 172

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/159 (22%), Positives = 65/159 (40%), Gaps = 2/159 (1%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIATF 64
           D  V++   G  HGL GEV +    + P             R   +  ++   +  + T 
Sbjct: 6   DGRVVIGKAGAPHGLRGEVRVIPLTDFPERFESLREVFIGERVFHVEHVHYHRQFVLLTL 65

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
           +   +  +A++L    L   R+D     L E EF+  D+  +   D  G+  G+V  V  
Sbjct: 66  AECTSREAAAKLTGELLRVAREDAAP--LAEGEFYTFDIIGLAVLDMAGERLGEVTNVLK 123

Query: 125 FGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
            G+  +  +K T     L+P  K  V E+++    + +D
Sbjct: 124 TGSNDVYVVKKTDGAELLVPALKKVVREIDIAGGFLRVD 162


>gi|296129319|ref|YP_003636569.1| 16S rRNA processing protein RimM [Cellulomonas flavigena DSM 20109]
 gi|296021134|gb|ADG74370.1| 16S rRNA processing protein RimM [Cellulomonas flavigena DSM 20109]
          Length = 188

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 76/185 (41%), Gaps = 11/185 (5%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDL----NRYVLYSNDNRELRILKMYRKNKRFIA 62
           L+ +A IG  HGL GEV +D   + P D      R          L I ++     R+  
Sbjct: 2   LLTVARIGRAHGLRGEVALDVRTDAPEDRLVVGARIATQPASAGPLEIARVREAQGRWYV 61

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMET-FDRQGKYWGQVCG 121
           TF    +  +A  LR + L        DE  E+D ++   L  +       G+  G+V G
Sbjct: 62  TFVQATDRTAAEALRGVALVVD--SDDDEADEDDAWYPHQLVGLRAEHAADGRLLGEVVG 119

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP----IAAGLNNTTMKNP 177
           + +  A  +L ++       L+PF    V  V++   ++++DP    +AA   N  + + 
Sbjct: 120 LEHLPAHDVLVLREADGARTLVPFVAAIVPVVDVAGGRVVLDPPGGLLAADAANLVVSDE 179

Query: 178 QYDCP 182
               P
Sbjct: 180 TRGAP 184


>gi|227824780|ref|ZP_03989612.1| 16S rRNA processing protein rimM [Acidaminococcus sp. D21]
 gi|226905279|gb|EEH91197.1| 16S rRNA processing protein rimM [Acidaminococcus sp. D21]
          Length = 167

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/165 (20%), Positives = 75/165 (45%), Gaps = 9/165 (5%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNRELRILKMYRK 56
           M+ +++ +++  I   HG+ GE  I    + P    RY    +++ +D R+L ++ + + 
Sbjct: 1   MMTMEQQIVIGKIVAPHGVRGEFRIMPLTDQP---QRYAKMKIVHLDDGRDLTVVSVRQH 57

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
              ++     I N+  A  LR  +L    ++     L + +F+  D+         G+ +
Sbjct: 58  KNVYLMMVKEITNMDEAEALRGRQLVISPKELP--PLPKGQFYVRDILGFAVESPDGEAF 115

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKIL 161
           G V  V + G+  +  I +   +  L+   K  +L ++  E+K++
Sbjct: 116 GTVKDVISPGSTDVFVIASPTGEEILLAAIKENILTIDWAEHKVV 160


>gi|331002000|ref|ZP_08325520.1| 16S rRNA processing protein RimM [Lachnospiraceae oral taxon 107
           str. F0167]
 gi|330411796|gb|EGG91201.1| 16S rRNA processing protein RimM [Lachnospiraceae oral taxon 107
           str. F0167]
          Length = 169

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/169 (24%), Positives = 71/169 (42%), Gaps = 31/169 (18%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNK----------- 58
           +  I ++HG+ GE  +            Y    + NR  +I K+Y   K           
Sbjct: 7   VGVITSSHGIKGEAKV------------YPTSDDSNRLKKIKKVYADIKGVETSLDIETV 54

Query: 59  RF-----IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQG 113
           RF     +  F   +       LR+  L+  R +     L+++E +  DL  ++     G
Sbjct: 55  RFQKNMALVKFKQFNTPEEIQALRNTDLFVDRDNAT--PLKKNENYIADLIGLDVIGEDG 112

Query: 114 KYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
              G+V  V+  GA  ++E+ +  EK  L P+    +L+VNL+E KI +
Sbjct: 113 NILGKVTDVFPTGANHVMEV-DMGEKKVLFPYISQCILDVNLEEGKIFV 160


>gi|42782934|ref|NP_980181.1| 16S rRNA-processing protein RimM [Bacillus cereus ATCC 10987]
 gi|49186692|ref|YP_029944.1| 16S rRNA-processing protein RimM [Bacillus anthracis str. Sterne]
 gi|49481628|ref|YP_037903.1| 16S rRNA-processing protein RimM [Bacillus thuringiensis serovar
           konkukian str. 97-27]
 gi|217961262|ref|YP_002339830.1| 16S rRNA-processing protein RimM [Bacillus cereus AH187]
 gi|222097287|ref|YP_002531344.1| 16S rRNA-processing protein rimm [Bacillus cereus Q1]
 gi|225865823|ref|YP_002751201.1| 16S rRNA processing protein RimM [Bacillus cereus 03BB102]
 gi|228916479|ref|ZP_04080045.1| Ribosome maturation factor rimM [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|228928890|ref|ZP_04091922.1| Ribosome maturation factor rimM [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228935156|ref|ZP_04097983.1| Ribosome maturation factor rimM [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228947561|ref|ZP_04109851.1| Ribosome maturation factor rimM [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
 gi|228986985|ref|ZP_04147111.1| Ribosome maturation factor rimM [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|229092884|ref|ZP_04224018.1| Ribosome maturation factor rimM [Bacillus cereus Rock3-42]
 gi|229123356|ref|ZP_04252560.1| Ribosome maturation factor rimM [Bacillus cereus 95/8201]
 gi|229140485|ref|ZP_04269040.1| Ribosome maturation factor rimM [Bacillus cereus BDRD-ST26]
 gi|229157418|ref|ZP_04285496.1| Ribosome maturation factor rimM [Bacillus cereus ATCC 4342]
 gi|229186082|ref|ZP_04313251.1| Ribosome maturation factor rimM [Bacillus cereus BGSC 6E1]
 gi|229197952|ref|ZP_04324667.1| Ribosome maturation factor rimM [Bacillus cereus m1293]
 gi|254720890|ref|ZP_05182681.1| 16S rRNA-processing protein RimM [Bacillus anthracis str. A1055]
 gi|301055332|ref|YP_003793543.1| 16S rRNA-processing protein [Bacillus anthracis CI]
 gi|59798280|sp|Q6HEX3|RIMM_BACHK RecName: Full=Ribosome maturation factor rimM
 gi|59798339|sp|Q732M8|RIMM_BACC1 RecName: Full=Ribosome maturation factor rimM
 gi|209573750|sp|A0RHL5|RIMM_BACAH RecName: Full=Ribosome maturation factor rimM
 gi|226694910|sp|B7HLH5|RIMM_BACC7 RecName: Full=Ribosome maturation factor rimM
 gi|254797743|sp|C1EP66|RIMM_BACC3 RecName: Full=Ribosome maturation factor rimM
 gi|254797744|sp|B9IVD1|RIMM_BACCQ RecName: Full=Ribosome maturation factor rimM
 gi|42738861|gb|AAS42789.1| 16S rRNA processing protein RimM [Bacillus cereus ATCC 10987]
 gi|49180619|gb|AAT55995.1| 16S rRNA processing protein RimM [Bacillus anthracis str. Sterne]
 gi|49333184|gb|AAT63830.1| 16S rRNA processing protein [Bacillus thuringiensis serovar
           konkukian str. 97-27]
 gi|217067406|gb|ACJ81656.1| 16S rRNA processing protein RimM [Bacillus cereus AH187]
 gi|221241345|gb|ACM14055.1| 16S rRNA processing protein [Bacillus cereus Q1]
 gi|225790577|gb|ACO30794.1| 16S rRNA processing protein RimM [Bacillus cereus 03BB102]
 gi|228585531|gb|EEK43634.1| Ribosome maturation factor rimM [Bacillus cereus m1293]
 gi|228597258|gb|EEK54909.1| Ribosome maturation factor rimM [Bacillus cereus BGSC 6E1]
 gi|228626145|gb|EEK82894.1| Ribosome maturation factor rimM [Bacillus cereus ATCC 4342]
 gi|228643046|gb|EEK99322.1| Ribosome maturation factor rimM [Bacillus cereus BDRD-ST26]
 gi|228660132|gb|EEL15768.1| Ribosome maturation factor rimM [Bacillus cereus 95/8201]
 gi|228690506|gb|EEL44289.1| Ribosome maturation factor rimM [Bacillus cereus Rock3-42]
 gi|228772763|gb|EEM21203.1| Ribosome maturation factor rimM [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|228812081|gb|EEM58412.1| Ribosome maturation factor rimM [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
 gi|228824521|gb|EEM70326.1| Ribosome maturation factor rimM [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228830697|gb|EEM76302.1| Ribosome maturation factor rimM [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228843058|gb|EEM88140.1| Ribosome maturation factor rimM [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|300377501|gb|ADK06405.1| 16S rRNA-processing protein [Bacillus cereus biovar anthracis str.
           CI]
 gi|324327739|gb|ADY22999.1| 16S rRNA-processing protein RimM [Bacillus thuringiensis serovar
           finitimus YBT-020]
          Length = 171

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 80/169 (47%), Gaps = 14/169 (8%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNR--ELRILKM--YRKNKRF- 60
           +  I  THG+ GE+ + S  + P +  RY     LY ++ +  E   +K+  +R++K F 
Sbjct: 7   VGKIVNTHGVKGEIRVVSRTDFPEE--RYKVGNTLYISNEKGGEPFPVKITSHRQHKTFD 64

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           + TF G  N++   + +   L          EL E E++  ++        +G+  G + 
Sbjct: 65  LLTFEGYGNVNEVEQFKGSLLKVPEDQLG--ELAEGEYYYHEIIGCNVVTEEGEALGTIK 122

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
            V + GA  +  IK    +  LIP+    VL+VN+ ENK++   +  GL
Sbjct: 123 EVLSPGANDVWVIKRPKGQDLLIPYIDDVVLQVNI-ENKLVTIHVMEGL 170


>gi|148979278|ref|ZP_01815432.1| 16S rRNA-processing protein [Vibrionales bacterium SWAT-3]
 gi|145961926|gb|EDK27217.1| 16S rRNA-processing protein [Vibrionales bacterium SWAT-3]
          Length = 184

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 78/173 (45%), Gaps = 12/173 (6%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNR----ELRILKMYRK 56
           M K D+ ++M   G T+G+ G + + SY +N   +  Y  +  + +    E ++    R 
Sbjct: 9   MSKQDEKIVMGKFGATYGIRGWLKVFSYTDNAESIFDYSPWYVNQKGKWVEFKVESWKRH 68

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           NK  +    G +    A  L + ++          EL E+EF+  +L  M+    +G   
Sbjct: 69  NKGMVCKLEGFEVREDAHVLTNFEIAIDPASLP--ELSEEEFYWRELFGMQVVTTKGYDL 126

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTF-----LIPFTKFAVL-EVNLQENKILID 163
           G V  +   G+  +L IK  ++  F     L+P+ +  V+ +V+ +  +I +D
Sbjct: 127 GVVTDMLETGSNDVLVIKANLKDAFGQKERLVPYLEEQVVKKVDREAQRIEVD 179


>gi|327329803|gb|EGE71559.1| 16S rRNA processing protein RimM [Propionibacterium acnes HL096PA3]
          Length = 179

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 69/159 (43%), Gaps = 5/159 (3%)

Query: 16  THGLNGEVYIDSYANNP---IDLNRYVLYSNDNRELRILKMYRKNKRFIATFSGIDNIHS 72
            HGL G+V ++   + P     +   V      R+L +++       FI  F  + +   
Sbjct: 17  AHGLRGDVVVEVRTDEPDARFGVGATVQIEGSRRDLTVVRSRWAKGCFIVAFDEVKDRQG 76

Query: 73  ASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFGAGSILE 132
           A ELR   L    +   D+  + DEF++  L  +   D  GK  G V  V +  A  +L 
Sbjct: 77  AEELRGSVLVVDVEP-NDDPDDPDEFWDRRLRGLTVVDESGKSRGAVKDVLHMPAQDVLV 135

Query: 133 IKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN 171
           I  + E+  L+PF    V  V++   +I++  I   L++
Sbjct: 136 IDVSGEE-HLVPFVHQLVPTVDVASGRIVVSGIPGLLDS 173


>gi|239826593|ref|YP_002949217.1| 16S rRNA-processing protein RimM [Geobacillus sp. WCH70]
 gi|259585645|sp|C5D8U4|RIMM_GEOSW RecName: Full=Ribosome maturation factor rimM
 gi|239806886|gb|ACS23951.1| 16S rRNA processing protein RimM [Geobacillus sp. WCH70]
          Length = 172

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 75/173 (43%), Gaps = 9/173 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-----YVLYSNDNRELRI-LKMYRKN 57
           ++K   +  I  THG+ GEV + S  + P +  +     Y+        + + +K +R +
Sbjct: 1   MEKWFNVGKIVNTHGIRGEVRVISRTDFPEERYKKGNTLYIFMEKSKEPVAVTVKSHRVH 60

Query: 58  KRF-IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           K F +  F G DNI+   + +   L          EL+E E++  ++        +G+  
Sbjct: 61  KSFDLLAFEGYDNINLVEKFKGAMLKVPESQLG--ELDEGEYYFHEIIGCTVVTEEGETI 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           G V  +   GA  +  +K    K  LIP+ +  V  V+++   I I P+   L
Sbjct: 119 GTVKEILTPGANDVWVVKRDNGKEVLIPYIEDVVKNVDVETKTITIRPMEGLL 171


>gi|289423978|ref|ZP_06425770.1| 16S rRNA processing protein RimM [Peptostreptococcus anaerobius
           653-L]
 gi|289155614|gb|EFD04287.1| 16S rRNA processing protein RimM [Peptostreptococcus anaerobius
           653-L]
          Length = 171

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 75/161 (46%), Gaps = 9/161 (5%)

Query: 15  TTHGLNGEVYIDSYANNPID----LNRYVLYSNDNRELRILKMYR-KNKRFIATFSGIDN 69
           TT GL G++ + SY +N ID    L+ + +  +  ++ ++ K  +  N   +      D 
Sbjct: 15  TTRGLKGDLKVYSYTDN-IDRFKELDYFYIGKDRTKKYQVEKTSKISNDMVVIKIKSYDT 73

Query: 70  IHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFGAGS 129
           I S        LY  R +    EL++DE    D+  M+     G+Y G++  V  + A  
Sbjct: 74  IESVQAFIQKDLYVDRSN--TYELDDDEMLIVDMIGMKVETVDGEYIGELKEVLQYSAND 131

Query: 130 ILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           +  +K + +K FLIP T   V +++ +   I + PI   L+
Sbjct: 132 VYIVKGS-DKEFLIPATYEIVPKIDKEARIIKVKPIPGLLD 171


>gi|312795478|ref|YP_004028400.1| 16S rRNA processing protein rimM [Burkholderia rhizoxinica HKI 454]
 gi|312167253|emb|CBW74256.1| 16S rRNA processing protein rimM [Burkholderia rhizoxinica HKI 454]
          Length = 219

 Score = 46.6 bits (109), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 55/126 (43%), Gaps = 10/126 (7%)

Query: 46  RELRILKMYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEE 105
           R  +++     +   +A  +G  +   A  LR   ++ +R DF    LE DE++  DL  
Sbjct: 91  RAAQVVSSKAHSATVVAQLAGCADRDQAFALRGATVHVRRADFP--ALERDEYYWVDLIG 148

Query: 106 METFDRQGKYWGQVCGVYNFGAGSILEIK--------NTMEKTFLIPFTKFAVLEVNLQE 157
           +   +  G   GQV  + + GA SIL ++           +   LIPF    V  V   +
Sbjct: 149 LAVVNEFGDALGQVVALMDNGAHSILRVEYDEVGRDGRIKKAQRLIPFVDAYVKTVEPSD 208

Query: 158 NKILID 163
            +I++D
Sbjct: 209 RRIVVD 214


>gi|317133000|ref|YP_004092314.1| 16S rRNA processing protein RimM [Ethanoligenens harbinense YUAN-3]
 gi|315470979|gb|ADU27583.1| 16S rRNA processing protein RimM [Ethanoligenens harbinense YUAN-3]
          Length = 173

 Score = 46.6 bits (109), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 65/157 (41%), Gaps = 7/157 (4%)

Query: 13  IGTTHGLNGEVYIDSYANNPIDLNRY--VLYSNDNRELRILKMYRKNKRF-IATFSGIDN 69
           I  T GL GEV +  + ++P  L ++       + +  R +   R +K   +  F G + 
Sbjct: 12  IVATQGLRGEVRVQPWCDSPDFLLQFGGFFLDGEGKNYRKVTDARVHKHMAVLKFEGAET 71

Query: 70  IHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDR-QGKYWGQVCGVYNFGAG 128
           +  A  L    LY  R   K  +L E   F  DL  M+  D   G  +G++  V   GA 
Sbjct: 72  VEDAMALLRRVLYIDR---KTVDLPEGSHFEQDLIGMDVVDAGDGHAYGKLTEVLRTGAN 128

Query: 129 SILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPI 165
            +  + +   K  LIP     V EV+     + I P+
Sbjct: 129 DVYTVTDAAGKEVLIPAIPDVVREVDTDAGVMHITPL 165


>gi|86149933|ref|ZP_01068162.1| 16S rRNA processing protein RimM [Campylobacter jejuni subsp.
           jejuni CF93-6]
 gi|88596991|ref|ZP_01100227.1| 16S rRNA processing protein RimM [Campylobacter jejuni subsp.
           jejuni 84-25]
 gi|218562351|ref|YP_002344130.1| putative 16S rRNA processing protein [Campylobacter jejuni subsp.
           jejuni NCTC 11168]
 gi|14423901|sp|Q9PPJ5|RIMM_CAMJE RecName: Full=Ribosome maturation factor rimM
 gi|85839751|gb|EAQ57011.1| 16S rRNA processing protein RimM [Campylobacter jejuni subsp.
           jejuni CF93-6]
 gi|88190680|gb|EAQ94653.1| 16S rRNA processing protein RimM [Campylobacter jejuni subsp.
           jejuni 84-25]
 gi|112360057|emb|CAL34849.1| putative 16S rRNA processing protein [Campylobacter jejuni subsp.
           jejuni NCTC 11168]
 gi|284925968|gb|ADC28320.1| 16S rRNA processing protein RimM [Campylobacter jejuni subsp.
           jejuni IA3902]
 gi|315926827|gb|EFV06201.1| 16S rRNA processing protein RimM [Campylobacter jejuni subsp.
           jejuni DFVF1099]
 gi|315929640|gb|EFV08821.1| 16S rRNA processing protein RimM [Campylobacter jejuni subsp.
           jejuni 305]
          Length = 179

 Score = 46.6 bits (109), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 78/167 (46%), Gaps = 17/167 (10%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNR-YVLYSNDNRELRILKMYRKNKRFIATFS 65
            V +A +G T GL G V + + ++      +    +  + +E+  +K Y  N   +  F 
Sbjct: 6   FVQVAKLGKTVGLKGYVKLHNLSDFSSQFKKDATFFIKNTKEMLKIKHYNANNSTVL-FE 64

Query: 66  GIDNIHSASELRDLKLYAK----RQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
             ++I  A EL +L L+      RQ  K   L++DEFF  D+ E E F+ + K  G+V  
Sbjct: 65  NYEDIEKAKELTNLILFQSIEKSRQTCK---LKKDEFFYFDILECEVFE-EDKRLGKVVD 120

Query: 122 VYNFGAGSILEIKN-------TMEKTFLIPFTKFAVLEVNLQENKIL 161
           +   GA  + EI++          K F IP+    V  +++++ +I 
Sbjct: 121 ILETGASYLFEIQSDEKWVEKKYPKIFFIPYLDKFVKNIDIEKRQIF 167


>gi|241759337|ref|ZP_04757443.1| 16S rRNA processing protein RimM [Neisseria flavescens SK114]
 gi|241320473|gb|EER56770.1| 16S rRNA processing protein RimM [Neisseria flavescens SK114]
          Length = 169

 Score = 46.6 bits (109), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 70/168 (41%), Gaps = 9/168 (5%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDS---YANNPIDLNRYVLYSNDNRELRILKMYRK- 56
           M    K V M  I    G+ G + I +   Y ++ +D   + L   D + L ++    K 
Sbjct: 1   MTDTQKRVAMGYIKGVFGIKGWLKIAANTEYTDSLLDYPEWQL-CKDGKTLNVVLEAGKI 59

Query: 57  -NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
            N      F GID+   A  LR   +   R+ F     EEDE++  DL  M   +++   
Sbjct: 60  VNGELQVKFEGIDDRDQAFALRGYTIEIPRESFA--PTEEDEYYWADLVGMTVINKENIV 117

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
            G+V  +   GA  +L IK    +  LIPF    +  V+     I+ D
Sbjct: 118 LGKVSNLMETGANDVLMIKGEHGQ-ILIPFVSNYIESVDTDSKTIITD 164


>gi|240146495|ref|ZP_04745096.1| 16S rRNA processing protein RimM [Roseburia intestinalis L1-82]
 gi|257201351|gb|EEU99635.1| 16S rRNA processing protein RimM [Roseburia intestinalis L1-82]
 gi|291535149|emb|CBL08261.1| 16S rRNA processing protein RimM [Roseburia intestinalis M50/1]
          Length = 194

 Score = 46.6 bits (109), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/157 (24%), Positives = 72/157 (45%), Gaps = 6/157 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPI---DLNRYVL-YSNDNRELRILKMYRKNKR 59
           ++ L+ +  I TTHG+ GEV +    ++      L + +L    ++  L I  +      
Sbjct: 18  MENLLQVGVITTTHGVRGEVKVFPTTDDAARFKKLKQVILDTGKEHLALEIAGVKFFKNM 77

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F G DNI+     R   LY  R++    +L+++E+F  DL  ++    +G+  G++
Sbjct: 78  VILKFKGYDNINDVEMFRKKSLYVTREN--AVKLKKNEYFIADLIGLKVISDEGEDLGEL 135

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQ 156
             V   GA  +  I        L+P  K  V +V+++
Sbjct: 136 TDVLQTGANDVYVISKEGADDILLPAIKDCVKQVDIE 172


>gi|306836396|ref|ZP_07469374.1| 16S rRNA processing protein RimM [Corynebacterium accolens ATCC
           49726]
 gi|304567756|gb|EFM43343.1| 16S rRNA processing protein RimM [Corynebacterium accolens ATCC
           49726]
          Length = 165

 Score = 46.6 bits (109), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/164 (22%), Positives = 69/164 (42%), Gaps = 15/164 (9%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVL-------YSNDNRELRILKMYRKNKRF 60
           +++  +  +HG+ GEV ++   + P    R+ +             EL I  +     R 
Sbjct: 3   LMIGRVIKSHGIKGEVVVEPTTDEP--EVRFAVGEKLQGRQGRKEHELTISAVRSHKGRL 60

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           + T   I +   A  LR  + +A   +  DE      F++ +LE +    R G+  G V 
Sbjct: 61  LVTCKEIADRTQADSLRGTQFFAAPLEDDDEG-----FYDHELEGLRVI-RDGEDIGAVV 114

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
            V +  +  +LE++     + L+PF    V EV+++     I P
Sbjct: 115 SVVHGPSQDLLEVELASGSSALVPFVHAIVPEVDVEAGTCTIQP 158


>gi|206901833|ref|YP_002251244.1| 16S rRNA processing protein RimM [Dictyoglomus thermophilum H-6-12]
 gi|206740936|gb|ACI19994.1| 16S rRNA processing protein RimM [Dictyoglomus thermophilum H-6-12]
          Length = 166

 Score = 46.6 bits (109), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/163 (23%), Positives = 78/163 (47%), Gaps = 10/163 (6%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNR----YVLYSND---NRELRILKMYRKNKR 59
           +V +A +G   G+ G + I  + +    L +    Y+ + +     REL +  +   NK 
Sbjct: 1   MVRIAKLGEPFGIKGGIKIWPFFDLIGTLKKGQKIYLSWGDTLLVRRELSLENIREHNKG 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
           ++  FS I     A ++R   L  + +D    +L E +++   +  +  ++  G+Y G+V
Sbjct: 61  YVIYFSEILTRDEAEKIRGNWLLIEEEDLP--KLPEGQYYTYQIMGLSVYEESGEYLGKV 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
             +   G+  +  ++   E  + IP  K  ++E+NL+E KI+I
Sbjct: 119 KEILETGSNDVYIVEGEEEDIY-IPAIKDVIVEINLEEGKIVI 160


>gi|260775498|ref|ZP_05884395.1| 16S rRNA processing protein RimM [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260608679|gb|EEX34844.1| 16S rRNA processing protein RimM [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 182

 Score = 46.6 bits (109), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/166 (23%), Positives = 75/166 (45%), Gaps = 12/166 (7%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNR----ELRILKMYRKNKRFIAT 63
           +++   G T+G+ G + + SY +N   +  Y  +  + +    E ++    R NK  +  
Sbjct: 14  IVVGKFGATYGIRGWLKVFSYTDNTESIFDYAPWFINQKGEWVERKVESWKRHNKGLVVK 73

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
             G+D    A  L + ++          EL EDEF+  DL  M+    +G   G V  + 
Sbjct: 74  LEGLDVREEAQLLTNFEIAIDPAVLP--ELPEDEFYWRDLIGMQVVTDKGYDLGTVSDML 131

Query: 124 NFGAGSILEIKNTMEKTF-----LIPFTKFAVLE-VNLQENKILID 163
             G+  +L +K  ++  F     LIPF +  V++ ++ +  +I +D
Sbjct: 132 ETGSNDVLVVKANLKDAFGQKERLIPFLEEQVIKLIDREAQRIEVD 177


>gi|229541112|ref|ZP_04430172.1| 16S rRNA processing protein RimM [Bacillus coagulans 36D1]
 gi|229325532|gb|EEN91207.1| 16S rRNA processing protein RimM [Bacillus coagulans 36D1]
          Length = 172

 Score = 46.6 bits (109), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 76/163 (46%), Gaps = 9/163 (5%)

Query: 10  MATIGTTHGLNGEVYIDSYAN------NPIDLNRYVLYSNDNRELRILKMYRKNKRF-IA 62
           +  I  THG+ GEV + S  +       P +     L   D      ++ +R +K+F + 
Sbjct: 7   VGKIVNTHGIRGEVRVISQTDFKAERYKPGNTLYLFLPGRDEPLAVTIESHRVHKQFDLL 66

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F G D+I  A + +   L    +    +EL E+EF+  ++   E     G+  G V  +
Sbjct: 67  KFEGFDSIEEAEKWKGGMLKVSEEQL--DELGENEFYFHEIIGCEVVTTAGEKVGTVKEI 124

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPI 165
              GA  +  +K   +K  LIP+ +  V +V+ +E +I+I+P+
Sbjct: 125 LTPGANDVWVVKTAQQKEALIPYIEDVVKKVDKKEKRIVIEPM 167


>gi|104774247|ref|YP_619227.1| 16S rRNA-processing protein RimM [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC 11842]
 gi|116514337|ref|YP_813243.1| 16S rRNA-processing protein RimM [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC BAA-365]
 gi|122274931|sp|Q049R7|RIMM_LACDB RecName: Full=Ribosome maturation factor rimM
 gi|122397101|sp|Q1G9L3|RIMM_LACDA RecName: Full=Ribosome maturation factor rimM
 gi|103423328|emb|CAI98171.1| 16S rRNA processing protein RimM [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC 11842]
 gi|116093652|gb|ABJ58805.1| 16S rRNA processing protein RimM [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC BAA-365]
 gi|325126033|gb|ADY85363.1| Probable 16S rRNA processing protein rimM [Lactobacillus
           delbrueckii subsp. bulgaricus 2038]
          Length = 167

 Score = 46.6 bits (109), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/158 (22%), Positives = 76/158 (48%), Gaps = 6/158 (3%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNRY---VLYSNDNRELRILKMYRKNKRFIATFSG 66
           +  I  THGL GEV +    + P D  R    +   +D+RE+ +       + ++ TF+ 
Sbjct: 6   VGKIIATHGLKGEVKVALTTDFPEDRFRAGSRLYLGDDSREVTVAAGRPFKQFWLVTFAE 65

Query: 67  IDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQ-GKYWGQVCGVYNF 125
           I +I  A +L+  ++    +D    EL +  ++  +L   +  D + G+  G++  +   
Sbjct: 66  ITDIDQAEKLKGTEILISEED--QGELPDGVYYYRELLGCKVLDDESGEEIGELTDIEAP 123

Query: 126 GAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
           GA  I E+ +   K+F +P+    V  V++ + ++ ++
Sbjct: 124 GANDIWEVTDKNGKSFWLPYIPQVVKSVDIDKKEVRVE 161


>gi|262046942|ref|ZP_06019902.1| 16S rRNA processing protein RimM [Lactobacillus crispatus MV-3A-US]
 gi|260572924|gb|EEX29484.1| 16S rRNA processing protein RimM [Lactobacillus crispatus MV-3A-US]
          Length = 171

 Score = 46.6 bits (109), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 73/159 (45%), Gaps = 7/159 (4%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPID---LNRYVLYSNDNRELRILKMYRKNKRF-IATFS 65
           +A I TTHGLNGEV +    + P D   +  ++    +  ++  +   R  K+F +  F+
Sbjct: 6   VARILTTHGLNGEVKVSIITDFPEDRFAIGMHLAIKGETSQVLTVAKSRPFKQFWLVQFA 65

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQ-GKYWGQVCGVYN 124
            I +I  A +L+   L     D    EL E  ++  D+ +    D + GK  G++  + +
Sbjct: 66  EITDIDQAEKLKGKILVVSEADRG--ELPEGVYYYKDIFDCNVIDEESGKRLGKITDIES 123

Query: 125 FGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
            GA  I  +     K + IP     V +V++   K+ ++
Sbjct: 124 PGANDIWLVHEDNGKEYWIPNIASVVKKVDVANKKVYVE 162


>gi|323466315|gb|ADX70002.1| Ribosome maturation factor rimM [Lactobacillus helveticus H10]
          Length = 171

 Score = 46.6 bits (109), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 79/169 (46%), Gaps = 12/169 (7%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNRYV------LYSNDNRELRILKMYRKNKRFIAT 63
           +A I TTH LNGEV ++   + P    R+       L S+ NR L + K     + ++  
Sbjct: 6   VARILTTHRLNGEVKVNVITDFP--EERFAEGMHLSLRSDTNRTLTVEKSRPFKQFWLIQ 63

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQ-GKYWGQVCGV 122
           F  I +I  A +LR   L    +D    EL +  ++  D+ + +  D + GK  G++  +
Sbjct: 64  FKEITDIDQAEKLRGQILVVSEEDRG--ELPDGVYYYKDIFDCDVIDEETGKRIGKIVDI 121

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN 171
            + GA  I  ++    K + IP     V +V++   K+ ++ +  GL +
Sbjct: 122 QSPGANDIWLVREDDVKEYWIPNIADVVKKVDVAAKKVYVE-LMEGLRD 169


>gi|72161068|ref|YP_288725.1| 16S rRNA-processing protein RimM [Thermobifida fusca YX]
 gi|109893064|sp|Q47S65|RIMM_THEFY RecName: Full=Ribosome maturation factor rimM
 gi|71914800|gb|AAZ54702.1| 16S rRNA processing protein RimM [Thermobifida fusca YX]
          Length = 170

 Score = 46.6 bits (109), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/163 (22%), Positives = 72/163 (44%), Gaps = 10/163 (6%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY------SNDNRELRILKMYRKNKRFI 61
           +++  IG  HG+ GEV ++   ++P +  R+V+         D   L I        R +
Sbjct: 3   LVVGRIGRPHGVKGEVTVEVRTDSPEE--RFVVGKALETDPADVGPLTITAQRWHKDRLL 60

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
             F  + +  +A +LR + L     +    + + DEF + +L  +      G+  G+V  
Sbjct: 61  VRFEEVPDRTAAEQLRGVFLVVDSAELPPLD-DPDEFHDHELIGLRVETVDGEAVGEVVD 119

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           V +  A  +L +        L+PF +  V +V+    +++IDP
Sbjct: 120 VLHH-AQDMLVVSGEKGSEVLVPFVRELVPDVDTAAGRVVIDP 161


>gi|283953922|ref|ZP_06371451.1| putative 16S rRNA processing protein [Campylobacter jejuni subsp.
           jejuni 414]
 gi|283794527|gb|EFC33267.1| putative 16S rRNA processing protein [Campylobacter jejuni subsp.
           jejuni 414]
          Length = 178

 Score = 46.6 bits (109), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/166 (25%), Positives = 79/166 (47%), Gaps = 16/166 (9%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNR-YVLYSNDNRELRILKMYRKNKRFIATFS 65
            V +A +G T GL G V + + ++      +    +  + RE+  +K Y  +   +  F 
Sbjct: 6   FVQVAKLGKTVGLKGYVKLHNLSDFSSQFKKDATFFIKNTREILKIKHYNISSSTVL-FE 64

Query: 66  GIDNIHSASELRDLKLYAK----RQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
             +++  A EL +L L+      RQ  K   L++DEFF  D+ E E F+ + K  G+V  
Sbjct: 65  NYEDVEKAKELTNLILFQSIEKSRQTCK---LKKDEFFYFDILECEVFE-EDKRLGKVID 120

Query: 122 VYNFGAGSILEIKN------TMEKTFLIPFTKFAVLEVNLQENKIL 161
           +   G+  + EI++         KTF IP+    V  +++++ +I 
Sbjct: 121 ILETGSSYLFEIQSDEKWVKKYSKTFFIPYLDKFVKNIDIEKRQIF 166


>gi|289662768|ref|ZP_06484349.1| 16S rRNA-processing protein RimM [Xanthomonas campestris pv.
           vasculorum NCPPB702]
 gi|289670358|ref|ZP_06491433.1| 16S rRNA-processing protein RimM [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 170

 Score = 46.6 bits (109), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/168 (20%), Positives = 78/168 (46%), Gaps = 8/168 (4%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY---VLYSNDNRELRI--LKMYR 55
           M + ++ +L+  +    G+ GE+ ++S+      + RY   ++ +   +E  I  ++   
Sbjct: 1   MKQTERRILLGRVVGAFGVKGELKLESWTEPRNAIFRYQPWIVRAPSGQESVISGVRGRD 60

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
           + K  IA F  + +  +   +   ++Y  R      +   DE++  DLEE++    +G  
Sbjct: 61  QGKNLIAVFPDVTDRDTVEAMHGTEIYVARSALPPPK--PDEYYWVDLEELQVETVEGVK 118

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
            G V  +++ G+  ++ ++   E+     F  F V  V+ + N I++D
Sbjct: 119 LGTVSHLFSTGSNDVVVVRGDRERMIPFVFPDF-VKSVDFEANLIVVD 165


>gi|302525174|ref|ZP_07277516.1| 16S rRNA processing protein RimM [Streptomyces sp. AA4]
 gi|302434069|gb|EFL05885.1| 16S rRNA processing protein RimM [Streptomyces sp. AA4]
          Length = 171

 Score = 46.6 bits (109), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/165 (24%), Positives = 72/165 (43%), Gaps = 12/165 (7%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYV--------LYSNDNRELRILKMYRKNKR 59
           V++  I   HG+ GE+ +D   ++P    R+         L     REL I      + R
Sbjct: 3   VVVGRIAKAHGIRGELAVDVRTDSP--QERFAIGAVVTTKLRDGSTRELTIAAAREHSGR 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +  F  +     A  LR   L A   D      + DEF++ +L  +      G   G+V
Sbjct: 61  LLVRFEEVLTRDVAETLRGALLLAD-TDSLPPTGDPDEFYDHELAGLRAELTDGTVVGKV 119

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
             V +  AG +LE+ +   ++ L+PF +  V  V++   ++++DP
Sbjct: 120 VEVVHSPAGELLELDHD-GRSVLVPFVRAIVPVVDVAGGRVVLDP 163


>gi|118479064|ref|YP_896215.1| 16S rRNA-processing protein RimM [Bacillus thuringiensis str. Al
           Hakam]
 gi|118418289|gb|ABK86708.1| 16S rRNA processing protein RimM [Bacillus thuringiensis str. Al
           Hakam]
          Length = 193

 Score = 46.6 bits (109), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 80/169 (47%), Gaps = 14/169 (8%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNR--ELRILKM--YRKNKRF- 60
           +  I  THG+ GE+ + S  + P +  RY     LY ++ +  E   +K+  +R++K F 
Sbjct: 29  VGKIVNTHGVKGEIRVVSRTDFPEE--RYKVGNTLYISNEKGGEPFPVKITSHRQHKTFD 86

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           + TF G  N++   + +   L          EL E E++  ++        +G+  G + 
Sbjct: 87  LLTFEGYGNVNEVEQFKGSLLKVPEDQLG--ELAEGEYYYHEIIGCNVVTEEGEALGTIK 144

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
            V + GA  +  IK    +  LIP+    VL+VN+ ENK++   +  GL
Sbjct: 145 EVLSPGANDVWVIKRPKGQDLLIPYIDDVVLQVNI-ENKLVTIHVMEGL 192


>gi|56419735|ref|YP_147053.1| 16S rRNA-processing protein RimM [Geobacillus kaustophilus HTA426]
 gi|67461272|sp|Q5L0P5|RIMM_GEOKA RecName: Full=Ribosome maturation factor rimM
 gi|56379577|dbj|BAD75485.1| 16S rRNA processing protein [Geobacillus kaustophilus HTA426]
          Length = 175

 Score = 46.6 bits (109), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/176 (22%), Positives = 74/176 (42%), Gaps = 9/176 (5%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-----YVLYSNDNRELRI-LKMY 54
           M  +++   +  I  THG+ GEV + S  + P +  +     Y+    D   + + +K +
Sbjct: 1   MKAMERWFNVGKIVNTHGIRGEVRVISRTDFPEERYKKGNKLYIFRERDTEPIEVTVKSH 60

Query: 55  RKNKRF-IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQG 113
           R +K F + +F G D+I+     +   L          EL E E++  ++         G
Sbjct: 61  RVHKSFDLLSFEGYDSINDVERFKGAMLKVPESQLG--ELAEGEYYFHEIIGCTVVTEGG 118

Query: 114 KYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           +  G V  +   GA  +  ++       LIP+    VL V+ +   I+I P+   L
Sbjct: 119 ETIGAVKEILTPGANDVWVVRREDGSEALIPYIDEVVLHVDPERKTIIIRPMEGLL 174


>gi|116671027|ref|YP_831960.1| 16S rRNA-processing protein RimM [Arthrobacter sp. FB24]
 gi|171855198|sp|A0JXU0|RIMM_ARTS2 RecName: Full=Ribosome maturation factor rimM
 gi|116611136|gb|ABK03860.1| 16S rRNA processing protein RimM [Arthrobacter sp. FB24]
          Length = 197

 Score = 46.6 bits (109), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 71/163 (43%), Gaps = 15/163 (9%)

Query: 10  MATIGTTHGLNGEVYIDSYANNP----IDLNRYVLYSNDNRELRILKMYRKNKRFIATFS 65
           +A IG  HG+ GEV +    + P    I   R+V+       L +          +  F 
Sbjct: 5   VARIGKPHGIRGEVTVQVLTDAPEDRFIPGTRFVVEPASAGPLTVDSARWNKDILLLGFE 64

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELE---EDEFFNTDLEEMETFDRQG-KYWGQVCG 121
           GI+  + A  LR  KL+ + ++ ++E+ E   E E    D+       R G    G + G
Sbjct: 65  GIETRNQAEALRGAKLFIETEELEEEDDEGWYEHELVGLDV-------RVGDAVVGTISG 117

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           +       ++ +++   K  LIPF +  V EVN+ E  IL+ P
Sbjct: 118 LRTLPVQDLIVVESPDGKEILIPFVEEIVPEVNVGEKYILVTP 160


>gi|57237014|ref|YP_178816.1| 16S rRNA processing protein RimM [Campylobacter jejuni RM1221]
 gi|67461263|sp|Q5HV69|RIMM_CAMJR RecName: Full=Ribosome maturation factor rimM
 gi|57165818|gb|AAW34597.1| 16S rRNA processing protein RimM [Campylobacter jejuni RM1221]
 gi|315058175|gb|ADT72504.1| 16S rRNA processing protein RimM [Campylobacter jejuni subsp.
           jejuni S3]
          Length = 179

 Score = 46.6 bits (109), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 78/167 (46%), Gaps = 17/167 (10%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNR-YVLYSNDNRELRILKMYRKNKRFIATFS 65
            V +A +G T GL G V + + ++      +    +  + +E+  +K Y  N   +  F 
Sbjct: 6   FVQVAKLGKTVGLKGYVKLHNLSDFSSQFKKDATFFIKNTKEMLKIKHYNANNSTVL-FE 64

Query: 66  GIDNIHSASELRDLKLYAK----RQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
             ++I  A EL +L L+      RQ  K   L++DEFF  D+ E E F+ + K  G+V  
Sbjct: 65  NYEDIEKAKELTNLILFQSIEKSRQTCK---LKKDEFFYFDILECEVFE-EDKRLGKVVD 120

Query: 122 VYNFGAGSILEIKN-------TMEKTFLIPFTKFAVLEVNLQENKIL 161
           +   GA  + EI++          K F IP+    V  +++++ +I 
Sbjct: 121 ILETGASYLFEIQSDEKWVEKKYPKIFFIPYLGKFVKNIDIEKRQIF 167


>gi|225075459|ref|ZP_03718658.1| hypothetical protein NEIFLAOT_00464 [Neisseria flavescens
           NRL30031/H210]
 gi|224953277|gb|EEG34486.1| hypothetical protein NEIFLAOT_00464 [Neisseria flavescens
           NRL30031/H210]
          Length = 169

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 70/168 (41%), Gaps = 9/168 (5%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDS---YANNPIDLNRYVLYSNDNRELRILKMYRK- 56
           M    K V M  I    G+ G + I +   Y ++ +D   + L   D + L ++    K 
Sbjct: 1   MTNTQKRVAMGYIKGVFGIKGWLKIAANTEYTDSLLDYPEWQL-CKDGKTLNVVLETGKI 59

Query: 57  -NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
            N      F GID+   A  LR   +   R+ F     EEDE++  DL  M   +++   
Sbjct: 60  VNGELQVKFEGIDDRDQAFALRGYTIEIPRESFA--PTEEDEYYWADLVGMTVINKENII 117

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
            G+V  +   GA  +L IK    +  LIPF    +  V+     I+ D
Sbjct: 118 LGKVSNLMETGANDVLMIKGEHGQ-ILIPFVSNYIESVDTDSKTIIAD 164


>gi|311898560|dbj|BAJ30968.1| putative 16S rRNA-processing protein RimM [Kitasatospora setae
           KM-6054]
          Length = 210

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/171 (21%), Positives = 77/171 (45%), Gaps = 12/171 (7%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNP-IDLNRYVLYSNDNRELRILKMYR---KNKRFIAT 63
           +++  IG  HG+ G+V ++   + P + L    +   D   +  L +      + R +  
Sbjct: 3   LVVGKIGRAHGIRGDVSVEVRTDEPELRLGPGAVLLTDPAAIGPLTIESGRVHSGRLLLR 62

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F+G+ +  +A  LR   L A+  D ++   + DE+++  L  ++     G   G++  V 
Sbjct: 63  FAGVKDRTAAEALRGTMLIAE-IDPEETPDDPDEYYDHQLIGLDVVLADGTPVGELTEVI 121

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKI-------LIDPIAA 167
           +     +L ++       L+PF +  V  ++L E ++       LIDP+ A
Sbjct: 122 HLPYQDLLTVQRPDGTEVLVPFVEQIVPVIDLDEQRVVLTPPPGLIDPVDA 172


>gi|168188035|ref|ZP_02622670.1| 16S rRNA processing protein RimM [Clostridium botulinum C str.
           Eklund]
 gi|169294123|gb|EDS76256.1| 16S rRNA processing protein RimM [Clostridium botulinum C str.
           Eklund]
          Length = 162

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/162 (22%), Positives = 71/162 (43%), Gaps = 4/162 (2%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIAT 63
           +++ + +  I  THG+ GEV +    +N            D   + I     +  + I  
Sbjct: 1   MEQFLAVGKIINTHGIKGEVKVMPSTDNVERFKELNEAYIDGNMMEIEGCKFQPGKVILK 60

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
              ID+I  A +L++  +   R+  K   L+ED ++  D+     +D   K  G +  + 
Sbjct: 61  IKDIDSIEDAQKLKNKYIKVNRK--KAVALDEDCYYEADIIGCTVYDENEKQLGTIDEII 118

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPI 165
             G+  +  IK   E   LIP  K  ++++++   KI+I P+
Sbjct: 119 RTGSNDVYWIKG--ENEILIPAIKSIIVDIDVTNKKIIIKPL 158


>gi|225463376|ref|XP_002271571.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|297740629|emb|CBI30811.3| unnamed protein product [Vitis vinifera]
          Length = 665

 Score = 46.2 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 39/140 (27%), Positives = 63/140 (45%), Gaps = 14/140 (10%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNP--------IDLNRYVLYSNDN-RELRIL--KMY 54
           + V +  I + HGL GE+ +    + P        I   R      +  RE+ ++  + +
Sbjct: 76  EFVEVGYISSVHGLQGEIRVKPNTDFPELRFAEPGIRWLRQQFSGKETIREVELVEGRGH 135

Query: 55  RKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEME-TFDRQG 113
              K +I  F GID +  A +L    L  +  D    ELEE EF++ DL  M  T    G
Sbjct: 136 PGQKTWILKFGGIDTVEEAKQLVGSSLLVREDD--RPELEEGEFYSRDLLGMRVTLKETG 193

Query: 114 KYWGQVCGVYNFGAGSILEI 133
           +  G V  V++ GA  +L++
Sbjct: 194 EPVGTVVNVFSTGANDLLQV 213


>gi|78044794|ref|YP_360263.1| 16S rRNA processing protein RimM [Carboxydothermus hydrogenoformans
           Z-2901]
 gi|109893006|sp|Q3AC71|RIMM_CARHZ RecName: Full=Ribosome maturation factor rimM
 gi|77996909|gb|ABB15808.1| 16S rRNA processing protein RimM [Carboxydothermus hydrogenoformans
           Z-2901]
          Length = 172

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/172 (25%), Positives = 83/172 (48%), Gaps = 10/172 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNP---IDLNRYVLYSNDNR-ELRILKMYRKNKR 59
           ++ L+ +  +  T G+ G V ++   ++P   ++  R      D    LRI ++  + +R
Sbjct: 1   MNNLIAIGYVLGTFGIEGWVKVEPLTDHPQRFLNTERVFWEKEDEIFPLRIEEVQLQAER 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDE--ELEEDEFFNTDLEEMETFDRQGKYWG 117
            +  F  I++I  A++L    ++   +  K+E  +L+E+EF+   L+ +  +D   +  G
Sbjct: 61  ILVKFMEINDIKEANKL----IFGYLKIPKNEIVQLKENEFYLFQLKGLTVYDLNYQKIG 116

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
            V  V    A  +L I    +K  L+PF K  V EVNL E  I ++ +   L
Sbjct: 117 VVRTVLKNPANDLLVIDTIHDKELLLPFIKVFVKEVNLPEGFIKVELLPGML 168


>gi|307297776|ref|ZP_07577582.1| 16S rRNA processing protein RimM [Thermotogales bacterium
           mesG1.Ag.4.2]
 gi|306917036|gb|EFN47418.1| 16S rRNA processing protein RimM [Thermotogales bacterium
           mesG1.Ag.4.2]
          Length = 185

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/167 (22%), Positives = 74/167 (44%), Gaps = 11/167 (6%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPI---DLNRYVLYSNDNRELRILKM---YRKN 57
           L+++V +  I   HGL GE+ +     +     ++   +LY    R   +  +    R  
Sbjct: 9   LEEMVPIGRIVKPHGLRGEMKVKVALEDETAFKEIQEVLLYDEKTRSRFVTSIDGARRAT 68

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
           K +I  F GID++  A  L    +Y + +     EL++ E++   +     FD   ++ G
Sbjct: 69  KGWILHFEGIDSMGQAERLVGFHIYVEERVLP--ELKQGEYYYFQILGSSVFDENRRFIG 126

Query: 118 QVCGVYNFGAGSILEIKNTMEKTF---LIPFTKFAVLEVNLQENKIL 161
            V  +   GA  ++ +    + T    LIP  +  +LE+N ++  I+
Sbjct: 127 TVNDIIETGANDVMVVVREEDLTVREELIPIIRDYILELNFEDKTIV 173


>gi|291539679|emb|CBL12790.1| 16S rRNA processing protein RimM [Roseburia intestinalis XB6B4]
          Length = 194

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/157 (24%), Positives = 72/157 (45%), Gaps = 6/157 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPI---DLNRYVL-YSNDNRELRILKMYRKNKR 59
           ++ L+ +  I TTHG+ GEV +    ++      L + +L    ++  L I  +      
Sbjct: 18  MENLLQVGVITTTHGVRGEVKVFPTTDDAARFKKLKQVILDTGKEHLALEIAGVKFFKNM 77

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F G DNI+     R   LY  R++    +L+++E+F  DL  ++    +G+  G++
Sbjct: 78  VILKFKGYDNINDVEMFRKKSLYVTREN--AVKLKKNEYFIADLIGLKMISDEGEDLGEL 135

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQ 156
             V   GA  +  I        L+P  K  V +V+++
Sbjct: 136 TDVLQTGANDVYVISKEGADDILLPAIKDCVKQVDIE 172


>gi|296117624|ref|ZP_06836208.1| 16S rRNA processing protein RimM [Corynebacterium ammoniagenes DSM
           20306]
 gi|295969355|gb|EFG82596.1| 16S rRNA processing protein RimM [Corynebacterium ammoniagenes DSM
           20306]
          Length = 171

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 75/164 (45%), Gaps = 13/164 (7%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNR---ELRILKMYRKNKRF 60
           +L+  +  +HG+ GEV +D   ++P +  R+    VL         E  I  +     R 
Sbjct: 7   LLIGRVIKSHGIKGEVSVDVTTDSPEE--RFYPGAVLNGKQGAKDLEFTISTVRAHKGRL 64

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           + TF  I +   A  LR ++ +A   +  D++   D F++ +LE +      G   G+V 
Sbjct: 65  LLTFEEITDRTQADSLRGVQFFAPPLEDDDDD---DGFYDHELEGL-NLVLDGNVIGEVT 120

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           G+ +    S+LE K    K  LIPF +  V E++L E    I P
Sbjct: 121 GISHGPVQSLLEAKLHNGKEALIPFVEEIVPEIDLDEGTCTITP 164


>gi|325685918|gb|EGD27983.1| 16S rRNA processing protein RimM [Lactobacillus delbrueckii subsp.
           lactis DSM 20072]
          Length = 167

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/158 (22%), Positives = 76/158 (48%), Gaps = 6/158 (3%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNRY---VLYSNDNRELRILKMYRKNKRFIATFSG 66
           +  I  THGL GEV +    + P D  R    +   +D+RE+ +       + ++ TF+ 
Sbjct: 6   VGKIIATHGLKGEVKVALTTDFPEDRFRAGSRLYLGDDSREVTVAAGRPFKQFWLVTFAE 65

Query: 67  IDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQ-GKYWGQVCGVYNF 125
           I +I  A +L+  ++    +D    EL +  ++  +L   +  D + G+  G++  +   
Sbjct: 66  ITDIDQAEKLKGTEILISEED--QGELPDGVYYYRELLGCKVLDDESGEEIGELTDIEAP 123

Query: 126 GAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
           GA  I E+ +   K+F +P+    V  V++ + ++ ++
Sbjct: 124 GANDIWEVTDENGKSFWLPYIPQVVKSVDIDKKEVRVE 161


>gi|229019037|ref|ZP_04175878.1| Ribosome maturation factor rimM [Bacillus cereus AH1273]
 gi|229025283|ref|ZP_04181703.1| Ribosome maturation factor rimM [Bacillus cereus AH1272]
 gi|228736036|gb|EEL86611.1| Ribosome maturation factor rimM [Bacillus cereus AH1272]
 gi|228742277|gb|EEL92436.1| Ribosome maturation factor rimM [Bacillus cereus AH1273]
          Length = 171

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 78/169 (46%), Gaps = 14/169 (8%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNRELRILKM----YRKNKRF- 60
           +  I  THG+ GE+ + S  + P +  RY     LY  + +    L +    +R++K F 
Sbjct: 7   VGKIVNTHGVRGEIRVISRTDFPEE--RYKVGNTLYICNEKGTDYLPVKVTSHRQHKTFD 64

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           + T  G +N+    +L+   +    +     EL E E++  ++        +G+  G + 
Sbjct: 65  LLTLEGYNNVDEVEKLKGSLIKVPEEQLG--ELAEGEYYYHEIIGCSVVTEEGEALGTIK 122

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
            + + GA  +  IK    +  LIP+    VL+VN+ ENK++   +  GL
Sbjct: 123 EILSPGANDVWVIKRPKGQDLLIPYIDDVVLQVNI-ENKLVTIHVMEGL 170


>gi|104783232|ref|YP_609730.1| 16S rRNA-processing protein RimM [Pseudomonas entomophila L48]
 gi|122402143|sp|Q1I5Y9|RIMM_PSEE4 RecName: Full=Ribosome maturation factor rimM
 gi|95112219|emb|CAK16946.1| 16S rRNA processing protein [Pseudomonas entomophila L48]
          Length = 178

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/162 (22%), Positives = 76/162 (46%), Gaps = 10/162 (6%)

Query: 3   KLDKLVLMATIGTTHGLNGEVYIDSYAN---NPIDLNRYVL-YSNDNRELRILKMYRKNK 58
           K D L+++  I + HG+ GEV + S+ +   N +D  R+ L +    +++ ++      K
Sbjct: 7   KADDLIVVGKIFSVHGVRGEVKVYSFTDPIENLLDYPRWTLRHEGKVKQVELVSGRGSQK 66

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
             +    G+D+   A  L   ++   R    +  L  DE++   L  ++  ++    +G+
Sbjct: 67  GLVVKLKGLDDRDEARLLSGHEICISRSLLPN--LATDEYYWYQLVGLKVINQDEHLFGK 124

Query: 119 VCGVYNFGAGSILEIKNTM----EKTFLIPFTKFAVLEVNLQ 156
           +  +   GA  +L +K       ++  L+P+T   VL V+L+
Sbjct: 125 IDHLLETGANDVLVVKPCAGSLDDRERLLPYTGQCVLAVDLE 166


>gi|319944226|ref|ZP_08018502.1| 16S rRNA processing protein RimM [Lautropia mirabilis ATCC 51599]
 gi|319742521|gb|EFV94932.1| 16S rRNA processing protein RimM [Lautropia mirabilis ATCC 51599]
          Length = 195

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 45/91 (49%), Gaps = 6/91 (6%)

Query: 73  ASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFGAGSILE 132
           A  L+ +++   R DF     ++DEF++ DL   E   +QG   G V  V + GA  +L 
Sbjct: 105 ALALKGVEIQVDRADFP--PTQDDEFYHADLIGCEVIGQQGARLGTVVAVDDHGAQQVLR 162

Query: 133 IKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
           + + M    LIPF +  V  V++   +I  D
Sbjct: 163 LDDGM----LIPFVEAIVQSVDIAARRIQAD 189


>gi|291459091|ref|ZP_06598481.1| 16S rRNA processing protein RimM [Oribacterium sp. oral taxon 078
           str. F0262]
 gi|291418345|gb|EFE92064.1| 16S rRNA processing protein RimM [Oribacterium sp. oral taxon 078
           str. F0262]
          Length = 178

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 69/165 (41%), Gaps = 14/165 (8%)

Query: 10  MATIGTTHGLNGEVYIDSYANNP---IDLNRYVLYSN---------DNRELRILKMYRKN 57
           +  I  THGL GE+ +    ++P   ++L +  L              RE  +  +  + 
Sbjct: 7   VGMISATHGLKGELKVIPTTDDPKRFLELKKLRLRKKARGLRREDETEREFSVESVRFQK 66

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
           +  +   SGI+ I  A  LR  +L+  R D     L E E+F  D   +      G+  G
Sbjct: 67  ELVLLKLSGINRIEDAENLRGSELWIDRADAV--ALAEGEYFLGDYIGLRVLTEDGEELG 124

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
           ++  +   GA  +  ++    +  LIP ++  VLE   +E  + I
Sbjct: 125 KIRSILETGANYVFSVEREGGRELLIPNSENCVLEKKPEEGYLRI 169


>gi|84468326|dbj|BAE71246.1| hypothetical protein [Trifolium pratense]
          Length = 669

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/190 (24%), Positives = 80/190 (42%), Gaps = 33/190 (17%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNP---------IDLNRYVLYSNDNRELRILKMYRK 56
           K + +  +   HG  G+V +    + P           L + V+     +E+ + +    
Sbjct: 77  KFIDIGYVSGVHGFQGDVRVKPNTDFPELRFSTPGRRWLRQRVMSEESVKEVELEEGREH 136

Query: 57  NKR--FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQ-G 113
           + +  +I  F GI+++  A  L    L    +D    ELE+ EF+  DL  M  F ++ G
Sbjct: 137 SGKNCWILKFRGIESVEEAKMLIGATLLVTEED--KPELEDGEFYAHDLNGMRVFMKENG 194

Query: 114 KYWGQVCGVYNFGAGSILEI----------KNTMEKT---------FLIPFTKFAVLEVN 154
           K  G V  V+N GA  +L+I          KN   K           L+PF +  V +V+
Sbjct: 195 KLLGTVINVFNTGANDLLQISLDSSFDVLDKNGQPKPEEIDASGQLVLLPFVEAIVSDVD 254

Query: 155 LQENKILIDP 164
           + + ++ I P
Sbjct: 255 MNKREMHITP 264


>gi|310828466|ref|YP_003960823.1| RimM protein [Eubacterium limosum KIST612]
 gi|308740200|gb|ADO37860.1| RimM protein [Eubacterium limosum KIST612]
          Length = 171

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 80/167 (47%), Gaps = 20/167 (11%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNR-----ELRILKMYRKNK 58
           +++  I   HG+ GE+ +    ++P    R+     +Y  D +     E+ ++++++ N 
Sbjct: 6   MVIGKILGAHGIRGELKVYPLTDDP---GRFYGLDTVYVQDGQKQECCEVELVRLHKGN- 61

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
             + T  G+ + + + +L    +   R+D     LEEDE+F  DL  ++  D  G   G 
Sbjct: 62  -VLLTLKGVSDRNQSEKLIGRTVAVDREDAV--ALEEDEYFIEDLIGLDVTDTDGAPVGV 118

Query: 119 VCGVYNFGAGSI--LEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
           V  V    AGS+  +EIK T EK   +P  K   L+V+ +  +I  D
Sbjct: 119 VKDVIQT-AGSVDNIEIK-TPEKLVYVPARKVYFLKVDFENKRITAD 163


>gi|313124063|ref|YP_004034322.1| ribosome maturation factor rimm [Lactobacillus delbrueckii subsp.
           bulgaricus ND02]
 gi|312280626|gb|ADQ61345.1| Ribosome maturation factor rimM [Lactobacillus delbrueckii subsp.
           bulgaricus ND02]
          Length = 167

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/158 (22%), Positives = 76/158 (48%), Gaps = 6/158 (3%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNRY---VLYSNDNRELRILKMYRKNKRFIATFSG 66
           +  I  THGL GEV +    + P D  R    +   +D+RE+ +       + ++ TF+ 
Sbjct: 6   VGKIIATHGLKGEVKVALTTDFPEDRFRAGSRLYLGDDSREVTVAAGRPFKQFWLVTFTE 65

Query: 67  IDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQ-GKYWGQVCGVYNF 125
           I +I  A +L+  ++    +D    EL +  ++  +L   +  D + G+  G++  +   
Sbjct: 66  ITDIDQAEKLKGTEILISEED--QGELPDGVYYYRELLGCKVLDDESGEEIGELTDIEAP 123

Query: 126 GAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
           GA  I E+ +   K+F +P+    V  V++ + ++ ++
Sbjct: 124 GANDIWEVTDENGKSFWLPYIPQVVKSVDIDKKEVRVE 161


>gi|269961268|ref|ZP_06175635.1| 16S rRNA-processing protein [Vibrio harveyi 1DA3]
 gi|269834029|gb|EEZ88121.1| 16S rRNA-processing protein [Vibrio harveyi 1DA3]
          Length = 182

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/166 (23%), Positives = 76/166 (45%), Gaps = 12/166 (7%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNR----ELRILKMYRKNKRFIAT 63
           +++   G T+G+ G + + SY +N   +  Y  +  + +    E ++    R NK  +A 
Sbjct: 14  IVVGKFGATYGIRGWLKVFSYTDNAESIFDYSPWFINQKGTWVEYKVESWKRHNKGMVAK 73

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
             G+D    A  + + ++          EL EDEF+  +L  M+    +G   G V  + 
Sbjct: 74  LEGLDIREDAHLMTNFEIAIDPAVLP--ELSEDEFYWRELFGMQVVTTKGYDLGVVSDIL 131

Query: 124 NFGAGSILEIKNTMEKTF-----LIPFTKFAV-LEVNLQENKILID 163
             G+  +L +K  ++  F     LIPF +  V ++V+ +  +I +D
Sbjct: 132 ETGSNDVLVVKANLKDAFGQKERLIPFLEEQVIIKVDREAQRIEVD 177


>gi|297242900|ref|ZP_06926838.1| 16S rRNA-processing protein rimM [Gardnerella vaginalis AMD]
 gi|296889111|gb|EFH27845.1| 16S rRNA-processing protein rimM [Gardnerella vaginalis AMD]
          Length = 199

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 75/173 (43%), Gaps = 17/173 (9%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNP---IDLNRYVLYSNDNRELRILKMYRKNKRFIAT 63
           L+ +  IG   GL GEV +  + + P    +    +  ++  RE  I        R+I  
Sbjct: 20  LLRVCRIGKAQGLKGEVTVQIFTDEPYERFEPGNVLCTADGEREFVIENARTFKNRWILL 79

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMET-------FDRQGKYW 116
           F    N + A  L   +LY   +D + E   E+ ++  DL  ++             K  
Sbjct: 80  FEESQNRNDAEALNGTELYVHAEDAQ-ELAAENAWYIKDLVGLQARLCEENQLGLTPKVI 138

Query: 117 GQVCGVYNFGAGSILEIK-----NTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           G+V  V + GA S+L+I+     +   KT L+PF +  V EV++    + IDP
Sbjct: 139 GKVVDVLD-GAQSLLKIRLDHPIDEENKTALVPFVEAIVPEVDVANGYLTIDP 190


>gi|311030152|ref|ZP_07708242.1| 16S rRNA-processing protein RimM [Bacillus sp. m3-13]
          Length = 172

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/167 (25%), Positives = 72/167 (43%), Gaps = 24/167 (14%)

Query: 16  THGLNGEVYIDSYANNPIDLNR-----YVLYSNDNRELRI-LKMYRKNKRF-IATFSGID 68
           THG+ GEV + S  + P +  +     Y+   ND   + + +   R +K F + TF G  
Sbjct: 13  THGIKGEVRVVSRTDFPDERYKKGNLLYLFLPNDKEPVEVKVASRRVHKSFDLLTFEGFH 72

Query: 69  NIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDL--------EEMETFDRQGKYWGQVC 120
           N++   + +   +          ELEE E++  ++        E ME         G V 
Sbjct: 73  NVNEVEKFKGAIIKVPEDQLG--ELEEGEYYFHEIVGCKVILQETMEEI-------GTVK 123

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAA 167
            V   GA  +  I+    K  LIP+    V +V++QE  I+I+P+  
Sbjct: 124 EVLTPGANDVWVIQAKKGKDILIPYIDQVVKKVDVQEKTIIIEPLEG 170


>gi|239631959|ref|ZP_04674990.1| RimM protein [Lactobacillus paracasei subsp. paracasei 8700:2]
 gi|301066645|ref|YP_003788668.1| rimM protein, required for 16S rRNA processing [Lactobacillus casei
           str. Zhang]
 gi|239526424|gb|EEQ65425.1| RimM protein [Lactobacillus paracasei subsp. paracasei 8700:2]
 gi|300439052|gb|ADK18818.1| RimM protein, required for 16S rRNA processing [Lactobacillus casei
           str. Zhang]
          Length = 172

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/152 (22%), Positives = 66/152 (43%), Gaps = 6/152 (3%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPID---LNRYVLYSNDNRELRILKMYRKNKRF-IATFS 65
           + TI  THG+ GEV +    + P D   +   V  +   +    ++  R++K   + TF 
Sbjct: 7   IGTIVNTHGIRGEVRVLVTTDFPADRFKVGNIVYVATSPKTALTIQSVREHKGLTLLTFK 66

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNF 125
              +I+     +  KL         + L+E  ++  D+  +   D QG+  G+V  + + 
Sbjct: 67  DYTDINQVLPFKGKKLQVTETAL--QPLDEGSYYYKDIIGLTVIDEQGQTLGKVNEILSP 124

Query: 126 GAGSILEIKNTMEKTFLIPFTKFAVLEVNLQE 157
           G   +  I  + +   L+PF K  V  ++L +
Sbjct: 125 GPNDVWVIPRSGKSDILLPFLKSVVQSIDLDQ 156


>gi|157164206|ref|YP_001466986.1| 16S rRNA processing protein RimM [Campylobacter concisus 13826]
 gi|171855062|sp|A7ZDX8|RIMM_CAMC1 RecName: Full=Ribosome maturation factor rimM
 gi|112800951|gb|EAT98295.1| 16S rRNA processing protein RimM [Campylobacter concisus 13826]
          Length = 176

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 80/164 (48%), Gaps = 10/164 (6%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIATFSG 66
           +V +ATIG   GL G + + + ++ P    +   + + N +  I+K Y + K  +  F  
Sbjct: 5   IVEVATIGRCVGLKGYLKLHNKSDFPEQFKKGATFFDKNDDQLIIKDYNRQKELV-LFEK 63

Query: 67  IDNIHSASELRDLKLYAKRQ-DFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNF 125
            D++  A  L +  +Y  ++   K+ +L++DEFF  D+  ++  +  G+  G V  + + 
Sbjct: 64  FDDLDLAKTLVNKTIYTTKELTRKNCKLKKDEFFQFDIIGLKVVE-NGEILGIVEDIQDN 122

Query: 126 GAGSILEIKNT-------MEKTFLIPFTKFAVLEVNLQENKILI 162
            A S+L IK           K F IP+ +  +  VNL   +IL+
Sbjct: 123 FANSLLYIKTDEVLIAAGKPKNFYIPYLERFIESVNLDSGEILV 166


>gi|315651819|ref|ZP_07904823.1| 16S rRNA processing protein RimM [Eubacterium saburreum DSM 3986]
 gi|315485949|gb|EFU76327.1| 16S rRNA processing protein RimM [Eubacterium saburreum DSM 3986]
          Length = 180

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 72/169 (42%), Gaps = 31/169 (18%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNK----------- 58
           +  I ++HG+ GE  +            Y    + NR  +I K+Y   K           
Sbjct: 18  VGVITSSHGIKGEAKV------------YPTSDDSNRLKKIKKVYADIKGVETVLDIETV 65

Query: 59  RF-----IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQG 113
           RF     +  F   +       LR+  L+  R +     L+++E +  DL  +E  D  G
Sbjct: 66  RFQKNMALVKFKQFNTPEEIQALRNTDLFVDRDNAI--PLKKNENYIADLIGLEVTDEDG 123

Query: 114 KYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
              G+V  V+  GA  ++E+ +  EK  L P+    +L+VNL+E +I +
Sbjct: 124 IILGKVTDVFPTGANHVMEV-DMGEKKVLFPYISQCILDVNLEEGEIRV 171


>gi|239908104|ref|YP_002954845.1| probable 16S rRNA processing protein RimM [Desulfovibrio magneticus
           RS-1]
 gi|239797970|dbj|BAH76959.1| probable 16S rRNA processing protein RimM [Desulfovibrio magneticus
           RS-1]
          Length = 184

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/170 (22%), Positives = 71/170 (41%), Gaps = 13/170 (7%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNR----YVLYSNDNRELR--ILKMYRKNK- 58
           K +++  +   HG+ GE+ +DS+A++P    R     +   +D    R  +++  R ++ 
Sbjct: 5   KYIIVGVVARPHGVRGELVVDSHADSPTYFARGSTLRLSPPSDPGRGRDYVVRAARPHQD 64

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY--- 115
           R + T   + +  +A  LR L +             EDE F  DL  +            
Sbjct: 65  RILITLDNVPDRTAADALRGLAICVPADRLV--AAAEDEVFLHDLPGLRVRLADAAPTDP 122

Query: 116 -WGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
             G +  V ++G   I  I++   +  L P T   V +V+L    + IDP
Sbjct: 123 DLGVIEDVRDYGGPEIWVIRDAKGREILFPATDDFVPDVDLDAGVVTIDP 172


>gi|172040481|ref|YP_001800195.1| 16S rRNA-processing protein RimM [Corynebacterium urealyticum DSM
           7109]
 gi|209573573|sp|B1VG72|RIMM_CORU7 RecName: Full=Ribosome maturation factor rimM
 gi|171851785|emb|CAQ04761.1| 16S rRNA processing protein [Corynebacterium urealyticum DSM 7109]
          Length = 194

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 67/174 (38%), Gaps = 26/174 (14%)

Query: 17  HGLNGEVYIDSYANN-----PIDLNRYVLYSNDNRELRILKMYRKNKRFIATFSGIDNIH 71
           HG+ GEV +D   ++      I      + +   R+L +  M R   R + TF  I +  
Sbjct: 13  HGVKGEVVVDPSTDHVPERFAIGEALRAVQTGKERQLTVTGMRRHQNRLLVTFEEIRDRD 72

Query: 72  SASELRDLKLYAKR------QDFKDEELEEDEFFNTDLEEMETFDRQGKYW--------G 117
            A  LR  +  A          + D EL      N    + +T +R+            G
Sbjct: 73  EAESLRGARFMAAPLHDDSDDGYYDHELIGLRVLNVGSVDADTANRRAYEGEQPEPVDIG 132

Query: 118 QVCGVYNFGAGSILEIK-------NTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           +V GV +  AG+ LE+         T   T LIPF    V  V+L    +++ P
Sbjct: 133 EVTGVSHGPAGATLEVAVDADADLPTAGSTILIPFKLAIVPIVDLDNEALVVTP 186


>gi|20807906|ref|NP_623077.1| RimM protein, required for 16S rRNA processing [Thermoanaerobacter
           tengcongensis MB4]
 gi|22001901|sp|Q8R9X3|RIMM_THETN RecName: Full=Ribosome maturation factor rimM
 gi|20516473|gb|AAM24681.1| RimM protein, required for 16S rRNA processing [Thermoanaerobacter
           tengcongensis MB4]
          Length = 168

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/167 (25%), Positives = 81/167 (48%), Gaps = 12/167 (7%)

Query: 10  MATIGTTHGLNGEVYIDSYANNP---IDLNRYVLYSNDN----RELRILKMYRKNKRFIA 62
           +  + + HG+ GE+ +    N P    D+    ++   +     E+  +K+  K    + 
Sbjct: 7   VGKVTSPHGIRGEIKVYPLTNVPERFYDIPYIWVFDEKDIPCKYEIENVKITSKG-MVLL 65

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
              GID+ + A +L+ L L    ++    +LEEDE+F TDL  M+ +  +G+  G +  V
Sbjct: 66  KLKGIDSRNDAEKLKGLFLKVDAENAL--KLEEDEYFITDLIGMKVYTEEGELIGTLEEV 123

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
              GA  +  +K   E+  L+P  K  + +V++ E K++I  +  GL
Sbjct: 124 LQTGANDVYVVK-AKEREVLLPAIKEVIKKVDV-EGKVMIVRLLEGL 168


>gi|78776654|ref|YP_392969.1| 16S rRNA processing protein RimM [Sulfurimonas denitrificans DSM
           1251]
 gi|109893067|sp|Q30TE7|RIMM_SULDN RecName: Full=Ribosome maturation factor rimM
 gi|78497194|gb|ABB43734.1| 16S rRNA processing protein RimM [Sulfurimonas denitrificans DSM
           1251]
          Length = 179

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/167 (26%), Positives = 83/167 (49%), Gaps = 12/167 (7%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYV-LYSNDNRELRILKMYRKNKRFIAT 63
           +KL+ +ATIG + GL G++ +   ++ P    + V  + N+N  L +  +   ++R +  
Sbjct: 6   NKLLHIATIGKSVGLGGDMKLHIKSDFPEQFKKGVSFFINENETLTLSDI--NHERALIK 63

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDE-ELEEDEFFNTDLEEMETFDRQGKYWGQV--- 119
           F G ++   A +L +  LY   +  + E  LE+DE+F  D+E     +  GK  G V   
Sbjct: 64  FVGYNSPEDAKKLTNKNLYTTIERTRKECRLEKDEYFWFDIEGCSVVE-DGKVLGIVDEL 122

Query: 120 --CGVYNFGAGSILE--IKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
              G+ N+      E  +K+   K+FLIPF +   +  +++E  I +
Sbjct: 123 DRMGITNYLCVITDETLVKSGFAKSFLIPFREPFTINTDIKEKIITV 169


>gi|257886946|ref|ZP_05666599.1| ribosome maturation factor rimM [Enterococcus faecium 1,141,733]
 gi|257898133|ref|ZP_05677786.1| ribosome maturation factor rimM [Enterococcus faecium Com15]
 gi|257823000|gb|EEV49932.1| ribosome maturation factor rimM [Enterococcus faecium 1,141,733]
 gi|257836045|gb|EEV61119.1| ribosome maturation factor rimM [Enterococcus faecium Com15]
          Length = 174

 Score = 45.8 bits (107), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 80/168 (47%), Gaps = 13/168 (7%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNRY------VLYSNDNRELRI-LKMYRKNKRF-I 61
           +  I  T G+ GEV + S  + P +  RY       L+ +    + + +K +RK+K F +
Sbjct: 7   VGKIVNTQGIKGEVRVISTTDFPEE--RYKKGTVLTLFQDGKAPVELTVKSHRKHKNFDL 64

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
            +F G  +I+   + RD  L   + +  D  L E+EF+  ++  +   +  G   G+V  
Sbjct: 65  LSFEGHPSINDVEKYRDGILKVSKDNSVD--LAENEFYYHEIIGLRVVEEDGTELGKVKE 122

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           + + GA  +  ++   +   L+P+    V EV+L+   + ++ I  GL
Sbjct: 123 ILSPGANDVWVVQRPKKADILLPYIASVVKEVDLEAGVVRVE-IPEGL 169


>gi|116495081|ref|YP_806815.1| 16S rRNA-processing protein RimM [Lactobacillus casei ATCC 334]
 gi|191638584|ref|YP_001987750.1| 16S rRNA-processing protein RimM [Lactobacillus casei BL23]
 gi|227534906|ref|ZP_03964955.1| 16S rRNA processing protein [Lactobacillus paracasei subsp.
           paracasei ATCC 25302]
 gi|122263502|sp|Q038J9|RIMM_LACC3 RecName: Full=Ribosome maturation factor rimM
 gi|238693051|sp|B3WEU1|RIMM_LACCB RecName: Full=Ribosome maturation factor rimM
 gi|116105231|gb|ABJ70373.1| 16S rRNA processing protein RimM [Lactobacillus casei ATCC 334]
 gi|190712886|emb|CAQ66892.1| Probable 16S rRNA-processing protein rimM [Lactobacillus casei
           BL23]
 gi|227187662|gb|EEI67729.1| 16S rRNA processing protein [Lactobacillus paracasei subsp.
           paracasei ATCC 25302]
 gi|327382625|gb|AEA54101.1| 16S rRNA processing protein RimM [Lactobacillus casei LC2W]
 gi|327385821|gb|AEA57295.1| 16S rRNA processing protein RimM [Lactobacillus casei BD-II]
          Length = 172

 Score = 45.8 bits (107), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/152 (22%), Positives = 66/152 (43%), Gaps = 6/152 (3%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPID---LNRYVLYSNDNRELRILKMYRKNKRF-IATFS 65
           + TI  THG+ GEV +    + P D   +   V  +   +    ++  R++K   + TF 
Sbjct: 7   IGTIVNTHGIRGEVRVLVTTDFPADRFKVGNTVYVATSPKTALTIQSVREHKGLTLLTFK 66

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNF 125
              +I+     +  KL         + L+E  ++  D+  +   D QG+  G+V  + + 
Sbjct: 67  DYTDINQVLPFKGKKLQVTETAL--QPLDEGSYYYKDIIGLTVIDEQGQTLGKVNEILSP 124

Query: 126 GAGSILEIKNTMEKTFLIPFTKFAVLEVNLQE 157
           G   +  I  + +   L+PF K  V  ++L +
Sbjct: 125 GPNDVWVIPRSGKSDILLPFLKSVVQSIDLDQ 156


>gi|157362993|ref|YP_001469760.1| 16S rRNA processing protein RimM [Thermotoga lettingae TMO]
 gi|166985971|sp|A8F3G2|RIMM_THELT RecName: Full=Ribosome maturation factor rimM
 gi|157313597|gb|ABV32696.1| 16S rRNA processing protein RimM [Thermotoga lettingae TMO]
          Length = 168

 Score = 45.8 bits (107), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 61/134 (45%), Gaps = 7/134 (5%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY--VLYSND----NRELRILKMYRKNKRFI 61
           V++  I  THGL G V +    N      +   V   ND       L+I ++ +  K F+
Sbjct: 5   VVIGKITKTHGLFGSVKVLPLTNALEVFQKLENVFIKNDAQSNTHRLQIEEIRKAGKGFL 64

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
             FSGID+   A ++  L L  +  D    +   +E++  +L  +E  D+ G + G+V  
Sbjct: 65  IKFSGIDDEERARKIVGLSLAVRVTDLPKPK-SPNEYYYYELLNVEVLDQSGNFIGRVED 123

Query: 122 VYNFGAGSILEIKN 135
           +   G+  +  +KN
Sbjct: 124 IIQTGSNEVAVVKN 137


>gi|328957320|ref|YP_004374706.1| 16S rRNA-processing protein RimM [Carnobacterium sp. 17-4]
 gi|328673644|gb|AEB29690.1| 16S rRNA-processing protein RimM [Carnobacterium sp. 17-4]
          Length = 171

 Score = 45.8 bits (107), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 84/172 (48%), Gaps = 17/172 (9%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS-----NDNRELRILKM--YRKNKRF-I 61
           +  I  T G+ GEV + S  + P +  RY   S      D + +  L +  +RK+K F I
Sbjct: 7   VGKIVNTQGIKGEVRVISKTDFPEE--RYKKGSTLSLFQDGKLVTDLTVASHRKHKNFDI 64

Query: 62  ATFSGIDNIHSASELRD--LKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +F    NI+   + RD  LK+   R      EL ++EF+   +  +   D +    G++
Sbjct: 65  LSFENHPNINDVEKYRDGILKVSEDRL----TELPKNEFYLHQIVGLTVQDEEKNTIGKI 120

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN 171
             V + GA  +  I+   +K  LIP+ +  VLEV+L EN+++   +  GL++
Sbjct: 121 SEVMSPGANDVWVIERPKKKDLLIPYIEEVVLEVDL-ENQMVTIHMMEGLDD 171


>gi|308068629|ref|YP_003870234.1| 16S rRNA processing protein rimM [Paenibacillus polymyxa E681]
 gi|305857908|gb|ADM69696.1| Probable 16S rRNA processing protein rimM [Paenibacillus polymyxa
           E681]
          Length = 171

 Score = 45.8 bits (107), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 79/174 (45%), Gaps = 25/174 (14%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRK------- 56
           + +L  +  I  THG+ GE+ I +  + P D  R+   S    EL I+    K       
Sbjct: 1   MQQLFNVGKIVNTHGIRGELKILTTTDFPED--RFAKGS----ELLIVPAEGKAPIPVTV 54

Query: 57  -NKRF-----IATFSGIDNIHSASELRD--LKLYAKRQDFKDEELEEDEFFNTDLEEMET 108
              RF     +A F    NI+   + +   LK+ A+R      ELEE+EF+  ++  ME 
Sbjct: 55  ETARFQKNMVVAKFKEYHNINEVEKYKGTLLKVSAERLG----ELEENEFYFHEVVGMEV 110

Query: 109 FDRQGKYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
               G   G V  +   GA  +  +K    K  L+P+ +  +L+VN++E ++ +
Sbjct: 111 VTEDGNELGVVKEILTPGANDVWVVKMPKGKELLLPYIEDVILDVNVREKRVTV 164


>gi|118617623|ref|YP_905955.1| 16S rRNA-processing protein RimM [Mycobacterium ulcerans Agy99]
 gi|166226457|sp|A0PQ65|RIMM_MYCUA RecName: Full=Ribosome maturation factor rimM
 gi|118569733|gb|ABL04484.1| 16S rRNA processing protein RimM [Mycobacterium ulcerans Agy99]
          Length = 174

 Score = 45.8 bits (107), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 68/160 (42%), Gaps = 16/160 (10%)

Query: 16  THGLNGEVYIDSYANNPIDLNRYVLYSNDNRELR----------ILKMYRKN-KRFIATF 64
            HG+ GEV ++   + P   +R        R  R          +++  R++  R +   
Sbjct: 11  AHGITGEVVVEIRTDEP---DRRFTPGASLRAKRSRDGGTGRNYVIEGVREHGARLLVRL 67

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
           +G+++  +A  LR         D    E E D +++  LE +      G+  G V  V +
Sbjct: 68  AGVNDRDTADGLRGSLFVIDSADLPPIE-EPDTYYDHQLEGLRVRTTAGQDVGVVAEVLH 126

Query: 125 FGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
            GAG +L +K    +  L+PF    V  V+L +  + IDP
Sbjct: 127 TGAGELLAVKCDSGE-VLVPFVGAIVTSVSLDDRILEIDP 165


>gi|227878847|ref|ZP_03996754.1| 16S rRNA processing protein [Lactobacillus crispatus JV-V01]
 gi|227861595|gb|EEJ69207.1| 16S rRNA processing protein [Lactobacillus crispatus JV-V01]
          Length = 183

 Score = 45.8 bits (107), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 73/159 (45%), Gaps = 7/159 (4%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPID---LNRYVLYSNDNRELRILKMYRKNKRF-IATFS 65
           +A I T HGLNGEV +    + P D   +  ++    +  ++  +   R  K+F +  F+
Sbjct: 18  VARILTMHGLNGEVKVSVITDFPEDRFAIGMHLAIKGETSQVLTVAKSRPFKQFWLVQFA 77

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQ-GKYWGQVCGVYN 124
            I +I  A +L+   L     D    EL E  ++  D+ + +  D + GK  G++  + +
Sbjct: 78  EITDIDQAEKLKGKILVVSEADRG--ELPEGVYYYKDIFDCDVIDEESGKRLGKITDIES 135

Query: 125 FGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
            GA  I  +     K + IP     V +V++   K+ ++
Sbjct: 136 PGANDIWLVHEDNGKEYWIPNIASVVKKVDVANKKVYVE 174


>gi|256849813|ref|ZP_05555244.1| ribosome maturation factor rimM [Lactobacillus crispatus MV-1A-US]
 gi|256713302|gb|EEU28292.1| ribosome maturation factor rimM [Lactobacillus crispatus MV-1A-US]
          Length = 171

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 73/159 (45%), Gaps = 7/159 (4%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPID---LNRYVLYSNDNRELRILKMYRKNKRF-IATFS 65
           +A I T HGLNGEV +    + P D   +  ++    +  ++  +   R  K+F +  F+
Sbjct: 6   VARILTMHGLNGEVKVSVITDFPEDRFAIGMHLAIKGETSQVLTVAKSRPFKQFWLVQFA 65

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQ-GKYWGQVCGVYN 124
            I +I  A +L+   L     D    EL E  ++  D+ + +  D + GK  G++  + +
Sbjct: 66  EITDIDQAEKLKGKILVVSEADRG--ELPEGVYYYKDIFDCDVIDEESGKRLGKITDIES 123

Query: 125 FGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
            GA  I  +     K + IP     V +V++   K+ ++
Sbjct: 124 PGANDIWLVHEDNGKEYWIPNIASVVKKVDVANKKVYVE 162


>gi|222528964|ref|YP_002572846.1| 16S rRNA-processing protein RimM [Caldicellulosiruptor bescii DSM
           6725]
 gi|312127970|ref|YP_003992844.1| 16S rRNA processing protein rimm [Caldicellulosiruptor
           hydrothermalis 108]
 gi|254797740|sp|B9MQW9|RIMM_ANATD RecName: Full=Ribosome maturation factor rimM
 gi|222455811|gb|ACM60073.1| 16S rRNA processing protein RimM [Caldicellulosiruptor bescii DSM
           6725]
 gi|311777989|gb|ADQ07475.1| 16S rRNA processing protein RimM [Caldicellulosiruptor
           hydrothermalis 108]
          Length = 169

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 80/169 (47%), Gaps = 6/169 (3%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNP---IDLNRYVLYSNDNRELRILKMYRKNKRFIA 62
           K + +  I  T GL GEV +    +      +L   +L  N + +L I +   K+   I 
Sbjct: 3   KYLQVGKIVNTFGLKGEVKVIPLTDEVDRFSELEYVLLEDNLSTKLTIERYRVKDNIVII 62

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F  I +I  A +L++  +  +R+  K  +L +D +F  D+  +E +D  G+  G++  V
Sbjct: 63  KFKEISSIDEAQKLKNRYIVIERERAK--KLPKDTYFICDIIGLEVYDLDGRKLGRIKDV 120

Query: 123 YNFGAGSILEIKNTM-EKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
              G+  +    + + +K  LIP  K  V EVN++E  + I  +   L+
Sbjct: 121 LKTGSNDVYICDSYIGKKDILIPALKEIVKEVNIEEGYMKIKVVEGLLD 169


>gi|325694637|gb|EGD36545.1| 16S rRNA processing protein RimM [Streptococcus sanguinis SK150]
 gi|328946423|gb|EGG40564.1| 16S rRNA processing protein RimM [Streptococcus sanguinis SK1087]
          Length = 224

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/169 (23%), Positives = 83/169 (49%), Gaps = 11/169 (6%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDL----NRYVLYSNDNRELRILKM--YRKNKRF-IA 62
           +  I  T GL GE+ + S  +   +     N+  L+   ++ +  +++  +RK K F I 
Sbjct: 58  VGKIVNTQGLQGEMRVLSVTDFAEERFKKGNKLALFDKKDQFVMDVEIASHRKAKNFDII 117

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F G+ +I+   + RD  L    +D  D  LE+ EF+  ++  +E ++      G +  +
Sbjct: 118 KFKGMYHINDIEKFRDFSLKVAEEDLAD--LEDGEFYYHEIIGLEVYEND-VLLGTIKEI 174

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN 171
              GA  +  +K   ++  L+P+    VL +N+++ ++ ++ I  GL++
Sbjct: 175 LQPGANDVWVVKRKGKRDLLLPYIPPVVLGINIEQGRVDVE-IPEGLDD 222


>gi|138894721|ref|YP_001125174.1| 16S rRNA-processing protein RimM [Geobacillus thermodenitrificans
           NG80-2]
 gi|166226443|sp|A4IM75|RIMM_GEOTN RecName: Full=Ribosome maturation factor rimM
 gi|134266234|gb|ABO66429.1| 16S rRNA processing protein RimM [Geobacillus thermodenitrificans
           NG80-2]
          Length = 175

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/167 (22%), Positives = 72/167 (43%), Gaps = 9/167 (5%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNR-----YVLYSNDNRELRI-LKMYRKNKRF-IA 62
           +  I  THG+ GEV + S  + P +  +     Y+    D   + + +K +R +K F + 
Sbjct: 10  VGKIVNTHGIRGEVRVISRTDFPEERYKKGNKLYIFRECDTEPIEVTVKSHRVHKSFDLL 69

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
           +F G D+I+     +   L          EL E E++  ++ +       G+  G+V  +
Sbjct: 70  SFEGYDSINDVEPFKGAMLKVPESQLG--ELNEGEYYFHEIIDCTVVTEAGETIGKVKEI 127

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
              GA  +  ++       LIP+    V+ V+ +   I+I P+   L
Sbjct: 128 LTPGANDVWVVRRQDGTDALIPYIDDVVMHVDPERKIIIIRPMEGLL 174


>gi|147678055|ref|YP_001212270.1| RimM protein, required for 16S rRNA processing [Pelotomaculum
           thermopropionicum SI]
 gi|189040846|sp|A5D1J5|RIMM_PELTS RecName: Full=Ribosome maturation factor rimM
 gi|146274152|dbj|BAF59901.1| RimM protein, required for 16S rRNA processing [Pelotomaculum
           thermopropionicum SI]
          Length = 170

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 55/112 (49%), Gaps = 3/112 (2%)

Query: 52  KMYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDR 111
           ++Y      I  F  I+++ +A +L+   L   R +     L ED F+  D+  ++ +D 
Sbjct: 54  EVYHHKNFIIIKFKEIESMAAAEKLKGAFLEVGRDELVP--LPEDRFYIFDIIGLKVYDT 111

Query: 112 QGKYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
            G+  G+V  V   GA  +  + +T  K  LIP  K  V  VNL E K++++
Sbjct: 112 GGRNLGRVTDVLQTGANDVY-VVDTGGKPLLIPALKQVVKSVNLTEGKMVVE 162


>gi|319639238|ref|ZP_07993989.1| 16S rRNA-processing protein rimM [Neisseria mucosa C102]
 gi|317399422|gb|EFV80092.1| 16S rRNA-processing protein rimM [Neisseria mucosa C102]
          Length = 169

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 69/168 (41%), Gaps = 9/168 (5%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDS---YANNPIDLNRYVLYSNDNRELRILKMYRK- 56
           M    K V M  I    G+ G + I +   Y ++ +D   + L   D + L +     K 
Sbjct: 1   MTDTQKRVAMGYIKGVFGIKGWLKIAANTEYTDSLLDYPEWQL-CKDGKTLNVTLEAGKI 59

Query: 57  -NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
            N      F GID+   A  LR   +   R+ F     EEDE++  DL  M   +++   
Sbjct: 60  VNGELQVKFEGIDDRDQAFALRGYTIEIPRESFA--PTEEDEYYWADLVGMTVINKENIV 117

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
            G+V  +   GA  +L IK    +  LIPF    +  V+     I+ D
Sbjct: 118 LGKVSNLMETGANDVLMIKGEHGQ-ILIPFVSNYIESVDTDSKTIIAD 164


>gi|307721673|ref|YP_003892813.1| 16S rRNA processing protein RimM [Sulfurimonas autotrophica DSM
           16294]
 gi|306979766|gb|ADN09801.1| 16S rRNA processing protein RimM [Sulfurimonas autotrophica DSM
           16294]
          Length = 181

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 81/166 (48%), Gaps = 10/166 (6%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIATF 64
           +KL+ +ATIG T G+ G++      + P    +   +  + +E  +L     + R +   
Sbjct: 8   NKLLHIATIGKTVGIKGDMKFHIKCDFPEQFVKGSTFLINKKESIMLSEVDLD-RGLVRI 66

Query: 65  SGIDNIHSASELRDLKLYAKRQDF-KDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           + I N+  A +  + KL+   +D  K+  LEE E+F  DLE+ E ++   K  G V  + 
Sbjct: 67  NNITNLEDAKKFTNAKLFTTYEDTRKNCHLEEGEYFWFDLEDCEVYE-DSKCLGVVKEIE 125

Query: 124 NFGAGSILEI-------KNTMEKTFLIPFTKFAVLEVNLQENKILI 162
              + + L I       +N + K+FL+PF +   + V++ + +I +
Sbjct: 126 RLNSTNYLSIVTYESLVQNGLPKSFLVPFIEPFKVAVDVDKKRITL 171


>gi|261419400|ref|YP_003253082.1| 16S rRNA-processing protein RimM [Geobacillus sp. Y412MC61]
 gi|297530625|ref|YP_003671900.1| 16S rRNA processing protein RimM [Geobacillus sp. C56-T3]
 gi|319766215|ref|YP_004131716.1| 16S rRNA processing protein RimM [Geobacillus sp. Y412MC52]
 gi|261375857|gb|ACX78600.1| 16S rRNA processing protein RimM [Geobacillus sp. Y412MC61]
 gi|297253877|gb|ADI27323.1| 16S rRNA processing protein RimM [Geobacillus sp. C56-T3]
 gi|317111081|gb|ADU93573.1| 16S rRNA processing protein RimM [Geobacillus sp. Y412MC52]
          Length = 172

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/167 (23%), Positives = 70/167 (41%), Gaps = 9/167 (5%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNR-----YVLYSNDNRELRI-LKMYRKNKRF-IA 62
           +  I  THG+ GEV + S  + P +  +     Y+    D   + + +K +R +K F + 
Sbjct: 7   VGKIVNTHGIRGEVRVISRTDFPEERYKKGNKLYIFRERDTEPIEVTVKSHRVHKSFDLL 66

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
           +F G D+I+     +   L          EL E E++  ++         G+  G V  +
Sbjct: 67  SFEGYDSINDVERFKGAMLKVPESQLG--ELAEGEYYFHEIIGCTVVTEGGETIGAVKEI 124

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
              GA  +  ++       LIP+    VL V+ +   I+I P+   L
Sbjct: 125 LTPGANDVWVVRREDGSEALIPYIDEVVLHVDPERKTIIIRPMEGLL 171


>gi|222151071|ref|YP_002560225.1| 16S rRNA processing protein homolog [Macrococcus caseolyticus
           JCSC5402]
 gi|254797754|sp|B9EBB8|RIMM_MACCJ RecName: Full=Ribosome maturation factor rimM
 gi|222120194|dbj|BAH17529.1| 16S rRNA processing protein homolog [Macrococcus caseolyticus
           JCSC5402]
          Length = 165

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 75/146 (51%), Gaps = 9/146 (6%)

Query: 10  MATIGTTHGLNGEVYI---DSYANNPIDLNRYVLYSNDNRELRI-LKMYRKNKRF-IATF 64
           +  I  THG+ GEV I     +A       + ++    N  + + +K YR +K F +  F
Sbjct: 5   VGKIVNTHGVKGEVKILTASDFAAERFKPGKVLMIPFKNERVTLTIKSYRTHKNFHMLAF 64

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
            G++NI+   + + L +Y + ++ +D  L+E+E+F +D+     FD + +  G V  ++ 
Sbjct: 65  EGLNNINDVEKYKGLDVYQEIEN-EDIILDENEYFYSDIIGCTVFDGE-REIGIVNDIFE 122

Query: 125 FGAGSILEIKNTMEKTFLIPFTKFAV 150
            GA  +  ++   +K +LIP+ +  V
Sbjct: 123 TGANDVWVVQG--DKEYLIPYIEDVV 146


>gi|134299898|ref|YP_001113394.1| 16S rRNA processing protein RimM [Desulfotomaculum reducens MI-1]
 gi|172044314|sp|A4J666|RIMM_DESRM RecName: Full=Ribosome maturation factor rimM
 gi|134052598|gb|ABO50569.1| 16S rRNA processing protein RimM [Desulfotomaculum reducens MI-1]
          Length = 169

 Score = 45.4 bits (106), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 37/163 (22%), Positives = 71/163 (43%), Gaps = 6/163 (3%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR----YVLYSNDNRELRILKMYRKNKRF 60
           ++ + +  +  T G+ GEV I    + P    +     VL     R+  I +++   +  
Sbjct: 3   EEYITVGKVVNTQGIQGEVRIIPTTDFPERFVKNDKISVLLRGQRRDYTIERVWEHKQFI 62

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           I  FS I ++ +A +L+   L    ++     L E  ++   +  ++  D   +  G V 
Sbjct: 63  IIKFSEIPDMTAAEKLKGGLLQVTMEELVP--LPEGNYYIFQIVGLKVVDENEQELGTVA 120

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
            V   GA  +  +K +  K  LIP  K  V E+N+ E K+ ++
Sbjct: 121 QVLQTGANDVYVVKRSEGKDILIPAIKSVVKEINITEGKMKVE 163


>gi|331269651|ref|YP_004396143.1| 16S rRNA processing protein RimM [Clostridium botulinum BKT015925]
 gi|329126201|gb|AEB76146.1| 16S rRNA processing protein RimM [Clostridium botulinum BKT015925]
          Length = 162

 Score = 45.4 bits (106), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 73/165 (44%), Gaps = 10/165 (6%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSN---DNRELRILKMYRKNKRF 60
           +++ + +  I  THGL GE+ +    +   D+ R+        D   + I     +  + 
Sbjct: 1   MEQFLAVGKIINTHGLKGEIKLLPSTD---DVERFKELKKAYIDGEVIEIEGCKFQPGKV 57

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           I     +D+I  A  L++  +   R+D    +L ED ++  D+     +D   +  G+V 
Sbjct: 58  ILKIKDVDSIEQAQRLKNKYIKVTREDAA--KLPEDCYYEADIVGCTVYDENDEELGKVD 115

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPI 165
            +   G+  +  IK   E   LIP  K  ++ +++   KI+I P+
Sbjct: 116 EIIRTGSNDVYWIKGKNE--VLIPAIKSVIVSIDVNSKKIVIKPL 158


>gi|196247660|ref|ZP_03146362.1| 16S rRNA processing protein RimM [Geobacillus sp. G11MC16]
 gi|196212444|gb|EDY07201.1| 16S rRNA processing protein RimM [Geobacillus sp. G11MC16]
          Length = 173

 Score = 45.4 bits (106), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 38/167 (22%), Positives = 72/167 (43%), Gaps = 9/167 (5%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNR-----YVLYSNDNRELRI-LKMYRKNKRF-IA 62
           +  I  THG+ GEV + S  + P +  +     Y+    D   + + +K +R +K F + 
Sbjct: 8   VGKIVNTHGIRGEVRVISRTDFPEERYKKGNKLYIFRECDTEPIEVTVKSHRVHKSFDLL 67

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
           +F G D+I+     +   L          EL E E++  ++ +       G+  G+V  +
Sbjct: 68  SFEGYDSINDVEPFKGAMLKVPESQLG--ELNEGEYYFHEIIDCTVVTEAGETIGKVKEI 125

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
              GA  +  ++       LIP+    V+ V+ +   I+I P+   L
Sbjct: 126 LTPGANDVWVVRRQDGTDALIPYIDDVVMHVDPERKIIIIRPMEGLL 172


>gi|332652593|ref|ZP_08418338.1| 16S rRNA processing protein RimM [Ruminococcaceae bacterium D16]
 gi|332517739|gb|EGJ47342.1| 16S rRNA processing protein RimM [Ruminococcaceae bacterium D16]
          Length = 165

 Score = 45.4 bits (106), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 71/152 (46%), Gaps = 7/152 (4%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKRF-IATFSGI 67
           +  +   HGL GEV +  +A++P  L R+  LY +       ++  R +K   I  F G+
Sbjct: 8   VGKVTNVHGLMGEVRVQPWADSPDFLCRFKTLYVDKTHWPIEVERARVHKNMVIIKFHGV 67

Query: 68  DNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQG-KYWGQVCGVYNFG 126
            +++ A  +R+  LY  R    D  L +  FF  D+  +E  D Q  +  G+V  +    
Sbjct: 68  TDVNGALAMRNAILYIDRD---DANLPKGSFFLADIYGLEVRDAQTDEVLGKVDDILTPP 124

Query: 127 AGSILEIKNTMEKTFLIPFTKFAVLEVNLQEN 158
           A ++  ++   ++  +IP     V E+N+ E 
Sbjct: 125 ANNVYVVRGG-KREIMIPAVDQFVKEINVDEG 155


>gi|288942188|ref|YP_003444428.1| 16S rRNA processing protein RimM [Allochromatium vinosum DSM 180]
 gi|288897560|gb|ADC63396.1| 16S rRNA processing protein RimM [Allochromatium vinosum DSM 180]
          Length = 169

 Score = 45.4 bits (106), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 36/159 (22%), Positives = 71/159 (44%), Gaps = 7/159 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY--VLYSNDNRELRILKMYRKNKRFIATFS 65
           +++  +   +G+ G V + S  +    + RY   L   D    R+ +     K  +A   
Sbjct: 10  IVLGRVSGLYGVKGWVKVYSETDPREGILRYSPWLLGPDGVARRVAEGRMHGKGLVARLD 69

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNF 125
           G ++   A+ L   ++  +R          DEF+  DLE +    + G  +G+V  +++ 
Sbjct: 70  GCEDRDQAAALIGQEIAIRRDQLPPPR--PDEFYWIDLEGLAVVTQAGVEFGRVSHLFST 127

Query: 126 GAGSILEIKNTMEKTFLIPFTKF-AVLEVNLQENKILID 163
           GA  +L ++   E+  LIPF     +L+V+  +  I +D
Sbjct: 128 GANDVLVVQGERER--LIPFVWGDVILDVDFDQRLIRVD 164


>gi|297539670|ref|YP_003675439.1| 16S rRNA processing protein RimM [Methylotenera sp. 301]
 gi|297259017|gb|ADI30862.1| 16S rRNA processing protein RimM [Methylotenera sp. 301]
          Length = 189

 Score = 45.4 bits (106), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 41/176 (23%), Positives = 80/176 (45%), Gaps = 21/176 (11%)

Query: 7   LVLMATIGTTHGLNGEVYI--DSYA-NNPIDLNRYVLYSNDN-RELRILKMYRKNKRFIA 62
           +V+M  I   +G+ G + I  D+ A +   D + + L   D+ RE+ +      N   + 
Sbjct: 11  MVVMGRIVAPYGVFGWLKIVPDTEAFDGLFDYDTWWLGKGDDWREMVVETAKTHNDVLVV 70

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
              GID+  +A   +  ++   R+     E EE+E++ +DL  +   ++Q   +G +  V
Sbjct: 71  KLKGIDDRDAALACKGKQIAVPREQLP--EAEENEYYWSDLIGLRVKNKQDVDFGLIVDV 128

Query: 123 YNFGAGSILEIKNTMEKT---------------FLIPFTKFAVLEVNLQENKILID 163
           +  GA  ++ ++  + ++                LIPF    VLEV+L    +L+D
Sbjct: 129 FETGANDVIAVRADVIQSEDSTVKAVAKEKPQERLIPFIDDVVLEVDLAAKTMLVD 184


>gi|332362172|gb|EGJ39974.1| 16S rRNA processing protein RimM [Streptococcus sanguinis SK49]
          Length = 172

 Score = 45.4 bits (106), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/169 (23%), Positives = 84/169 (49%), Gaps = 11/169 (6%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDL----NRYVLYSNDNRELRILKM--YRKNKRF-IA 62
           +  I  T GL GE+ + S  +   +     N   L+   +R +  +++  +RK K F I 
Sbjct: 6   VGKIVNTQGLQGEMRVLSVTDFAEERFKKGNTLALFDKKDRFVMDVEIASHRKVKNFDII 65

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F G+ +I+   + RD  L  + +D  D  LE+ EF+  ++  +E ++      G++  +
Sbjct: 66  KFKGMYHINDIEKFRDFTLKVREEDLTD--LEDGEFYYHEIIGLEVYE-DDVLLGRIKEI 122

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN 171
              GA  +  +K   ++  L+P+    VL +++++ ++ ++ I  GL++
Sbjct: 123 LQPGANDVWVVKRKGKRDLLLPYIPPVVLGIDIEQGRVDVE-IPEGLDD 170


>gi|283956121|ref|ZP_06373608.1| putative 16S rRNA processing protein [Campylobacter jejuni subsp.
           jejuni 1336]
 gi|283792441|gb|EFC31223.1| putative 16S rRNA processing protein [Campylobacter jejuni subsp.
           jejuni 1336]
          Length = 179

 Score = 45.4 bits (106), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 78/167 (46%), Gaps = 17/167 (10%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNR-YVLYSNDNRELRILKMYRKNKRFIATFS 65
            V +A +G T GL G V + + ++      +    +  + +E+  +K Y  +   +  F 
Sbjct: 6   FVQVAKLGKTVGLKGYVKLHNLSDFSSQFKKDATFFIKNTKEILKIKHYNASNSTVL-FE 64

Query: 66  GIDNIHSASELRDLKLYAK----RQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
             ++I  A EL +L L+      RQ  K   L++DEFF  D+ E E F+ + K  G+V  
Sbjct: 65  NYEDIEKAKELTNLILFQSIEKSRQTCK---LKKDEFFYFDILECEVFE-EDKRLGKVVD 120

Query: 122 VYNFGAGSILEIKN-------TMEKTFLIPFTKFAVLEVNLQENKIL 161
           +   GA  + EI++          K F +P+    V  +++++ +I 
Sbjct: 121 ILEIGASYLFEIQSDEKWVNKKYSKIFFVPYLDKFVKNIDIEKRQIF 167


>gi|116074427|ref|ZP_01471689.1| 16S rRNA-processing protein [Synechococcus sp. RS9916]
 gi|116069732|gb|EAU75484.1| 16S rRNA-processing protein [Synechococcus sp. RS9916]
          Length = 187

 Score = 45.4 bits (106), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 45/162 (27%), Positives = 68/162 (41%), Gaps = 12/162 (7%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNP---IDLNRYVLYSNDNR----ELRILKMYRKN 57
           D L +   +G   GL GE+ I+  +  P    D     L +  +     EL+  +     
Sbjct: 17  DWLPVGKVVGV-QGLKGELRINPASEFPERFTDPGSRWLKARGSAPREMELKSGRQLPGR 75

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMET-FDRQGKYW 116
             F+  F+GIDN  +A  L    L     D    ELEE EF   DL  +E      G   
Sbjct: 76  SVFVVRFAGIDNREAAEALIGQTLMVPADDRP--ELEEGEFHLLDLVGLEARLSADGDAI 133

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQEN 158
           G V  + + G   +LE+K     T ++PF +  V EV++ + 
Sbjct: 134 GTVSDLIS-GGNELLELKTPDGDTLMVPFVEAIVPEVHVDDG 174


>gi|42568351|ref|NP_568663.2| 16S rRNA processing protein RimM family [Arabidopsis thaliana]
 gi|10177579|dbj|BAB10810.1| unnamed protein product [Arabidopsis thaliana]
 gi|332008000|gb|AED95383.1| RimM-like 16S rRNA processing protein [Arabidopsis thaliana]
          Length = 653

 Score = 45.4 bits (106), Expect = 0.004,   Method: Composition-based stats.
 Identities = 53/193 (27%), Positives = 82/193 (42%), Gaps = 28/193 (14%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDL-----NRYVLYSN-------DNRELRILKMY 54
           LV +  +   HGL GE+ I    + P DL      R  L          D  EL   + +
Sbjct: 80  LVEVGFLSGVHGLQGEICIKPNTDFP-DLRFSKPGRRWLKQQLLGQDKIDEVELVEGRPH 138

Query: 55  RKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQ-G 113
              K +I  F G+D++    +L    L A+  D    EL+E EF++ DL  M    ++ G
Sbjct: 139 PAQKSWILKFRGLDDVDQVRQLVGATLLAEDDD--RPELDEGEFYSRDLVGMRVLLKETG 196

Query: 114 KYWGQVCGVYNFGAGSIL--------EIKNTMEKT---FLIPFTKFAVLEVNLQENKILI 162
           +  G V  +++ G   +L        E+ N   KT     IPF    V +V+L+  ++ I
Sbjct: 197 QLVGTVANIFDNGGNDLLHVLLDSSMEVCNGNAKTNQLVWIPFVDAIVPDVDLERKEMYI 256

Query: 163 DPIAAGLNNTTMK 175
            P   GL    M+
Sbjct: 257 TP-PKGLLEVNMR 268


>gi|188585997|ref|YP_001917542.1| 16S rRNA processing protein RimM [Natranaerobius thermophilus
           JW/NM-WN-LF]
 gi|229564324|sp|B2A2N9|RIMM_NATTJ RecName: Full=Ribosome maturation factor rimM
 gi|179350684|gb|ACB84954.1| 16S rRNA processing protein RimM [Natranaerobius thermophilus
           JW/NM-WN-LF]
          Length = 179

 Score = 45.4 bits (106), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 43/171 (25%), Positives = 80/171 (46%), Gaps = 11/171 (6%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYA---NNPIDLNR-YVLYSNDNRELRILKM---YRKNKR 59
           LV +  I  THG+ GE+ + S     N   +L+R Y++   D+ +  I  +   +     
Sbjct: 7   LVYVGKIVGTHGVKGELKVISLTDIENRFNELDRVYLVNEQDHYDPIIAHIESSFTHKNM 66

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  FS  D+I+      D  +   R++    +LEEDE++   +  +     + ++ G V
Sbjct: 67  EIVKFSEWDDINQVEGFHDWYIKIPREERP--QLEEDEYYFDQITGLSVVTVEDEFLGTV 124

Query: 120 CGVYNFGAGSILEI-KNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
             +Y  G+  + E+ K   +K  LIP     V +++L E  +++D +  GL
Sbjct: 125 TNIYQTGSNDVYEVSKEQDDKPILIPALYEVVKKIDLDEQIMIVD-LPEGL 174


>gi|125718119|ref|YP_001035252.1| 16S rRNA-processing protein RimM [Streptococcus sanguinis SK36]
 gi|166226482|sp|A3CNE7|RIMM_STRSV RecName: Full=Ribosome maturation factor rimM
 gi|125498036|gb|ABN44702.1| RimM protein, required for 16S rRNA processing, putative
           [Streptococcus sanguinis SK36]
          Length = 172

 Score = 45.4 bits (106), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/169 (23%), Positives = 83/169 (49%), Gaps = 11/169 (6%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDL----NRYVLYSNDNRELRILKM--YRKNKRF-IA 62
           +  I  T GL GE+ + S  +   +     N+  L+   ++ +  +++  +RK K F I 
Sbjct: 6   VGKIVNTQGLQGEMRVLSVTDFAEERFKKGNKLALFDKKDQFVMDVEIASHRKAKNFDII 65

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F G+ +I+   + RD  L    +D  D  LE+ EF+  ++  +E ++      G +  +
Sbjct: 66  KFKGMYHINDIEKFRDFSLKVAEEDLAD--LEDGEFYYHEIIGLEVYEND-VLLGTIKEI 122

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN 171
              GA  +  +K   ++  L+P+    VL +N+++ ++ ++ I  GL++
Sbjct: 123 LQPGANDVWVVKRKGKRDLLLPYIPPVVLGINIEQGRVDVE-IPEGLDD 170


>gi|297626597|ref|YP_003688360.1| 16S rRNA processing protein [Propionibacterium freudenreichii
           subsp. shermanii CIRM-BIA1]
 gi|296922362|emb|CBL56934.1| 16S rRNA processing protein [Propionibacterium freudenreichii
           subsp. shermanii CIRM-BIA1]
          Length = 183

 Score = 45.4 bits (106), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/158 (24%), Positives = 69/158 (43%), Gaps = 9/158 (5%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNR---YVLYSNDNRELRILKMYRKNKRFIATF 64
           V++A IG  HG+ GE+ +    + P    R    +  S+ +R   +      + R + T 
Sbjct: 6   VVVAVIGRAHGVRGELTLTVRTDEPDRRLRKGVRLRASDPDRSFVVESARWVSGRLVVTL 65

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEED--EFFNTDLEEMETFDRQGKYWGQVCGV 122
            G+ + ++A  LR   L+A   D   +E  ED  EF++  L  M       +  G V  V
Sbjct: 66  GGVADRNAAEALRGTVLFA---DVPRDERPEDSEEFYDRQLIGMAVELADQRRVGVVSDV 122

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKI 160
            +  A  +L ++ T     L+PF +  V  V+ +   +
Sbjct: 123 LHLPAQDVLSVR-TDAGERLVPFVRELVPHVDAEAGVV 159


>gi|50955113|ref|YP_062401.1| 16S rRNA processing protein [Leifsonia xyli subsp. xyli str.
           CTCB07]
 gi|59798682|sp|Q6AEA0|RIMM_LEIXX RecName: Full=Ribosome maturation factor rimM
 gi|50951595|gb|AAT89296.1| 16S rRNA processing protein [Leifsonia xyli subsp. xyli str.
           CTCB07]
          Length = 217

 Score = 45.4 bits (106), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 65/160 (40%), Gaps = 16/160 (10%)

Query: 16  THGLNGEVYIDSYANNP-----------IDLNRYVLYSNDNRELRILKMYRKNKRFIATF 64
            HGL G + ++ + + P           + +     +      LR L+ Y  N   +  F
Sbjct: 28  AHGLKGAIKLELFTDEPGKRFVPGAVFTLQVPTASKWHGKTLALRELRWY--NGHPVGFF 85

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
            G+D+   A  L    L+   QD ++   EED +++  L  +    R G   G +  V +
Sbjct: 86  DGVDDRTEAESLVKAILWVN-QDVRELPDEEDAWYDNQLVGLSAH-RDGAVVGAIVRVDH 143

Query: 125 FGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
                +L IK T     L+PF K  V EV+L    + + P
Sbjct: 144 LPGQDLLAIK-TPGGEVLVPFVKAIVPEVDLAARTVTLTP 182


>gi|224370182|ref|YP_002604346.1| RimM [Desulfobacterium autotrophicum HRM2]
 gi|223692899|gb|ACN16182.1| RimM [Desulfobacterium autotrophicum HRM2]
          Length = 172

 Score = 45.4 bits (106), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 43/166 (25%), Positives = 70/166 (42%), Gaps = 12/166 (7%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANN----PIDLNRYVLYSNDNREL-RILKMYRKNKRFI 61
           L  +  +   HGL G + + S+A +       L   V  S    E   ILK     K  +
Sbjct: 5   LFTLGVVTGVHGLKGFLKVRSFAGSLETFKSGLEMVVRRSGKADECYTILKASPHKKGIL 64

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
             FSG+D   +A      +L   R+     E E+D +F  DL  ++  DR   + G +  
Sbjct: 65  MQFSGVDR-DAAETFVGAELLVDRRLLP--EPEDDAYFWEDLIGLKVTDRTLGFLGTIDS 121

Query: 122 VYNFGAGSILEIKNT----MEKTFLIPFTKFAVLEVNLQENKILID 163
           +   G+  +  +KN       K FLIP     V+ V+L+  ++ +D
Sbjct: 122 IMETGSNDVFVVKNKDKGLKNKEFLIPGLASVVIGVDLERGEMTVD 167


>gi|312134786|ref|YP_004002124.1| 16S rRNA processing protein rimm [Caldicellulosiruptor owensensis
           OL]
 gi|311774837|gb|ADQ04324.1| 16S rRNA processing protein RimM [Caldicellulosiruptor owensensis
           OL]
          Length = 169

 Score = 45.4 bits (106), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 42/156 (26%), Positives = 75/156 (48%), Gaps = 6/156 (3%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNP---IDLNRYVLYSNDNRELRILKMYRKNKRFIA 62
           K + +  I  T GL GEV +    +      +L   +L  N + +L I +   K+   I 
Sbjct: 3   KYLQVGKIVNTFGLKGEVKVIPLTDEVDRFSELEYVLLEDNLSTKLTIERYRVKDNIVII 62

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F  I +I  A +L++  +  +R+  K  +L +D +F  D+  +E +D  G+  G++  V
Sbjct: 63  KFKEISSIDEAQKLKNRYIVIERERAK--KLPKDTYFICDIIGLEVYDLDGRKLGRIKDV 120

Query: 123 YNFGAGSILEIKNTM-EKTFLIPFTKFAVLEVNLQE 157
              G+  +    + + +K  LIP  K  V EVN++E
Sbjct: 121 LKTGSNDVYICDSYIGKKDILIPALKDIVKEVNIEE 156


>gi|256379918|ref|YP_003103578.1| 16S rRNA processing protein RimM [Actinosynnema mirum DSM 43827]
 gi|255924221|gb|ACU39732.1| 16S rRNA processing protein RimM [Actinosynnema mirum DSM 43827]
          Length = 172

 Score = 45.4 bits (106), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/165 (21%), Positives = 67/165 (40%), Gaps = 11/165 (6%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS--------NDNRELRILKMYRKNKR 59
           V++  +   HG+ GE+ +D   ++P    R+ L S          +R+L +      + R
Sbjct: 3   VVVGRVAKAHGIRGELAVDVRTDSP--EARFALGSVLAAKLRDGTSRDLTVAAARYHSGR 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +  F  +     A  LR   L          + + DEF++  LE +      G   G V
Sbjct: 61  LLVRFEEVLTRDVAELLRGTLLLGSTDALPPTD-DPDEFYDHQLEGLAAELADGTRIGTV 119

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
             + +   G +L +        L+PF +  V  V++   ++++DP
Sbjct: 120 KEIVHGPGGELLVLVREDGSEALVPFVRQIVPTVDVAGGRVVVDP 164


>gi|258406143|ref|YP_003198885.1| 16S rRNA processing protein RimM [Desulfohalobium retbaense DSM
           5692]
 gi|257798370|gb|ACV69307.1| 16S rRNA processing protein RimM [Desulfohalobium retbaense DSM
           5692]
          Length = 182

 Score = 45.4 bits (106), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 42/176 (23%), Positives = 77/176 (43%), Gaps = 8/176 (4%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPI---DLNR-YVLYSNDNRELRILKMYRKNK-RF 60
           +LV +  I    GL GEV ++ +A+ P     L R Y+ +     +   +  +R +K R 
Sbjct: 5   RLVPIGRIAKPLGLRGEVCLEPHADFPFVFASLERIYLQFERRRPKPYAVLSHRVHKGRD 64

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +    GI+   +A  +R  ++ A+ +D    E ++      DL         G + G+V 
Sbjct: 65  VLLLHGIEGRDAAESIRGREVLARARDLP--EPDDAVLLRQDLPGCRVELEDGAWVGEVL 122

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKN 176
            V +  A  +  I     +  L P  +  VL+V+L+   ++I P   GL +  + N
Sbjct: 123 EVQDNRAQDVWVILGPQGQEILFPVCEAFVLDVDLERRVVVIRP-PEGLLDLYLHN 177


>gi|218132455|ref|ZP_03461259.1| hypothetical protein BACPEC_00314 [Bacteroides pectinophilus ATCC
           43243]
 gi|217992565|gb|EEC58567.1| hypothetical protein BACPEC_00314 [Bacteroides pectinophilus ATCC
           43243]
          Length = 169

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 74/163 (45%), Gaps = 6/163 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNP--IDLNRYVLYSNDNRELRI-LKMYRKNKRF 60
           +++ + +  I +THG+ GEV +    ++P   D    V+       +++ ++  +  K+F
Sbjct: 1   MEQTLRVGVITSTHGIRGEVKVFPTTDDPKRFDYLEEVIVDMKREPVKLEIEGVKYFKQF 60

Query: 61  -IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F G DNI+   +     L   R++    ELE+ EFF  DL  ++    +G   G +
Sbjct: 61  VILKFKGYDNINDIQQFVKKDLLVTRENAV--ELEDGEFFICDLVGLKVVTDEGVELGVL 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
             +   GA  +  +     K  LIP     +LE N +E  I +
Sbjct: 119 KDIMQTGANDVYVVGMNDGKEVLIPSIPQCILEKNPEEGYIRV 161


>gi|307330036|ref|ZP_07609187.1| 16S rRNA processing protein RimM [Streptomyces violaceusniger Tu
           4113]
 gi|306884297|gb|EFN15332.1| 16S rRNA processing protein RimM [Streptomyces violaceusniger Tu
           4113]
          Length = 215

 Score = 45.1 bits (105), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 37/161 (22%), Positives = 77/161 (47%), Gaps = 5/161 (3%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNP-IDLNRYVLYSNDNRE---LRILKMYRKNKRFIAT 63
           +++A IG  HG+ GEV ++   + P + L    + + +      L I      + R +  
Sbjct: 3   LVVARIGRAHGIKGEVTVEVRTDEPELRLGPGAVLTTEPASAGPLTIESGRVHSGRLLLR 62

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F G+ +  +A  LR++ L A+  D ++   + +EF++  L +++     G   G++  + 
Sbjct: 63  FEGVRDRSAAEALRNILLIAE-VDPEELPEDPEEFYDHQLIDIDVVTVDGTEVGRISEIS 121

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           +     +L +K       +IPF    V E++L+  + +IDP
Sbjct: 122 HLPYQDLLIVKRPDGGEVMIPFVSEFVPEIDLEAQRAVIDP 162


>gi|68536268|ref|YP_250973.1| 16S rRNA-processing protein [Corynebacterium jeikeium K411]
 gi|260578968|ref|ZP_05846871.1| probable 16S rRNA-processing protein RimM [Corynebacterium jeikeium
           ATCC 43734]
 gi|109893009|sp|Q4JV02|RIMM_CORJK RecName: Full=Ribosome maturation factor rimM
 gi|68263867|emb|CAI37355.1| 16S rRNA processing protein [Corynebacterium jeikeium K411]
 gi|258602942|gb|EEW16216.1| probable 16S rRNA-processing protein RimM [Corynebacterium jeikeium
           ATCC 43734]
          Length = 187

 Score = 45.1 bits (105), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 76/172 (44%), Gaps = 28/172 (16%)

Query: 17  HGLNGEVYIDSYANNP---IDLNRYVLYSNDNRELRI-LKMYRKNK-RFIATFSGIDNIH 71
           HG+ GEV +D   + P         +      +EL + ++ +R ++ R + TF  I +  
Sbjct: 12  HGVRGEVVVDPTTDTPELRFATGEVLKGKQAGKELSLTVRSFRPHQGRLLVTFEEIADRT 71

Query: 72  SASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETF------------DRQGKYWGQV 119
           +A  LR ++ +A      DE  ++D F++ +LE +  +             + G   G+V
Sbjct: 72  AAESLRGVRFFAA--PVHDE--DDDGFYDHELEGLTAYLLAPGTDLKGDEIQLGDLVGEV 127

Query: 120 CGVYNFGAGSILEI-------KNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
             V +  AG +L I         T  K  L+PF    V  V+L+E  +++ P
Sbjct: 128 VAVEHTPAGQLLVILIDAESQLPTAGKEVLVPFRHQIVPVVDLEEEILVLTP 179


>gi|312622770|ref|YP_004024383.1| 16S rRNA processing protein rimm [Caldicellulosiruptor
           kronotskyensis 2002]
 gi|312203237|gb|ADQ46564.1| 16S rRNA processing protein RimM [Caldicellulosiruptor
           kronotskyensis 2002]
          Length = 169

 Score = 45.1 bits (105), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 77/165 (46%), Gaps = 6/165 (3%)

Query: 10  MATIGTTHGLNGEVYIDSYANNP---IDLNRYVLYSNDNRELRILKMYRKNKRFIATFSG 66
           +  I  T GL GEV +    +      +L   +L  N + +L I +   K+   I  F  
Sbjct: 7   VGKIVNTFGLKGEVKVIPLTDEVDRFSELEYVLLEDNLSTKLTIERYRVKDNVVIIKFKE 66

Query: 67  IDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFG 126
           I  I  A +L++  +  +R+  K  +L +D +F  D+  +E +D  G+  G++  V   G
Sbjct: 67  ISCIDEAQKLKNKYIVIERERAK--KLPKDAYFICDIIGLEVYDLDGRKLGRIKDVLKTG 124

Query: 127 AGSILEIKNTM-EKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           +  +    + + +K  LIP  K  V EVN++E  + I  +   L+
Sbjct: 125 SNDVYICDSYIGKKDILIPALKEIVKEVNIEEGYMKIKVVEGLLD 169


>gi|163782681|ref|ZP_02177678.1| hypothetical protein HG1285_17395 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159882254|gb|EDP75761.1| hypothetical protein HG1285_17395 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 164

 Score = 45.1 bits (105), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 74/157 (47%), Gaps = 9/157 (5%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNR----ELRILKMYRKNKRFIAT 63
           V++  +  T G+ GE+ +  +A   I  N   +Y   +       ++ ++      F+  
Sbjct: 4   VVIGRVIDTFGVKGELKVIPFAPVEIFENLSKVYLKRSGGGYIPFKVERVKEHGNAFVIK 63

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
             G D +  A + R   L+   ++    E  EDEF+  +L  ME +  +G+  G+V  V 
Sbjct: 64  LKGYDFLEEADQFRGAHLFLPEKELPPRE--EDEFYAYELVGMEVWTDKGRRLGRVKRVE 121

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKI 160
           + G   +L +++  EKT +IPF    VL+V+ +  ++
Sbjct: 122 DLGVYDMLILED--EKT-MIPFVGDIVLDVDREGKRV 155


>gi|325267105|ref|ZP_08133774.1| 16S rRNA processing protein RimM [Kingella denitrificans ATCC
           33394]
 gi|324981458|gb|EGC17101.1| 16S rRNA processing protein RimM [Kingella denitrificans ATCC
           33394]
          Length = 169

 Score = 45.1 bits (105), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 69/160 (43%), Gaps = 7/160 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDS---YANNPIDLNRYVLYSNDN-RELRILKMYRKNKRFIAT 63
           V M  I    G+ G V + +   YA++ +D   + L    N R   I             
Sbjct: 8   VAMGYIKGAFGVKGWVKVHAGTEYADSLLDYPEWRLTKGGNVRVAEIEASKVAGDELQVK 67

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F+ I++   A+ LR   +   R++F   E EEDE++  DL  M   +R+    G+V  + 
Sbjct: 68  FAHINDRDEAALLRGYTIEIARENFA--ETEEDEYYWADLVGMSVVNREQAVLGEVVKLM 125

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
             GA  +L ++    +  LIPF    +  V+ +  KI  D
Sbjct: 126 ETGAHDVLVVRGEYGEK-LIPFVSHYIDGVDAENRKITAD 164


>gi|91228774|ref|ZP_01262684.1| 16S rRNA-processing protein [Vibrio alginolyticus 12G01]
 gi|262393310|ref|YP_003285164.1| 16S rRNA processing protein RimM [Vibrio sp. Ex25]
 gi|269966293|ref|ZP_06180381.1| 16S rRNA-processing protein [Vibrio alginolyticus 40B]
 gi|91187681|gb|EAS74003.1| 16S rRNA-processing protein [Vibrio alginolyticus 12G01]
 gi|262336904|gb|ACY50699.1| 16S rRNA processing protein RimM [Vibrio sp. Ex25]
 gi|269829090|gb|EEZ83336.1| 16S rRNA-processing protein [Vibrio alginolyticus 40B]
          Length = 182

 Score = 45.1 bits (105), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 39/166 (23%), Positives = 75/166 (45%), Gaps = 12/166 (7%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNR----ELRILKMYRKNKRFIAT 63
           +++   G T+G+ G + + SY +N   +  Y  +  + +    E ++    R NK  +A 
Sbjct: 14  IVVGKFGATYGIRGWLKVFSYTDNAESIFDYSPWYINQKGKWVEYKVESWKRHNKGMVAK 73

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
             G+D    A  + + ++          EL EDEF+  +L  M+    +G   G V  + 
Sbjct: 74  LEGMDVREDAHLMTNFEIAIDPAVLP--ELSEDEFYWRELFGMQVVTTKGYDLGVVTDML 131

Query: 124 NFGAGSILEIKNTMEKTF-----LIPFTKFAV-LEVNLQENKILID 163
             G+  +L +K  ++  F     LIPF +  V + V+ +  +I +D
Sbjct: 132 ETGSNDVLVVKANLKDAFGQKERLIPFLEEQVIINVDREAQRIEVD 177


>gi|298252294|ref|ZP_06976097.1| 16S rRNA processing protein RimM [Ktedonobacter racemifer DSM
           44963]
 gi|297546886|gb|EFH80754.1| 16S rRNA processing protein RimM [Ktedonobacter racemifer DSM
           44963]
          Length = 198

 Score = 45.1 bits (105), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 36/173 (20%), Positives = 72/173 (41%), Gaps = 11/173 (6%)

Query: 11  ATIG---TTHGLNGEVYIDSYANNPIDLN--RYVLYSNDNRELR--ILKMYR--KNKRFI 61
           ATIG      G+ GE+ +    + P      + V  S D    +  I+   R  K    +
Sbjct: 10  ATIGKIVALFGVRGELKVLPLTDIPDRFTSLKAVHVSTDGHTFKRCIITSVRPYKGDMLL 69

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               GI + + A  LRD  L+    +    +L  D ++  D+  ++ +    +  GQ+  
Sbjct: 70  VKLEGITSANDAEALRDQSLWIPESELA--QLPPDSYYQHDILGLKVYTLSNQEVGQIVD 127

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTM 174
           ++  G   +  ++    K  +IP  K  V ++++    + IDP+   L++  +
Sbjct: 128 LFPTGGNDVYVVRTPERKEVMIPAIKTVVHQIDVLRGVMYIDPLPGLLDDQAV 180


>gi|86606190|ref|YP_474953.1| 16S rRNA-processing protein RimM [Synechococcus sp. JA-3-3Ab]
 gi|109893059|sp|Q2JUD0|RIMM_SYNJA RecName: Full=Ribosome maturation factor rimM
 gi|86554732|gb|ABC99690.1| 16S rRNA processing protein RimM [Synechococcus sp. JA-3-3Ab]
          Length = 186

 Score = 45.1 bits (105), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 36/165 (21%), Positives = 72/165 (43%), Gaps = 12/165 (7%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLN----RYVLYSNDNRELRIL----KMYRKNKR 59
           +L+  +   HGL G + +  +++ P  L     R++   +D   L       + +     
Sbjct: 10  LLVGQVVAAHGLRGWLRVKCWSDFPERLTEPGPRWLQRDSDPEPLLHPLIEGQFFPAKGL 69

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
           ++    GI +  +A      K+       +   LE +E+  +DL  +  +  QG+  G V
Sbjct: 70  YLVRLEGIPDRTAAEAWVGAKVLVPAS--QRLPLEPEEYHYSDLIGLAVY-HQGRLLGHV 126

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
             ++  G   +LEI    ++  LIPF K  V  V+L++ ++ + P
Sbjct: 127 SAIWAAGQ-DVLEIATPDKRQVLIPFVKALVPVVDLEKGELQVQP 170


>gi|261380055|ref|ZP_05984628.1| 16S rRNA processing protein RimM [Neisseria subflava NJ9703]
 gi|284797269|gb|EFC52616.1| 16S rRNA processing protein RimM [Neisseria subflava NJ9703]
          Length = 169

 Score = 45.1 bits (105), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 68/161 (42%), Gaps = 9/161 (5%)

Query: 8   VLMATIGTTHGLNGEVYIDS---YANNPIDLNRYVLYSNDNRELRILKMYRK--NKRFIA 62
           V M  I    G+ G + I +   Y ++ +D   + L   D + L ++    K  N     
Sbjct: 8   VAMGYIKGVFGIKGWLKIAANTEYTDSLLDYPEWQL-CKDGKTLNVVLEAGKIVNGELQV 66

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F GID+   A  LR   +   R+ F     EEDE++  DL  M   +++    G+V  +
Sbjct: 67  KFEGIDDRDQAFALRGYTIEIPRESFA--PTEEDEYYWADLVGMTVINKENIVLGKVSNL 124

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
              GA  +L IK    +  LIPF    +  V+     I+ D
Sbjct: 125 METGANDVLMIKGKHGQ-ILIPFVSNYIESVDTDSKTIIAD 164


>gi|21230657|ref|NP_636574.1| 16S rRNA-processing protein RimM [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66769348|ref|YP_244110.1| 16S rRNA-processing protein RimM [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|24418648|sp|Q8PBC2|RIMM_XANCP RecName: Full=Ribosome maturation factor rimM
 gi|81304695|sp|Q4US83|RIMM_XANC8 RecName: Full=Ribosome maturation factor rimM
 gi|21112243|gb|AAM40498.1| 16S rRNA processing protein RimM [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66574680|gb|AAY50090.1| 16S rRNA processing protein RimM [Xanthomonas campestris pv.
           campestris str. 8004]
          Length = 170

 Score = 45.1 bits (105), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 36/169 (21%), Positives = 75/169 (44%), Gaps = 10/169 (5%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY-----SNDNRELRILKMYR 55
           M   ++ +L+  I    G+ GE+ ++S+      + RY  +     S     L  ++   
Sbjct: 1   MKPTERRILLGRIVGAFGVKGELKLESWTEPRSAIFRYQPWIVRTPSGQESVLSGVRGRD 60

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
           + K  IA F  I +  +   +   ++Y  R      +   DE++  DLE ++    +G  
Sbjct: 61  QGKNLIAVFPDITDRDTVEAMHGTEIYVARSALPPPK--PDEYYWVDLEGLQVETVEGVK 118

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFT-KFAVLEVNLQENKILID 163
            G V  +++ G+  ++ ++   E+  +IPF     V  V+ + N I++D
Sbjct: 119 LGTVSHLFSTGSNDVVVVRGDRER--MIPFVLPEYVKSVDFEANLIVVD 165


>gi|153951260|ref|YP_001398343.1| 16S rRNA processing protein RimM [Campylobacter jejuni subsp.
           doylei 269.97]
 gi|166226431|sp|A7H4B3|RIMM_CAMJD RecName: Full=Ribosome maturation factor rimM
 gi|152938706|gb|ABS43447.1| 16S rRNA processing protein RimM [Campylobacter jejuni subsp.
           doylei 269.97]
          Length = 179

 Score = 45.1 bits (105), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 43/167 (25%), Positives = 79/167 (47%), Gaps = 17/167 (10%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNR-YVLYSNDNRELRILKMYRKNKRFIATFS 65
            V +A +G T GL G V + + ++      +    +  + +E+  +K Y  +   +  F 
Sbjct: 6   FVQVAKLGKTVGLKGYVKLHNLSDFSSQFKKDATFFIKNTKEMLKIKHYNASNSTVL-FE 64

Query: 66  GIDNIHSASELRDLKLYAK----RQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
             ++I  A EL +L L+      RQ  K   L++DEFF  D+ E E F+ + K  G+V  
Sbjct: 65  NYEDIEKAKELTNLILFQSIEKSRQTCK---LKKDEFFYFDILECEVFE-EDKRLGKVVD 120

Query: 122 VYNFGAGSILEIKNTME-------KTFLIPFTKFAVLEVNLQENKIL 161
           +   GA  + EI++  +       K F IP+    V  +++++ +I 
Sbjct: 121 ILETGASYLFEIQSDEKWVEKKYPKIFFIPYLDKFVKNIDIEKRQIF 167


>gi|270158991|ref|ZP_06187647.1| 16S rRNA processing protein RimM [Legionella longbeachae D-4968]
 gi|289166168|ref|YP_003456306.1| 16S rRNA processing protein RimM [Legionella longbeachae NSW150]
 gi|269987330|gb|EEZ93585.1| 16S rRNA processing protein RimM [Legionella longbeachae D-4968]
 gi|288859341|emb|CBJ13277.1| putative 16S rRNA processing protein RimM [Legionella longbeachae
           NSW150]
          Length = 168

 Score = 45.1 bits (105), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/143 (22%), Positives = 66/143 (46%), Gaps = 10/143 (6%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPID-----LNRYVLYSNDNRELRILKMYRKNKRFIA 62
           +++A  G  HG+ G V + S+   P D      N +   +N  + +++++   ++K  I 
Sbjct: 7   IIIARFGRPHGVKGFVTVHSFTE-PRDNVLKYTNWHAFINNKWQPIKLMRAEVQSKSIIV 65

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
              G       + L ++++   R     E+L   E++   L  M   ++QG+ +G+V  +
Sbjct: 66  QIEGYSERELVAHLTNIEIAVHRDQL--EKLNPGEYYWHQLIGMNVINQQGETFGKVTEI 123

Query: 123 YNFGAGSILEIKNTMEKTFLIPF 145
              GA  +L ++    K  LIP+
Sbjct: 124 IPTGANDVLVVEGN--KRHLIPY 144


>gi|188992534|ref|YP_001904544.1| 16S rRNA-processing protein RimM [Xanthomonas campestris pv.
           campestris str. B100]
 gi|229890157|sp|B0RXD8|RIMM_XANCB RecName: Full=Ribosome maturation factor rimM
 gi|167734294|emb|CAP52504.1| 16S rRNA processing protein RimM [Xanthomonas campestris pv.
           campestris]
          Length = 170

 Score = 45.1 bits (105), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 36/169 (21%), Positives = 75/169 (44%), Gaps = 10/169 (5%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY-----SNDNRELRILKMYR 55
           M   ++ +L+  I    G+ GE+ ++S+      + RY  +     S     L  ++   
Sbjct: 1   MKPTERRILLGRIVGAFGVKGELKLESWTEPRSAIFRYQPWIVRTPSGQESVLSGVRGRD 60

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
           + K  IA F  I +  +   +   ++Y  R      +   DE++  DLE ++    +G  
Sbjct: 61  QGKNLIAVFPDITDRDTVEAMHGTEIYVARSALPPPK--PDEYYWVDLEGLQVETVEGIK 118

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFT-KFAVLEVNLQENKILID 163
            G V  +++ G+  ++ ++   E+  +IPF     V  V+ + N I++D
Sbjct: 119 LGAVSHLFSTGSNDVVVVRGDRER--MIPFVLPEYVKSVDFEANLIVVD 165


>gi|237756216|ref|ZP_04584780.1| 16S rRNA processing protein RimM [Sulfurihydrogenibium
           yellowstonense SS-5]
 gi|237691626|gb|EEP60670.1| 16S rRNA processing protein RimM [Sulfurihydrogenibium
           yellowstonense SS-5]
          Length = 166

 Score = 45.1 bits (105), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 73/159 (45%), Gaps = 5/159 (3%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYR-KNKRFIATFS 65
           L+ +  I  THG+ G +  + +  N   L   +   ++  EL+ L +     K+ +  F 
Sbjct: 5   LIAIGKIHGTHGVKGNLKFEIFVKN-FYLPEEIYIKDEENELQPLNIETIDRKKGLIKFK 63

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNF 125
             D    A E+    +Y   +     +L EDEF+   L  M  +    K  G+V  + + 
Sbjct: 64  NYDTPEKAKEISHKLIYVPEELLP--KLGEDEFYEFQLIGMNVY-YNDKLIGKVEKIDDR 120

Query: 126 GAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
            + + L IK T EKT  +PF    V +VN++ENK+ I P
Sbjct: 121 LSQAYLIIKCTDEKTRHLPFINEFVKDVNVEENKMQITP 159


>gi|188996312|ref|YP_001930563.1| 16S rRNA processing protein RimM [Sulfurihydrogenibium sp. YO3AOP1]
 gi|209573623|sp|B2V7T6|RIMM_SULSY RecName: Full=Ribosome maturation factor rimM
 gi|188931379|gb|ACD66009.1| 16S rRNA processing protein RimM [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 166

 Score = 44.7 bits (104), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 74/159 (46%), Gaps = 5/159 (3%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKN-KRFIATFS 65
           L+ +  I  THG+ G +  + +  N   L   +   ++  EL+ L +   + K+ +  F 
Sbjct: 5   LIAIGKIHGTHGVKGNLKFEIFVKN-FYLPEEIYIKDEENELQPLNIETVDRKKGLIKFK 63

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNF 125
             D    A E+    +Y         +L EDEF+   L  M+ +    K  G+V  + + 
Sbjct: 64  NYDTPEKAKEISHRLIYVPEDLLP--KLGEDEFYEFQLIGMDVY-YNDKLIGKVEKIDDR 120

Query: 126 GAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
            + + L IK T EKT  +PF    V +VN++ENK+ I P
Sbjct: 121 LSQAYLIIKCTDEKTRHLPFINEFVKDVNVKENKMQITP 159


>gi|28899306|ref|NP_798911.1| 16S rRNA-processing protein RimM [Vibrio parahaemolyticus RIMD
           2210633]
 gi|153838717|ref|ZP_01991384.1| 16S rRNA processing protein RimM [Vibrio parahaemolyticus AQ3810]
 gi|260363660|ref|ZP_05776456.1| 16S rRNA processing protein RimM [Vibrio parahaemolyticus K5030]
 gi|260879002|ref|ZP_05891357.1| 16S rRNA processing protein RimM [Vibrio parahaemolyticus AN-5034]
 gi|260897212|ref|ZP_05905708.1| 16S rRNA processing protein RimM [Vibrio parahaemolyticus Peru-466]
 gi|31076894|sp|Q87LS9|RIMM_VIBPA RecName: Full=Ribosome maturation factor rimM
 gi|28807530|dbj|BAC60795.1| 16S rRNA processing protein RimM [Vibrio parahaemolyticus RIMD
           2210633]
 gi|149747877|gb|EDM58755.1| 16S rRNA processing protein RimM [Vibrio parahaemolyticus AQ3810]
 gi|308088448|gb|EFO38143.1| 16S rRNA processing protein RimM [Vibrio parahaemolyticus Peru-466]
 gi|308089631|gb|EFO39326.1| 16S rRNA processing protein RimM [Vibrio parahaemolyticus AN-5034]
 gi|308111019|gb|EFO48559.1| 16S rRNA processing protein RimM [Vibrio parahaemolyticus K5030]
 gi|328474161|gb|EGF44966.1| 16S rRNA-processing protein RimM [Vibrio parahaemolyticus 10329]
          Length = 182

 Score = 44.7 bits (104), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 39/166 (23%), Positives = 75/166 (45%), Gaps = 12/166 (7%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNR----ELRILKMYRKNKRFIAT 63
           +++   G T+G+ G + + SY +N   +  Y  +  + +    E ++    R NK  +A 
Sbjct: 14  IVVGKFGATYGIRGWLKVFSYTDNAESIFDYSPWYINQKGKWVEYKVESWKRHNKGMVAK 73

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
             G+D    A  + + ++          EL EDEF+  +L  M     +G   G V  + 
Sbjct: 74  LEGMDVREDAHLMTNFEIAIDPAVLP--ELSEDEFYWRELFGMHVVTTKGYDLGVVTDML 131

Query: 124 NFGAGSILEIKNTMEKTF-----LIPFTKFAV-LEVNLQENKILID 163
             G+  +L +K  ++  F     LIPF +  V ++V+ +  +I +D
Sbjct: 132 ETGSNDVLVVKANLKDAFGQKERLIPFLEEQVIIKVDREAQRIEVD 177


>gi|52785581|ref|YP_091410.1| 16S rRNA-processing protein RimM [Bacillus licheniformis ATCC
           14580]
 gi|163119432|ref|YP_078995.2| 16S rRNA-processing protein RimM [Bacillus licheniformis ATCC
           14580]
 gi|319646017|ref|ZP_08000247.1| 16S rRNA-processing protein rimM [Bacillus sp. BT1B_CT2]
 gi|81385584|sp|Q65JP7|RIMM_BACLD RecName: Full=Ribosome maturation factor rimM
 gi|52348083|gb|AAU40717.1| RimM [Bacillus licheniformis ATCC 14580]
 gi|145902939|gb|AAU23357.2| 16S rRNA processing protein [Bacillus licheniformis ATCC 14580]
 gi|317391767|gb|EFV72564.1| 16S rRNA-processing protein rimM [Bacillus sp. BT1B_CT2]
          Length = 174

 Score = 44.7 bits (104), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 35/160 (21%), Positives = 73/160 (45%), Gaps = 9/160 (5%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNR-----YVLYSNDNRELRI-LKMYRKNKRF-IA 62
           +  I  THG+ GEV + S  + P +  +     Y+     +  +++ +  +R +K+F + 
Sbjct: 8   VGKIVNTHGVKGEVRVISRTDFPEERYKPGNALYLFLEGKDEPVQVTVSAHRLHKQFHLL 67

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F  ++ +  A +L++  +          +L EDE++  ++   + F   G   G+V  +
Sbjct: 68  QFKEVETLTEAEKLKNALIKVPEDQLS--QLAEDEYYFHEIIGCDVFSEDGDLIGKVKEI 125

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
              GA  +  +    +K  LIP+    V E+N+ +  I I
Sbjct: 126 LTPGANDVWVVARPGKKDALIPYIDAVVKEINVADKTIKI 165


>gi|327470887|gb|EGF16343.1| 16S rRNA processing protein RimM [Streptococcus sanguinis SK330]
          Length = 172

 Score = 44.7 bits (104), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 39/169 (23%), Positives = 84/169 (49%), Gaps = 11/169 (6%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDL----NRYVLYSNDNRELRILKM--YRKNKRF-IA 62
           + TI  T GL GE+ + S  +   +     N   L+   ++ +  +++  +RK K F I 
Sbjct: 6   VGTIVNTQGLQGEMRVLSVTDFAEERFKKGNTLALFDKKDQFVMDVEIASHRKVKNFDII 65

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F G+ +I+   + RD  L  + +D  D  LE+ EF+  ++  +E ++      G +  +
Sbjct: 66  KFKGMYHINDIEKFRDFTLKVREEDLTD--LEDGEFYYHEIIGLEVYEND-ILLGTIKEI 122

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN 171
              GA  +  +K   ++  L+P+    VL +++++ ++ ++ I  GL++
Sbjct: 123 LQPGANDVWVVKRKGKRDLLLPYIPPVVLGIDIEQGRVDVE-IPEGLDD 170


>gi|329947883|ref|ZP_08294815.1| 16S rRNA processing protein RimM [Actinomyces sp. oral taxon 170
           str. F0386]
 gi|328523507|gb|EGF50605.1| 16S rRNA processing protein RimM [Actinomyces sp. oral taxon 170
           str. F0386]
          Length = 180

 Score = 44.7 bits (104), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 36/164 (21%), Positives = 68/164 (41%), Gaps = 6/164 (3%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPID-LNRYVLYSNDNRELRILKMYR---KNKRFIA 62
           L+ +A IG  H L GEV ++   ++P   L        +  ++  L + R      R+ A
Sbjct: 2   LLTLAVIGPAHALKGEVRLEIRTDDPEGRLAPGTAVPTEPTQVGPLTVSRLRFDGSRWFA 61

Query: 63  TFSGIDNIHSASELRDLKLYAKRQD--FKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           TF    +  +A  LR ++L  +  D    D E  E+ ++  +L  +      G+  G+V 
Sbjct: 62  TFEQARDRTAAEALRGVRLLVETDDEAPGDTEETEESWYRHELVGLRALSASGEALGEVT 121

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
            +    A   L +  +      +PF    V  ++ +   + +DP
Sbjct: 122 DLEPGIAQDRLVVTTSGGDEVAVPFVAALVPAIDPEAGTVTLDP 165


>gi|257454504|ref|ZP_05619762.1| 16S rRNA processing protein RimM [Enhydrobacter aerosaccus SK60]
 gi|257448066|gb|EEV23051.1| 16S rRNA processing protein RimM [Enhydrobacter aerosaccus SK60]
          Length = 185

 Score = 44.7 bits (104), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 34/156 (21%), Positives = 82/156 (52%), Gaps = 11/156 (7%)

Query: 17  HGLNGEVYIDSYANNP---IDLNRYVLYSNDNRELRILKMYRKN-KRFIATFSGIDNIHS 72
           +G++G +++ S+  +     D+  +V+ +   ++   +K +R+  K ++   + + + + 
Sbjct: 27  YGIHGWLWVFSFTEDREAIFDMQPWVINTAMGQKTLTVKNWRQQGKGYVVQLNEVPDRNI 86

Query: 73  ASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDR-QGKYWGQVCGVYNFGAGSIL 131
           A  +  + L+A++ +    EL E+E++ +DL  +    + +    G+V  ++  GA +I+
Sbjct: 87  AETMFSVSLWAEKNNLS--ELAENEYYWSDLIGLTVISQSENVILGRVKELFETGAHAIM 144

Query: 132 EIKNTMEKT----FLIPFTKFAVLEVNLQENKILID 163
            ++ T +       LIP+ K  V EVNL E  +++D
Sbjct: 145 VVEPTADSVDGEERLIPWHKQTVGEVNLTEQTLMVD 180


>gi|28210936|ref|NP_781880.1| 16S rRNA-processing protein RimM [Clostridium tetani E88]
 gi|28203375|gb|AAO35817.1| 16S rRNA processing protein rimM [Clostridium tetani E88]
          Length = 170

 Score = 44.7 bits (104), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 84/171 (49%), Gaps = 14/171 (8%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-----VLYSNDNRELRILKMYRKNK 58
           +++ + +  I  THGL GE+ ++   +N   ++R+     V  + + +++   K    N 
Sbjct: 7   MEQFLKIGLIINTHGLKGELKVNPQTDN---IDRFKKLKRVYIAGEEKQVEGCKFL--ND 61

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
           + +    GID I  A++ R+  +  KR+D    EL E  ++  D+   +  D  G Y G+
Sbjct: 62  KVVLKIQGIDGIEIANKYRNKYIEVKRED--AVELPEGRYYVADIIGCKVLDEDGNYLGK 119

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           V  V +     +  ++   +K  LIP  K  V++++++  +I+I P+   L
Sbjct: 120 VKEVIHTKNNDVYWVEG--KKELLIPVLKTIVVKIDIENEEIIIKPVKTWL 168


>gi|148241234|ref|YP_001226391.1| RimM protein, required for 16S rRNA processing [Synechococcus sp.
           RCC307]
 gi|209573626|sp|A5GQ79|RIMM_SYNR3 RecName: Full=Ribosome maturation factor rimM
 gi|147849544|emb|CAK27038.1| RimM protein, required for 16S rRNA processing [Synechococcus sp.
           RCC307]
          Length = 175

 Score = 44.7 bits (104), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 79/169 (46%), Gaps = 12/169 (7%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDL----NRYVLYSNDN-RELRIL--KMYRKN 57
           D+ +++  +    GL GEV I   ++ P       +R++     N +++++L  +     
Sbjct: 3   DEFLVVGQVVAAQGLKGEVRILPASDFPQRFTEPGSRWLRRRGHNEQQVQLLSGRQLPGK 62

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMET-FDRQGKYW 116
           + F+  F GI++  +A  L   +      D    ELE+ EF   DL+ +    D +    
Sbjct: 63  ELFVVRFEGINDRTAAESLVHQEFLVAADDIP--ELEDGEFHVRDLQGLSVRLDTESDPI 120

Query: 117 GQVCGVYNFGAGSILEIKNTME-KTFLIPFTKFAVLEVNLQENKILIDP 164
           G V  +++ G   +LEI+   + +  L+PF    V +V L+E  +LI P
Sbjct: 121 GVVVDLHH-GGNDLLEIELKADGRRCLVPFVDAIVPQVELEEGWLLITP 168


>gi|119899189|ref|YP_934402.1| 16S rRNA processing protein [Azoarcus sp. BH72]
 gi|166226423|sp|A1K9L0|RIMM_AZOSB RecName: Full=Ribosome maturation factor rimM
 gi|119671602|emb|CAL95515.1| conserved hypothetical 16S rRNA processing protein [Azoarcus sp.
           BH72]
          Length = 168

 Score = 44.7 bits (104), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 34/165 (20%), Positives = 74/165 (44%), Gaps = 12/165 (7%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNR----YVLYSNDNRE-----LRILKMYRKN 57
           ++++  I    G+ G + I  + ++P    +    ++    D  E      ++       
Sbjct: 1   MMVLGRIVAPFGVQGWLKIHPFGDDPAAWRKMTHWWLAEDPDGPESAWVQYKLASCRPHG 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
           K  +A   G+ + ++A  +    + A R      E  +DE++  DL  ++  +   +  G
Sbjct: 61  KGLVALLEGVPDRNAAEAIEGRYVGAPRDAMPAPE--KDEYYWGDLVGLDVVNETDETLG 118

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
           +V G+ + GA  +L++++  E   LIPF    VL+V+L   +I +
Sbjct: 119 RVSGLISTGAHDVLQVEDG-ETERLIPFVAAYVLDVDLAARRIRV 162


>gi|59803034|sp|Q895M3|RIMM_CLOTE RecName: Full=Ribosome maturation factor rimM
          Length = 164

 Score = 44.7 bits (104), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 84/171 (49%), Gaps = 14/171 (8%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-----VLYSNDNRELRILKMYRKNK 58
           +++ + +  I  THGL GE+ ++   +N   ++R+     V  + + +++   K    N 
Sbjct: 1   MEQFLKIGLIINTHGLKGELKVNPQTDN---IDRFKKLKRVYIAGEEKQVEGCKFL--ND 55

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
           + +    GID I  A++ R+  +  KR+D    EL E  ++  D+   +  D  G Y G+
Sbjct: 56  KVVLKIQGIDGIEIANKYRNKYIEVKREDA--VELPEGRYYVADIIGCKVLDEDGNYLGK 113

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           V  V +     +  ++   +K  LIP  K  V++++++  +I+I P+   L
Sbjct: 114 VKEVIHTKNNDVYWVEG--KKELLIPVLKTIVVKIDIENEEIIIKPVKTWL 162


>gi|50842920|ref|YP_056147.1| 16S rRNA processing protein RimM [Propionibacterium acnes
           KPA171202]
 gi|289426523|ref|ZP_06428266.1| 16S rRNA processing protein RimM [Propionibacterium acnes SK187]
 gi|289427767|ref|ZP_06429478.1| 16S rRNA processing protein RimM [Propionibacterium acnes J165]
 gi|295130977|ref|YP_003581640.1| 16S rRNA processing protein RimM [Propionibacterium acnes SK137]
 gi|59798678|sp|Q6A7S6|RIMM_PROAC RecName: Full=Ribosome maturation factor rimM
 gi|50840522|gb|AAT83189.1| probable 16S rRNA processing protein RimM [Propionibacterium acnes
           KPA171202]
 gi|289153251|gb|EFD01969.1| 16S rRNA processing protein RimM [Propionibacterium acnes SK187]
 gi|289159031|gb|EFD07224.1| 16S rRNA processing protein RimM [Propionibacterium acnes J165]
 gi|291376028|gb|ADD99882.1| 16S rRNA processing protein RimM [Propionibacterium acnes SK137]
 gi|313773599|gb|EFS39565.1| 16S rRNA processing protein RimM [Propionibacterium acnes HL074PA1]
 gi|313794055|gb|EFS42079.1| 16S rRNA processing protein RimM [Propionibacterium acnes HL110PA1]
 gi|313801442|gb|EFS42693.1| 16S rRNA processing protein RimM [Propionibacterium acnes HL110PA2]
 gi|313807878|gb|EFS46359.1| 16S rRNA processing protein RimM [Propionibacterium acnes HL087PA2]
 gi|313811651|gb|EFS49365.1| 16S rRNA processing protein RimM [Propionibacterium acnes HL083PA1]
 gi|313813540|gb|EFS51254.1| 16S rRNA processing protein RimM [Propionibacterium acnes HL025PA1]
 gi|313819663|gb|EFS57377.1| 16S rRNA processing protein RimM [Propionibacterium acnes HL046PA2]
 gi|313822231|gb|EFS59945.1| 16S rRNA processing protein RimM [Propionibacterium acnes HL036PA1]
 gi|313823536|gb|EFS61250.1| 16S rRNA processing protein RimM [Propionibacterium acnes HL036PA2]
 gi|313825863|gb|EFS63577.1| 16S rRNA processing protein RimM [Propionibacterium acnes HL063PA1]
 gi|313829543|gb|EFS67257.1| 16S rRNA processing protein RimM [Propionibacterium acnes HL063PA2]
 gi|313831392|gb|EFS69106.1| 16S rRNA processing protein RimM [Propionibacterium acnes HL007PA1]
 gi|313835004|gb|EFS72718.1| 16S rRNA processing protein RimM [Propionibacterium acnes HL056PA1]
 gi|313839838|gb|EFS77552.1| 16S rRNA processing protein RimM [Propionibacterium acnes HL086PA1]
 gi|314924625|gb|EFS88456.1| 16S rRNA processing protein RimM [Propionibacterium acnes HL036PA3]
 gi|314962011|gb|EFT06112.1| 16S rRNA processing protein RimM [Propionibacterium acnes HL002PA2]
 gi|314963591|gb|EFT07691.1| 16S rRNA processing protein RimM [Propionibacterium acnes HL082PA1]
 gi|314968577|gb|EFT12675.1| 16S rRNA processing protein RimM [Propionibacterium acnes HL037PA1]
 gi|314974267|gb|EFT18363.1| 16S rRNA processing protein RimM [Propionibacterium acnes HL053PA1]
 gi|314976728|gb|EFT20823.1| 16S rRNA processing protein RimM [Propionibacterium acnes HL045PA1]
 gi|314978894|gb|EFT22988.1| 16S rRNA processing protein RimM [Propionibacterium acnes HL072PA2]
 gi|314984430|gb|EFT28522.1| 16S rRNA processing protein RimM [Propionibacterium acnes HL005PA1]
 gi|314986446|gb|EFT30538.1| 16S rRNA processing protein RimM [Propionibacterium acnes HL005PA2]
 gi|314990806|gb|EFT34897.1| 16S rRNA processing protein RimM [Propionibacterium acnes HL005PA3]
 gi|315079445|gb|EFT51438.1| 16S rRNA processing protein RimM [Propionibacterium acnes HL053PA2]
 gi|315081328|gb|EFT53304.1| 16S rRNA processing protein RimM [Propionibacterium acnes HL078PA1]
 gi|315083529|gb|EFT55505.1| 16S rRNA processing protein RimM [Propionibacterium acnes HL027PA2]
 gi|315087209|gb|EFT59185.1| 16S rRNA processing protein RimM [Propionibacterium acnes HL002PA3]
 gi|315089383|gb|EFT61359.1| 16S rRNA processing protein RimM [Propionibacterium acnes HL072PA1]
 gi|315095407|gb|EFT67383.1| 16S rRNA processing protein RimM [Propionibacterium acnes HL038PA1]
 gi|315106744|gb|EFT78720.1| 16S rRNA processing protein RimM [Propionibacterium acnes HL030PA1]
 gi|315109087|gb|EFT81063.1| 16S rRNA processing protein RimM [Propionibacterium acnes HL030PA2]
 gi|327328332|gb|EGE70094.1| 16S rRNA processing protein RimM [Propionibacterium acnes HL096PA2]
 gi|327334318|gb|EGE76032.1| 16S rRNA processing protein RimM [Propionibacterium acnes HL097PA1]
 gi|327444116|gb|EGE90770.1| 16S rRNA processing protein RimM [Propionibacterium acnes HL043PA2]
 gi|327445005|gb|EGE91659.1| 16S rRNA processing protein RimM [Propionibacterium acnes HL043PA1]
 gi|327446488|gb|EGE93142.1| 16S rRNA processing protein RimM [Propionibacterium acnes HL013PA2]
 gi|327451926|gb|EGE98580.1| 16S rRNA processing protein RimM [Propionibacterium acnes HL092PA1]
 gi|328752244|gb|EGF65860.1| 16S rRNA processing protein RimM [Propionibacterium acnes HL020PA1]
 gi|328760083|gb|EGF73662.1| 16S rRNA processing protein RimM [Propionibacterium acnes HL099PA1]
 gi|332675857|gb|AEE72673.1| ribosome maturation factor RimM [Propionibacterium acnes 266]
          Length = 179

 Score = 44.7 bits (104), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 68/159 (42%), Gaps = 5/159 (3%)

Query: 16  THGLNGEVYIDSYANNP---IDLNRYVLYSNDNRELRILKMYRKNKRFIATFSGIDNIHS 72
            HGL G+V ++   + P     +   V      R+L +++        I  F  + +   
Sbjct: 17  AHGLRGDVVVEVRTDEPDARFGVGATVQIEGSRRDLTVVRSRWAKGCLIVAFDEVKDRQG 76

Query: 73  ASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFGAGSILE 132
           A ELR   L    +   D+  + DEF++  L  +   D  GK  G V  V +  A  +L 
Sbjct: 77  AEELRGSVLVVDVEP-NDDPDDPDEFWDRRLRGLTVVDESGKSRGAVKDVLHMPAQDVLV 135

Query: 133 IKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN 171
           I  + E+  L+PF    V  V++   +I++  I   L++
Sbjct: 136 IDVSGEE-HLVPFVHQLVPTVDVASGRIVVSGIPGLLDS 173


>gi|120610565|ref|YP_970243.1| 16S rRNA-processing protein RimM [Acidovorax citrulli AAC00-1]
 gi|209573540|sp|A1TND1|RIMM_ACIAC RecName: Full=Ribosome maturation factor rimM
 gi|120589029|gb|ABM32469.1| 16S rRNA processing protein RimM [Acidovorax citrulli AAC00-1]
          Length = 191

 Score = 44.7 bits (104), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 71/172 (41%), Gaps = 18/172 (10%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDL---NRYVLYSNDNRE---------LRILKMYR 55
           V +  I    G+ G   +  Y+ +P  L    R+ L  ++            L I +   
Sbjct: 17  VEVGRIADAWGVKGWFKVLPYSADPEALFSSKRWYLQPSEKGAKSFFTGTVLLPIRQARE 76

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
            +   +A   G+D+  +A  LR  +++  R  F      EDE++  DL  +E  +R+G  
Sbjct: 77  HSDSVVAQAQGVDDRDAAEALRGARIFVPRSSFPTAA--EDEYYWVDLIGLEVVNREGVA 134

Query: 116 WGQVCGVYNFGAGSILEI----KNTMEKTFLIPFTKFAVLEVNLQENKILID 163
            G V  +   G  + L +    +   E   +IPF    V  V++   +I++D
Sbjct: 135 LGSVRELLATGPQTTLVLSFPQEGGKEGERMIPFVSAFVDRVDIAGRRIVVD 186


>gi|300741683|ref|ZP_07071704.1| 16S rRNA processing protein RimM [Rothia dentocariosa M567]
 gi|300380868|gb|EFJ77430.1| 16S rRNA processing protein RimM [Rothia dentocariosa M567]
          Length = 212

 Score = 44.7 bits (104), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 68/173 (39%), Gaps = 27/173 (15%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNP---------IDLNRYVLYSN-----DNRELRILKM 53
           VL+A IG  HG+ GEV +  + + P         +DL  +   S          L+++  
Sbjct: 3   VLVARIGKPHGIRGEVTVQLFTDIPEERFAPGEVLDLENFTPKSPVATVAPTGRLKVVGH 62

Query: 54  YRKNKRFIATFSGIDNIHSASELRDLKL-YAKRQDFKDEELEEDEFFNTDL--------- 103
               K  +  F  +   + A ELR  +L +   +D  DE   E E  N  +         
Sbjct: 63  RWNKKILVVRFEEVTTRNQAEELRGSRLMFEVPEDEDDEGFYEQELVNLPVYLLMKVPEG 122

Query: 104 EEMETFDRQGKYWGQVCGVYNFGAGSILEIKNTMEK---TFLIPFTKFAVLEV 153
           E      + GK  G+V G+    A  IL +K   E      +IPF +  V EV
Sbjct: 123 ENPVNNPKAGKPLGKVTGLQTMPAQDILLVKLAAEHGGDEIMIPFVEEIVPEV 175


>gi|282854584|ref|ZP_06263919.1| 16S rRNA processing protein RimM [Propionibacterium acnes J139]
 gi|282582166|gb|EFB87548.1| 16S rRNA processing protein RimM [Propionibacterium acnes J139]
 gi|314923929|gb|EFS87760.1| 16S rRNA processing protein RimM [Propionibacterium acnes HL001PA1]
 gi|314966105|gb|EFT10204.1| 16S rRNA processing protein RimM [Propionibacterium acnes HL082PA2]
 gi|314981878|gb|EFT25971.1| 16S rRNA processing protein RimM [Propionibacterium acnes HL110PA3]
 gi|315090709|gb|EFT62685.1| 16S rRNA processing protein RimM [Propionibacterium acnes HL110PA4]
 gi|315094957|gb|EFT66933.1| 16S rRNA processing protein RimM [Propionibacterium acnes HL060PA1]
 gi|315104276|gb|EFT76252.1| 16S rRNA processing protein RimM [Propionibacterium acnes HL050PA2]
 gi|327328018|gb|EGE69787.1| 16S rRNA processing protein RimM [Propionibacterium acnes HL103PA1]
          Length = 179

 Score = 44.7 bits (104), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 67/159 (42%), Gaps = 5/159 (3%)

Query: 16  THGLNGEVYIDSYANNP---IDLNRYVLYSNDNRELRILKMYRKNKRFIATFSGIDNIHS 72
            HGL G+V ++   + P     +   V      R+L +++        I  F  + +   
Sbjct: 17  AHGLRGDVVVEVRTDEPDARFGVGATVQIEGSRRDLTVVRSRWAKGSLIVAFGEVKDRQG 76

Query: 73  ASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFGAGSILE 132
           A ELR   L    +   D+  + DEF++  L  +   D  GK  G V  V +  A  +L 
Sbjct: 77  AEELRGSVLVVDVEP-NDDPDDPDEFWDRRLRGLTVVDESGKSRGAVKDVLHMPAQDVLV 135

Query: 133 IKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN 171
           I    E+  L+PF    V  V++   +I++  I   L++
Sbjct: 136 IDVGGEE-HLVPFVHQLVPTVDVASGQIIVSGIPGLLDS 173


>gi|167032081|ref|YP_001667312.1| 16S rRNA-processing protein RimM [Pseudomonas putida GB-1]
 gi|189040848|sp|B0KRI2|RIMM_PSEPG RecName: Full=Ribosome maturation factor rimM
 gi|166858569|gb|ABY96976.1| 16S rRNA processing protein RimM [Pseudomonas putida GB-1]
          Length = 178

 Score = 44.7 bits (104), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 34/169 (20%), Positives = 79/169 (46%), Gaps = 10/169 (5%)

Query: 3   KLDKLVLMATIGTTHGLNGEVYIDSYAN---NPIDLNRYVL-YSNDNRELRILKMYRKNK 58
           K D L+++  I + HG+ GEV + S+ +   N +D  R+ L +    +++ ++      K
Sbjct: 7   KADDLIVVGKIFSVHGVRGEVKVYSFTDPIENLLDYPRWTLRHEGKVKQVELVSGRGSQK 66

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
             +    G+++   A  L   ++   R    +  L  DE++   L  ++  ++    +G+
Sbjct: 67  GLVVKLKGLEDRDEARLLSGYEICIARSLLPN--LAADEYYWYQLVGLKVINQDEHLFGK 124

Query: 119 VCGVYNFGAGSILEIKNTM----EKTFLIPFTKFAVLEVNLQENKILID 163
           V  +   GA  ++ +K       ++  L+P+T   VL ++L+   + ++
Sbjct: 125 VDHLLETGANDVMVVKPCAGSLDDRERLLPYTAQCVLAIDLEAGVMRVE 173


>gi|153831521|ref|ZP_01984188.1| 16S rRNA processing protein RimM [Vibrio cholerae 623-39]
 gi|148872997|gb|EDL71132.1| 16S rRNA processing protein RimM [Vibrio cholerae 623-39]
          Length = 148

 Score = 44.7 bits (104), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 66/142 (46%), Gaps = 6/142 (4%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNR----ELRILKMYRK 56
           M K ++ +++  +G+++G+ G + + SY +NP  +  Y  +  D +    E ++    R 
Sbjct: 9   MSKQNEKLVVGKLGSSYGIRGWLKVFSYTDNPESIFDYSPWYIDQKGEWVEYKVEGWKRH 68

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           NK ++    G+D    A  L + ++          EL EDEF+  +L  M+     G   
Sbjct: 69  NKGWVVKLQGLDVREDAHLLTNFEIAIDPASLP--ELSEDEFYWRELFGMQVVTTNGYDL 126

Query: 117 GQVCGVYNFGAGSILEIKNTME 138
           G V  +   G+  +L +K  ++
Sbjct: 127 GVVTDMMETGSHDVLVVKANLK 148


>gi|295396052|ref|ZP_06806236.1| 16S rRNA processing protein RimM [Brevibacterium mcbrellneri ATCC
           49030]
 gi|294971140|gb|EFG47031.1| 16S rRNA processing protein RimM [Brevibacterium mcbrellneri ATCC
           49030]
          Length = 165

 Score = 44.7 bits (104), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 39/168 (23%), Positives = 74/168 (44%), Gaps = 13/168 (7%)

Query: 9   LMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSN-----DNRELRILKMYRKNKRFIAT 63
           ++A +G  HG+ GE+ ++   ++P +  R+   +      D   L + +      R + T
Sbjct: 4   VVARLGKPHGIRGEMTVEVRTDDPDE--RFTPGATFGTDPDIGTLTLTRARWHRDRLMLT 61

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F  + + + A E+R+  +     +  DE    D ++  DL   E     G   G V  V 
Sbjct: 62  FDEVPDRNRAEEIRNTLITVDVSETDDE----DAWYIDDLVGAEVV-HSGSVIGTVSAVT 116

Query: 124 NFGAGSILEIK-NTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
              A  ++ ++     +  +IPF +  V  V+L  N++ IDP A  L+
Sbjct: 117 PGAAQDLIHVELADSGREVMIPFVEEIVPVVDLDNNRVEIDPPAGLLD 164


>gi|302754616|ref|XP_002960732.1| hypothetical protein SELMODRAFT_451035 [Selaginella moellendorffii]
 gi|300171671|gb|EFJ38271.1| hypothetical protein SELMODRAFT_451035 [Selaginella moellendorffii]
          Length = 604

 Score = 44.7 bits (104), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 55/112 (49%), Gaps = 9/112 (8%)

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQG-KYWGQ 118
           ++ T   +D++  AS+     +  KR +     LEE EF+  DL  M+ F +   +  G 
Sbjct: 57  WLLTLKNVDSVEKASKYIGATMLVKRDE--RPALEEGEFYIPDLIGMDVFVQSSMENIGT 114

Query: 119 VCGVYNFGAGSILEIKNTMEKT------FLIPFTKFAVLEVNLQENKILIDP 164
           +  + NFGA  +L ++     +        IPF +  V  V++++ ++++DP
Sbjct: 115 IADMCNFGASDLLRVQRNPASSVGEGPLIWIPFVEAIVPVVDMEQRRVIVDP 166


>gi|156741645|ref|YP_001431774.1| 16S rRNA processing protein RimM [Roseiflexus castenholzii DSM
           13941]
 gi|209573591|sp|A7NJT6|RIMM_ROSCS RecName: Full=Ribosome maturation factor rimM
 gi|156232973|gb|ABU57756.1| 16S rRNA processing protein RimM [Roseiflexus castenholzii DSM
           13941]
          Length = 178

 Score = 44.7 bits (104), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 37/162 (22%), Positives = 71/162 (43%), Gaps = 6/162 (3%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYV--LYSNDNRELRILKMYRKNKR--F 60
           D+++L+ T+    GL+GE+ + S  +    L  +V  ++  + R    L+  R+ K    
Sbjct: 8   DEVLLIGTVVDAFGLHGEIKVRSVTDRVDHLRHHVQTVFVGEERRPFPLQRIREPKTGVL 67

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           I T  G+ +   A  LR  ++  +  D     LE DE+F   L  +   +  G   G V 
Sbjct: 68  ILTLGGVTDRTMAEALRGAEVTIRECDAA--PLEADEYFIHQLYGLRVVESSGAEIGIVR 125

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
            V   GA  ++ ++       L+P     V  +++   +I++
Sbjct: 126 EVLQTGANDVIVVERHGRSDTLLPMIHDVVESLDVAAGQIVV 167


>gi|55981002|ref|YP_144299.1| 16S rRNA-processing protein RimM [Thermus thermophilus HB8]
 gi|67461327|sp|Q5SJH5|RIMM_THET8 RecName: Full=Ribosome maturation factor rimM
 gi|145579204|pdb|2DYI|A Chain A, Crystal Structure Of 16s Ribosomal Rna Processing Protein
           Rimm From Thermus Thermophilus Hb8
 gi|294979412|pdb|3A1P|A Chain A, Structure Of Ribosome Maturation Protein Rimm And
           Ribosomal Protein S19
 gi|294979414|pdb|3A1P|C Chain C, Structure Of Ribosome Maturation Protein Rimm And
           Ribosomal Protein S19
 gi|55772415|dbj|BAD70856.1| 16S rRNA processing protein RimM [Thermus thermophilus HB8]
          Length = 162

 Score = 44.3 bits (103), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 38/167 (22%), Positives = 72/167 (43%), Gaps = 14/167 (8%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIATFS 65
           +LV +   G  + L G +    +   P+ L+   +Y   +    I  +YR  +  +   +
Sbjct: 2   RLVEIGRFGAPYALKGGL---RFRGEPVVLHLERVYVEGHGWRAIEDLYRVGEELVVHLA 58

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNF 125
           G+ +   A  L  L++YA+  D     LEE  ++   L  +  +  +G+  G+V  + + 
Sbjct: 59  GVTDRTLAEALVGLRVYAEVADLPP--LEEGRYYYFALIGLPVYV-EGRQVGEVVDILDA 115

Query: 126 GAGSILEIKNTMEKT-----FLIPFTKFAVLEVNLQENKILIDPIAA 167
           GA  +L I+   E+       L+P        V ++E  I +DPI  
Sbjct: 116 GAQDVLIIRGVGERLRDRAERLVPLQAPY---VRVEEGSIHVDPIPG 159


>gi|298253303|ref|ZP_06977095.1| 16S rRNA-processing protein rimM [Gardnerella vaginalis 5-1]
 gi|297532698|gb|EFH71584.1| 16S rRNA-processing protein rimM [Gardnerella vaginalis 5-1]
          Length = 197

 Score = 44.3 bits (103), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 75/173 (43%), Gaps = 17/173 (9%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNP---IDLNRYVLYSNDNRELRILKMYRKNKRFIAT 63
           L+ +  IG   GL GEV +  + + P    +    +  ++  RE  I        R+I  
Sbjct: 18  LLRVCRIGKAQGLKGEVTVQIFTDEPYERFEPGNVLCTADGEREFVIENARTFKNRWILL 77

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMET-------FDRQGKYW 116
           F    N + A  L   +LY   +D + E   E+ ++  DL  ++             K  
Sbjct: 78  FEESQNRNDAEALNGTELYVHAEDAQ-ELAAENAWYIKDLVGLQARLCEENQLGLTPKII 136

Query: 117 GQVCGVYNFGAGSILEIK-----NTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           G+V  V + GA S+L+I+     +   KT L+PF +  V EV++    + I+P
Sbjct: 137 GKVVDVLD-GAQSLLKIRLDHPVDEEHKTALVPFVEAIVPEVDVANGYLTINP 188


>gi|296111838|ref|YP_003622220.1| 16S rRNA processing protein [Leuconostoc kimchii IMSNU 11154]
 gi|295833370|gb|ADG41251.1| 16S rRNA processing protein [Leuconostoc kimchii IMSNU 11154]
          Length = 173

 Score = 44.3 bits (103), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 39/168 (23%), Positives = 76/168 (45%), Gaps = 11/168 (6%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKR-----FIATF 64
           + TI  THG+ GEV I +  +   D  +       + +   L M  ++ R     ++  F
Sbjct: 10  VGTIVNTHGIRGEVKIMAITDFAADRFKKGAELQIDTKQGFLPMKVQSSRLHKNMWLVLF 69

Query: 65  SGIDNIHSASELR--DLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            GI NI+   + +  D+ +Y + +    +EL++DE++  ++ +    D  G   G V  +
Sbjct: 70  EGITNINDIEKYKTHDIYVYGEAR----QELDDDEYYYDEIIDSRVVDLDGHEIGVVSDI 125

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
               A  +  +K   +   LIP     V  V+++++ I ID +   L+
Sbjct: 126 MTTPANDVWTVKREGQPDALIPMIDDVVKNVDVEQHLITIDALEGLLD 173


>gi|326318072|ref|YP_004235744.1| 16S rRNA processing protein RimM [Acidovorax avenae subsp. avenae
           ATCC 19860]
 gi|323374908|gb|ADX47177.1| 16S rRNA processing protein RimM [Acidovorax avenae subsp. avenae
           ATCC 19860]
          Length = 191

 Score = 44.3 bits (103), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 72/172 (41%), Gaps = 18/172 (10%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDL---NRYVLYSNDNRE---------LRILKMYR 55
           V +  I    G+ G   +  Y+ +P  L    R+ L  ++            L I +   
Sbjct: 17  VEVGRIADAWGVKGWFKVLPYSADPEALFSSKRWYLQPSEKGAKSFFTGTVLLPIRQARE 76

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
            +   +A   G+D+  +A  LR  +++  R  F      EDE++  DL  +E  +R+G  
Sbjct: 77  HSDSVVAQAQGVDDRDAAEALRGARIFVPRSSFPTAA--EDEYYWVDLIGLEVVNREGVA 134

Query: 116 WGQVCGVYNFGAGSILEI----KNTMEKTFLIPFTKFAVLEVNLQENKILID 163
            G V  +   G  + L +    +   E   +IPF    V +V++   +I++D
Sbjct: 135 LGTVRELLATGPQTTLVLSFPQEGGKEGERMIPFVSAFVDKVDVAGRRIVVD 186


>gi|294631646|ref|ZP_06710206.1| 16S rRNA processing protein RimM [Streptomyces sp. e14]
 gi|292834979|gb|EFF93328.1| 16S rRNA processing protein RimM [Streptomyces sp. e14]
          Length = 202

 Score = 44.3 bits (103), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 36/161 (22%), Positives = 76/161 (47%), Gaps = 5/161 (3%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNP-IDLNRYVLYSND---NRELRILKMYRKNKRFIAT 63
           +++A IG  HG+ GEV ++   + P + L    + + D      L I      + R +  
Sbjct: 1   MVVARIGRAHGIKGEVTVEVRTDEPELRLAPGAVLATDPASTGPLTIETGRVHSGRLLLR 60

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F G+ +  +A  LR+  L A+    +  E E+ E+++  L +++     G   G++  + 
Sbjct: 61  FEGVGDRTAAEALRNTLLIAEVDPEELPEDED-EYYDHQLIDLDVVTEDGTEVGRITEIS 119

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           +  +  +  ++       +IPF +  V E++L+E + +I P
Sbjct: 120 HLPSQDLFIVERPDGSEVMIPFVQEIVTEIDLEEQRAVITP 160


>gi|183981814|ref|YP_001850105.1| 16S rRNA processing protein RimM [Mycobacterium marinum M]
 gi|238689244|sp|B2HJL4|RIMM_MYCMM RecName: Full=Ribosome maturation factor rimM
 gi|183175140|gb|ACC40250.1| 16S rRNA processing protein RimM [Mycobacterium marinum M]
          Length = 174

 Score = 44.3 bits (103), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 38/160 (23%), Positives = 68/160 (42%), Gaps = 16/160 (10%)

Query: 16  THGLNGEVYIDSYANNPIDLNRYVLYSNDNRELR----------ILKMYRKN-KRFIATF 64
            HG+ GEV ++   + P   +R        R  R          +++  R++  R +   
Sbjct: 11  AHGITGEVVVEIRTDEP---DRRFTPGASLRAKRSRDGGTGRNYVIEGVREHGARLLVRL 67

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
           +G+++  +A  LR         D    + E D +++  LE +      G+  G V  V +
Sbjct: 68  AGVNDRDTADGLRGSLFVIDSADLPPID-EPDTYYDHQLEGLRVRTTAGQDVGVVAEVLH 126

Query: 125 FGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
            GAG +L +K    +  L+PF    V  V+L +  + IDP
Sbjct: 127 TGAGELLAVKCDSGE-VLVPFVGAIVTSVSLDDRILEIDP 165


>gi|227872396|ref|ZP_03990743.1| possible 16S rRNA processing protein [Oribacterium sinus F0268]
 gi|227841756|gb|EEJ52039.1| possible 16S rRNA processing protein [Oribacterium sinus F0268]
          Length = 174

 Score = 44.3 bits (103), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 69/164 (42%), Gaps = 16/164 (9%)

Query: 10  MATIGTTHGLNGEVYIDSYANNP---IDLNRYVLYSNDN-------RELRILKMYRKNKR 59
           + TI   HGL GE+ +      P     L   +L             E R +K  R    
Sbjct: 7   VGTILKPHGLKGEMKVFPTTEEPRRFTQLKELILRRESKGLRDTSFSESRKIKSVRFQGE 66

Query: 60  FIA-TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
           F+     GID++  A + R++ L   R+      L ++EFF  D   ME +    +  G+
Sbjct: 67  FLLLQLEGIDSVEMAEKYRNVSLMIPREQALP--LGDNEFFLGDYIGMEVYIEGKELLGE 124

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
           V  V   GA  +  ++   EK +LIP     V E+  +EN+I I
Sbjct: 125 VKEVIETGANLVFSVEGK-EKEYLIPHIPPVVYEI--KENRIAI 165


>gi|157151375|ref|YP_001450597.1| 16S rRNA-processing protein RimM [Streptococcus gordonii str.
           Challis substr. CH1]
 gi|189040858|sp|A8AXT7|RIMM_STRGC RecName: Full=Ribosome maturation factor rimM
 gi|157076169|gb|ABV10852.1| 16S rRNA processing protein RimM [Streptococcus gordonii str.
           Challis substr. CH1]
          Length = 172

 Score = 44.3 bits (103), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 39/169 (23%), Positives = 83/169 (49%), Gaps = 11/169 (6%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDL----NRYVLYSNDNRELRILKM--YRKNKRF-IA 62
           +  I  T GL GE+ + S  +   +     N   L+   ++ +  +++  +RK K F I 
Sbjct: 6   VGKIVNTQGLQGEMRVLSVTDFAEERFKKGNTLALFDKKDQFVMDVEIASHRKVKNFDII 65

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F G+ +I++  + RD  L    +D  D  LEE EF+  ++  +E ++      G +  +
Sbjct: 66  KFKGMYHINAIEKFRDFSLKVAEEDLSD--LEEGEFYYHEIIGLEVYEND-VLLGTIKEI 122

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN 171
              GA  +  +K   ++  L+P+    VL +++++ ++ ++ I  GL++
Sbjct: 123 LQPGANDVWVVKRKGKRDLLLPYIPPVVLGIDIEQGRVDVE-IPEGLDD 170


>gi|91784786|ref|YP_559992.1| 16S rRNA-processing protein [Burkholderia xenovorans LB400]
 gi|123062644|sp|Q13VE9|RIMM_BURXL RecName: Full=Ribosome maturation factor rimM
 gi|91688740|gb|ABE31940.1| 16S rRNA processing protein RimM [Burkholderia xenovorans LB400]
          Length = 244

 Score = 44.3 bits (103), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 71/171 (41%), Gaps = 17/171 (9%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNP------IDLNRYVLYSNDNRE-LRILKMYRKNKRF 60
           V +  I   +GL G V + ++A+        +   R+ L     R+    L+    +   
Sbjct: 71  VEVGAIVDAYGLKGWVKVAAHADAGHGGDALLSAKRWWLLKGQERKSAPSLQAKTHSDSV 130

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +A   G+ +   A  LR  ++Y  R +F    L  DEF+  DL  ++  +  G   G+V 
Sbjct: 131 VAHLGGVTDRDVALALRGSRVYISRSEFP--ALGADEFYWVDLLGLDVVNVAGVSLGKVA 188

Query: 121 GVYNFGAGSILEIK--------NTMEKTFLIPFTKFAVLEVNLQENKILID 163
            + + GA S+L I+          +    LIPF    V  V+    +I +D
Sbjct: 189 DMIDNGAHSVLRIEYPATDKSGKPVTGERLIPFVGVFVKTVDQAAKQITVD 239


>gi|319760316|ref|YP_004124254.1| ribosome maturation factor rimM [Candidatus Blochmannia vafer str.
           BVAF]
 gi|318039030|gb|ADV33580.1| ribosome maturation factor rimM [Candidatus Blochmannia vafer str.
           BVAF]
          Length = 189

 Score = 44.3 bits (103), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 76/166 (45%), Gaps = 11/166 (6%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYV---LYSNDNRELRILKMYRK-NKRFIAT 63
           V++  IG  +G+ G + I S+ +   D+ +Y    +      +L IL+ +R  NK +IA 
Sbjct: 14  VIIGKIGGAYGVQGWLKIISFTDKIEDIFKYCPWFILLRSQWKLMILENWRVINKHYIAK 73

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
            S I +   A  L    L    +     + +E E++  D+   E  +  G Y G V  + 
Sbjct: 74  ISDISSREIAMSLAQCNLIIDSKSLPILK-KEGEYYWKDIIGCEVINIDGDYLGYVINII 132

Query: 124 NFGAGSILEIK-----NTMEKTFLIPFTKFAVLE-VNLQENKILID 163
              A  +L IK     +   K+ LIPF +  +++ V++    I++D
Sbjct: 133 ETQAHDVLVIKLNSHDDVKIKSCLIPFVQKKIIKYVSIINRTIIVD 178


>gi|283782824|ref|YP_003373578.1| 16S rRNA processing protein RimM [Gardnerella vaginalis 409-05]
 gi|283441158|gb|ADB13624.1| 16S rRNA processing protein RimM [Gardnerella vaginalis 409-05]
          Length = 199

 Score = 44.3 bits (103), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 76/173 (43%), Gaps = 17/173 (9%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNP---IDLNRYVLYSNDNRELRILKMYRKNKRFIAT 63
           L+ +  IG   GL GEV +  + + P    +    +  ++  RE  I        R+I  
Sbjct: 20  LLRVCRIGKAQGLKGEVTVQIFTDEPYERFEPGNVLCTADGEREFVIENARTFKNRWILL 79

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMET-------FDRQGKYW 116
           F    N + A  L   +LY   +D + E   E+ ++  DL  ++                
Sbjct: 80  FEESQNRNDAEALNGTELYVHAEDAQ-ELAAENAWYIKDLVGLQARLCEENQLGLPACTI 138

Query: 117 GQVCGVYNFGAGSILEIK--NTME---KTFLIPFTKFAVLEVNLQENKILIDP 164
           G+V  V + GA S+L+I+  N ++   KT L+PF +  V EV++    + IDP
Sbjct: 139 GKVVDVLD-GAQSLLKIRLNNPIDDDNKTALVPFVEALVPEVDVANGYLTIDP 190


>gi|222152905|ref|YP_002562082.1| 16S rRNA-processing protein RimM [Streptococcus uberis 0140J]
 gi|254797765|sp|B9DRW5|RIMM_STRU0 RecName: Full=Ribosome maturation factor rimM
 gi|222113718|emb|CAR41678.1| 16S rRNA processing protein [Streptococcus uberis 0140J]
          Length = 172

 Score = 44.3 bits (103), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 60/119 (50%), Gaps = 5/119 (4%)

Query: 54  YRKNKRF-IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQ 112
           +R+ K F I  F G+++I+   + +   L   +Q   D  L+E EF+   +  +E ++  
Sbjct: 56  HRRQKNFDIIKFKGMNHINDIEKFKGFTLKVSQQHLSD--LDEGEFYYHQIIGLEVYEND 113

Query: 113 GKYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN 171
             Y G +  +   GA  +  +K   +K  L+PF    VL V+++ N++ +  I  GL++
Sbjct: 114 -VYIGTIKEILQPGANDVWVVKRQGKKDLLLPFIPPVVLNVDVEANRVDV-AIMEGLDD 170


>gi|38234108|ref|NP_939875.1| 16S rRNA-processing protein [Corynebacterium diphtheriae NCTC
           13129]
 gi|59798748|sp|Q6NGI4|RIMM_CORDI RecName: Full=Ribosome maturation factor rimM
 gi|38200370|emb|CAE50057.1| Putative 16s rRNA processing protein [Corynebacterium diphtheriae]
          Length = 166

 Score = 44.3 bits (103), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 42/162 (25%), Positives = 69/162 (42%), Gaps = 10/162 (6%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNP-IDLNRYVLY----SNDNRELRILKMYRKNKRFIA 62
           +++  +  +HG+ GEV I+     P I   +  +           L I  +     R + 
Sbjct: 3   LMIGRVVKSHGIRGEVAIEVTTEEPEIRFAQGEVLNGRQGGKEHSLTIASVRPHQNRLLV 62

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F  I +  +A  LR  + +A   D   +    D F++ +LE +     + K  G+V GV
Sbjct: 63  KFKEIADRTAADSLRGTRFFAAPLDDDVD----DGFYDHELEGLAVIHGEEKI-GEVSGV 117

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
            +  A S+LE+     K  LIPF    V EV+L     +I P
Sbjct: 118 IHGPAQSLLEVTLESGKEVLIPFVHDIVPEVDLDAGTCVITP 159


>gi|33864216|ref|NP_895776.1| 16S rRNA-processing protein RimM [Prochlorococcus marinus str. MIT
           9313]
 gi|33635800|emb|CAE22125.1| possible 16S rRNA processing protein RimM [Prochlorococcus marinus
           str. MIT 9313]
          Length = 181

 Score = 44.3 bits (103), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 73/164 (44%), Gaps = 14/164 (8%)

Query: 12  TIG---TTHGLNGEVYIDSYANNP----IDLNRYVLYSN-DNRELRILKMYRKNKR--FI 61
           T+G      G+ GE+ I+  ++ P    +   R++   N + R + +L   +   R  ++
Sbjct: 14  TVGKVVAAQGMQGELRINPSSDFPERFTLPGQRWLKERNGEPRPIELLTGRQLPGRSLYV 73

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMET-FDRQGKYWGQVC 120
             F+G++N ++A  L   KL     D     L E EF   DL  +E     +G   G V 
Sbjct: 74  VKFAGVNNRNAAEALVGQKLLVPSSDRPS--LAEGEFHLLDLVGLEARLQAEGPAIGHVI 131

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
            +   G   +LEI+    +  L+PF +  V EV L +  + + P
Sbjct: 132 DLTTAG-NDLLEIELLTGRRVLVPFVEAIVPEVQLNQGWLRLTP 174


>gi|297571154|ref|YP_003696928.1| 16S rRNA processing protein RimM [Arcanobacterium haemolyticum DSM
           20595]
 gi|296931501|gb|ADH92309.1| 16S rRNA processing protein RimM [Arcanobacterium haemolyticum DSM
           20595]
          Length = 177

 Score = 44.3 bits (103), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 75/162 (46%), Gaps = 9/162 (5%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNP-IDLNRYVLYSNDNRELRILKMYR----KNKRFI 61
           L+ +A +G  HGL GEV ++   ++P   L    +Y     EL  + +      K   F+
Sbjct: 2   LLTVAIVGAPHGLKGEVKLNVRTDSPERRLVVGAMYETQPAELGPVTLASVRNYKGSTFV 61

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
            TF+   +   A  LR +KL  +  +     +EED +F  +L  +E  D  G   G+V G
Sbjct: 62  -TFAEYADRTGAEALRGVKLVIETDEDD---VEEDAWFAHELIGLEALDPDGYELGEVAG 117

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
           +    A   L ++        +PF K  V EV++ ++ ++ID
Sbjct: 118 LEPGPAHDYLIVREPDGIMTRVPFVKAIVTEVDVDDHCVVID 159


>gi|167767998|ref|ZP_02440051.1| hypothetical protein CLOSS21_02541 [Clostridium sp. SS2/1]
 gi|317498407|ref|ZP_07956702.1| 16S rRNA processing protein RimM [Lachnospiraceae bacterium
           5_1_63FAA]
 gi|167710327|gb|EDS20906.1| hypothetical protein CLOSS21_02541 [Clostridium sp. SS2/1]
 gi|291561000|emb|CBL39800.1| 16S rRNA processing protein RimM [butyrate-producing bacterium
           SSC/2]
 gi|316894301|gb|EFV16488.1| 16S rRNA processing protein RimM [Lachnospiraceae bacterium
           5_1_63FAA]
          Length = 171

 Score = 44.3 bits (103), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 79/168 (47%), Gaps = 15/168 (8%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYV----LYSNDNRELRILKM----YR 55
           +++ + +  I  THG+ GEV +    +   D+ R+     +Y +  +E ++L +    + 
Sbjct: 1   MEEFLQVGAIANTHGIAGEVKVFPMTD---DIKRFKKLKEVYLDTGKERKLLHVVSCKFV 57

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETF-DRQGK 114
           KN+  +  F    NI+     +   L+  R   +   LE+DE+F  DL  +    +  G+
Sbjct: 58  KNQP-VLRFKEFSNINEVEMYKRKGLFVTRD--QAVPLEKDEYFIADLIGLSVIREDNGE 114

Query: 115 YWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
             G++  V   GA  + E+K    K  L+P  +  +  V+LQ+ +I +
Sbjct: 115 VLGELTDVLQTGANDVYEVKMEDGKEVLLPAIRECIKNVDLQKGEITV 162


>gi|46198979|ref|YP_004646.1| 16S rRNA processing protein rimM [Thermus thermophilus HB27]
 gi|59798768|sp|Q72JU7|RIMM_THET2 RecName: Full=Ribosome maturation factor rimM
 gi|46196603|gb|AAS81019.1| 16S rRNA processing protein rimM [Thermus thermophilus HB27]
          Length = 162

 Score = 44.3 bits (103), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 38/167 (22%), Positives = 72/167 (43%), Gaps = 14/167 (8%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIATFS 65
           +LV +   G  + L G +    +   P+ L+   +Y   +    I  +YR  +  +   +
Sbjct: 2   RLVEIGRFGAPYALKGGL---RFRGEPVVLHLERVYVEGHGWRAIEDLYRVGEELVVHLA 58

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNF 125
           G+ +   A  L  L++YA+  D     LEE  ++   L  +  +  +G+  G+V  + + 
Sbjct: 59  GVTDRTLAEALVGLRVYAEVADLPP--LEEGRYYYFALIGLPVYV-EGRQVGEVVDILDA 115

Query: 126 GAGSILEIKNTMEKT-----FLIPFTKFAVLEVNLQENKILIDPIAA 167
           GA  +L I+   E+       L+P        V ++E  I +DPI  
Sbjct: 116 GAQDVLIIRGVGERLRDRAERLVPLQAPY---VRVEEGGIHVDPIPG 159


>gi|315221647|ref|ZP_07863566.1| 16S rRNA processing protein RimM [Streptococcus anginosus F0211]
 gi|315189298|gb|EFU22994.1| 16S rRNA processing protein RimM [Streptococcus anginosus F0211]
          Length = 179

 Score = 44.3 bits (103), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 41/169 (24%), Positives = 82/169 (48%), Gaps = 11/169 (6%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNR--YVLYSNDNRELRILKM----YRKNKRF-IA 62
           +  I  T GL GE+ + S  +   +  +   +L   D +E  ++ +    +RK K F I 
Sbjct: 13  VGKIVNTQGLQGEMRVLSVTDFAEERFKKGSILALFDKKEHFVMNVEIASHRKMKNFDII 72

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F G+ +I+   + RD  L    +D  D  L+E EF+  ++  +  ++ Q    G +  +
Sbjct: 73  KFKGMYHINDIEKYRDFTLKVAEEDLSD--LDEGEFYYHEIIGLNVYE-QDILIGTIKEI 129

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN 171
              GA  +  +K   ++  L+P+    VL ++L+ N++ ++ I  GL++
Sbjct: 130 LQPGANDVWVVKRKGKRDLLLPYIPPVVLNIDLENNRVDVE-IPEGLDD 177


>gi|332670017|ref|YP_004453025.1| 16S rRNA processing protein RimM [Cellulomonas fimi ATCC 484]
 gi|332339055|gb|AEE45638.1| 16S rRNA processing protein RimM [Cellulomonas fimi ATCC 484]
          Length = 184

 Score = 43.9 bits (102), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 36/159 (22%), Positives = 75/159 (47%), Gaps = 6/159 (3%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPID--LNRYVLYSND--NRELRILKMYRKNKRFIATFS 65
           +A IG  HGL GEV +D   + P +      VL +    +  L +++   +  R+  TF+
Sbjct: 5   VARIGRAHGLRGEVALDLRTDAPQERLAVGAVLQTEPAGSGPLTVMRTRVQQGRWYVTFA 64

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNF 125
              +  +A  L    L  +    +D + ++D ++  +L  +      G+  G+V G+ + 
Sbjct: 65  EASDRTAAEALTGTTLVVE--VDEDADADDDAWYPHELAGLRAEHVDGRVLGEVVGLEHA 122

Query: 126 GAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
            A  +L ++       L+PF +  V  V+++  ++++DP
Sbjct: 123 PAHDVLVVREPDGTRTLVPFVRAIVPTVDVRGGRVVLDP 161


>gi|332967675|gb|EGK06786.1| 16S rRNA processing protein RimM [Kingella kingae ATCC 23330]
          Length = 169

 Score = 43.9 bits (102), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 73/160 (45%), Gaps = 7/160 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDS---YANNPIDLNRYVLYSNDNRELRILKMYR-KNKRFIAT 63
           V M  I    G+ G V + +   YA++ +D   + L    + ++  ++  +         
Sbjct: 8   VGMGYIKGAFGVKGWVKVQASTEYADSLLDYPTWRLVKGKDVQIAEVEFGKVAGDELQVK 67

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F+ I++  +A+ +R   +   R +F   E EEDEF+  DL  M+  +R+    G+V  + 
Sbjct: 68  FTHINDRDAAALMRGYTIEVSRDEFA--ETEEDEFYWADLVGMQVVNRENIALGEVAKLM 125

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
             GA  +L +     +  LIPF    V +VN +   I +D
Sbjct: 126 ETGAHDVLIVCGEHGEK-LIPFVSHFVDDVNKETRVITVD 164


>gi|218665436|ref|YP_002427224.1| 16S rRNA processing protein RimM [Acidithiobacillus ferrooxidans
           ATCC 23270]
 gi|218517649|gb|ACK78235.1| 16S rRNA processing protein RimM [Acidithiobacillus ferrooxidans
           ATCC 23270]
          Length = 171

 Score = 43.9 bits (102), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 35/160 (21%), Positives = 71/160 (44%), Gaps = 4/160 (2%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYV-LYSNDNRELRILKMYR-KNKRFIAT 63
           + V++  +   +G+ G V + S+  +   +  Y   Y   +R   +L+  R + +  +A 
Sbjct: 9   EWVVLGRVSGIYGVRGMVKVFSFTESRDSILDYSPWYLGPDRRPWVLEDGRMQGEGVVAK 68

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
            + +++   A  L   ++   R D    EL   EF+ + L  +   +R+G   G V    
Sbjct: 69  LAQVEDREQARALIGQEIAVIRADLP--ELGAGEFYWSTLTGLRVLNREGIVLGTVSAFL 126

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
             GA  ++ I +      LIP++  A   V+L   +I++D
Sbjct: 127 ETGANDVMVIDDGKGGELLIPWSAEASAGVDLPAGQIVVD 166


>gi|319938980|ref|ZP_08013344.1| ribosome maturation factor rimM [Streptococcus anginosus 1_2_62CV]
 gi|319812030|gb|EFW08296.1| ribosome maturation factor rimM [Streptococcus anginosus 1_2_62CV]
          Length = 172

 Score = 43.9 bits (102), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 61/119 (51%), Gaps = 5/119 (4%)

Query: 54  YRKNKRF-IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQ 112
           +RK K F I  F G+ +I+   + RD  L    +D  D  L+E EF+  ++  M  ++ Q
Sbjct: 56  HRKMKNFDIVKFKGMYHINDIEKYRDFTLKVAEEDLSD--LDEGEFYYHEIIGMNVYE-Q 112

Query: 113 GKYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN 171
               G +  +   GA  +  +K   ++  L+P+    VL ++L+ +++ ++ I  GL++
Sbjct: 113 DVLIGAIKEILQPGANDVWVVKRKGKRDLLLPYIPPVVLNIDLENSRVDVE-IPEGLDD 170


>gi|225868438|ref|YP_002744386.1| 16S rRNA processing protein [Streptococcus equi subsp.
           zooepidemicus]
 gi|259585652|sp|C0MEI2|RIMM_STRS7 RecName: Full=Ribosome maturation factor rimM
 gi|225701714|emb|CAW99063.1| 16S rRNA processing protein [Streptococcus equi subsp.
           zooepidemicus]
          Length = 172

 Score = 43.9 bits (102), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 88/170 (51%), Gaps = 13/170 (7%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDL----NRYVLYSNDNRELRILKM--YRKNKRF-IA 62
           +  I  T GL GE+ + S ++   +      R  L+ + +R ++ +++  +RK+K+F I 
Sbjct: 6   VGKIVNTQGLQGEMRVLSVSDFTEERFQKGARLALFDDKDRFVQEVEIASHRKHKQFDII 65

Query: 63  TFSGIDNIHSASELRDLKL-YAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
            F G+ +I++  + +   L  AK    K   L E EF+   +  +E +++  +  GQ+  
Sbjct: 66  KFKGMYHINAIEQFKGCSLKIAKEHQGK---LAEGEFYYHQIIGLEVYEKD-QLVGQIKE 121

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN 171
           +   GA  +  +K   ++  L+P+    VL V++++ ++ ++ I  GL++
Sbjct: 122 ILQPGANDVWVVKRQSKRDLLLPYIPSVVLGVDIEKGRVDVE-IMEGLDD 170


>gi|291533107|emb|CBL06220.1| 16S rRNA processing protein RimM [Megamonas hypermegale ART12/1]
          Length = 173

 Score = 43.9 bits (102), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 29/153 (18%), Positives = 67/153 (43%), Gaps = 2/153 (1%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIATF 64
           +K +++  IG  HG+ G++ +    + P   N       D++E+ I+    +    +   
Sbjct: 10  NKKIIIGKIGAAHGVRGDMKVYPLTDFPDRFNTIKKAYVDDKEINIISTRYQGNFVVMKV 69

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
            G+++    +   +  L   R D     LE+ E++  D+  ++  ++     G++  +  
Sbjct: 70  EGVNSREEVARFTNKLLKINRSDV--PPLEDGEYYAFDIIGLQVINQDDVVLGKITEILK 127

Query: 125 FGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQE 157
            G+  +   K    +  LIP  K  V E+N+++
Sbjct: 128 TGSNDVYITKAKDGRQILIPALKKVVTEINVED 160


>gi|90407076|ref|ZP_01215265.1| 16S rRNA-processing protein [Psychromonas sp. CNPT3]
 gi|90311798|gb|EAS39894.1| 16S rRNA-processing protein [Psychromonas sp. CNPT3]
          Length = 175

 Score = 43.9 bits (102), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 39/166 (23%), Positives = 72/166 (43%), Gaps = 13/166 (7%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNRELRILKMYRKNKRFIAT 63
           +++   G  HG+ G + I SY ++   + +Y    + Y+   +E+ I      +  F+A 
Sbjct: 8   IVIGKFGAVHGIKGWLKIHSYTDDAESIFQYKPLLMKYNGVMQEVNITDWKAHSGTFVAK 67

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
               D    +  L  ++L     +  D    ED+F+  DL   +    +G + G V  + 
Sbjct: 68  IKSFDVREESQALVGVELLVNINELPD---LEDDFYWRDLIGCQVETDKGYHLGAVTDMM 124

Query: 124 NFGAGSILEIKNTMEKTF-----LIPFTK-FAVLEVNLQENKILID 163
             G+  +L +K      F     LIPF K   VL+VN+    I+++
Sbjct: 125 ETGSKDVLVVKANANDAFGQKQRLIPFIKEQVVLDVNITGKLIIVN 170


>gi|297202648|ref|ZP_06920045.1| 16S rRNA processing protein RimM [Streptomyces sviceus ATCC 29083]
 gi|197713223|gb|EDY57257.1| 16S rRNA processing protein RimM [Streptomyces sviceus ATCC 29083]
          Length = 183

 Score = 43.9 bits (102), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 37/161 (22%), Positives = 75/161 (46%), Gaps = 5/161 (3%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNP-IDLNRYVLYSND---NRELRILKMYRKNKRFIAT 63
           +++A IG  HG+ GEV ++   + P + L    + + D      L I      + R +  
Sbjct: 3   LVVARIGRAHGIKGEVTVEVRTDEPELRLAPGAVLATDPAATGPLTIETGRVHSGRLLLR 62

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F G+ +  +A  LR+  L A+    +  E E+ E+++  L +++     G   G++  + 
Sbjct: 63  FEGVRDRTAAEALRNTLLIAEVDPEELPEEED-EYYDHQLMDLDVVTEDGVEVGRITEIS 121

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
           +  +  +  ++       +IPF +  V E++L E K +I P
Sbjct: 122 HLPSQDLFIVERPDGSEVMIPFVEEIVAEIDLAEQKAVITP 162


>gi|163803445|ref|ZP_02197318.1| 16S rRNA-processing protein [Vibrio sp. AND4]
 gi|159172746|gb|EDP57594.1| 16S rRNA-processing protein [Vibrio sp. AND4]
          Length = 184

 Score = 43.9 bits (102), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 39/173 (22%), Positives = 78/173 (45%), Gaps = 12/173 (6%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNR----ELRILKMYRK 56
           M K ++ ++M   G T+G+ G + + SY +N   +  Y  +  + +    E ++    R 
Sbjct: 9   MSKQNEKIVMGKFGATYGIRGWLKVFSYTDNAESIFDYSPWYVNQKGKWVEYKVDSWKRH 68

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           NK  +    G +    A  L + ++          EL E+EF+  +L  M+    +G   
Sbjct: 69  NKGMVCKLEGFEVREDAHLLTNFEIAIDPASLP--ELSEEEFYWRELFGMQVVTTKGYDL 126

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTF-----LIPFTKFAVL-EVNLQENKILID 163
           G V  +   G+  +L IK  ++  F     L+P+ +  V+ +V+ +  +I +D
Sbjct: 127 GVVTDMLETGSNDVLVIKANLKDAFGQKERLVPYLEEQVIKKVDREAQRIEVD 179


>gi|291166845|gb|EFE28891.1| 16S rRNA processing protein RimM [Filifactor alocis ATCC 35896]
          Length = 167

 Score = 43.9 bits (102), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 67/163 (41%), Gaps = 10/163 (6%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNR-----YVLYSNDNRELRILKMYRKNKRFIATF 64
           + TI   HGL GEV +  + +   DL+R     Y++      +L +     +       F
Sbjct: 6   IGTIVKPHGLKGEVKVYPHTD---DLSRFEDATYLIVGGTEEKLEVQSTREQKGMIFLKF 62

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
              + I S   L   +LY    + +  ELEEDE+    L  +E +       G V     
Sbjct: 63  KDKNTIESIEYLLRKELYVDGDNMR--ELEEDEYMIDTLIGLEVYLEDDTKIGVVTDFLQ 120

Query: 125 FGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAA 167
           + A  +  I     +  +IPF K  V +++++  K+ I PI  
Sbjct: 121 YTANDVFVITLESGQKAMIPFLKQFVPKIDMEHQKMRIRPIKG 163


>gi|239917434|ref|YP_002956992.1| 16S rRNA processing protein RimM [Micrococcus luteus NCTC 2665]
 gi|281414076|ref|ZP_06245818.1| 16S rRNA processing protein RimM [Micrococcus luteus NCTC 2665]
 gi|239838641|gb|ACS30438.1| 16S rRNA processing protein RimM [Micrococcus luteus NCTC 2665]
          Length = 200

 Score = 43.9 bits (102), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 39/168 (23%), Positives = 75/168 (44%), Gaps = 13/168 (7%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNP----IDLNRYVLYSND---NRELRILKMYRKN 57
           D LV +A IG  HG+ GEV +  + ++P        R V+         EL + +     
Sbjct: 7   DDLVRVARIGKPHGIRGEVTVQVFTDDPDARFAPGERLVVRDGAPGLPAELTVTRARWNK 66

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
           +  +  F+   + + A  LR  +L+A     +    E DE++  DL ++E     G+  G
Sbjct: 67  QILVVGFAESLDRNVAETLRGAQLFAVPAAPE----ESDEWYEEDLVDLEVR-IDGERVG 121

Query: 118 QVCGVYNFGAGSILEIK-NTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
            V  +       +L +  + +E+  L+PF +  V E++ +   +++ P
Sbjct: 122 VVTALTTGAVQDLLHVAVDGVEEEALVPFVEEIVPEIDPKAGVLVLTP 169


>gi|86151754|ref|ZP_01069968.1| 16S rRNA processing protein RimM [Campylobacter jejuni subsp.
           jejuni 260.94]
 gi|86153557|ref|ZP_01071761.1| 16S rRNA processing protein RimM [Campylobacter jejuni subsp.
           jejuni HB93-13]
 gi|121612604|ref|YP_001000408.1| 16S rRNA processing protein RimM [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|157414999|ref|YP_001482255.1| 16S rRNA processing protein RimM [Campylobacter jejuni subsp.
           jejuni 81116]
 gi|167005350|ref|ZP_02271108.1| putative 16S rRNA processing protein [Campylobacte