BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780713|ref|YP_003065126.1| 16S rRNA-processing protein
[Candidatus Liberibacter asiaticus str. psy62]
         (190 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254780713|ref|YP_003065126.1| 16S rRNA-processing protein [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040390|gb|ACT57186.1| 16S rRNA-processing protein [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 190

 Score =  180 bits (458), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 190/190 (100%), Positives = 190/190 (100%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRF 60
           MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRF
Sbjct: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRF 60

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC
Sbjct: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQYD 180
           GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQYD
Sbjct: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQYD 180

Query: 181 CPLDSAGKKS 190
           CPLDSAGKKS
Sbjct: 181 CPLDSAGKKS 190


>gi|222150103|ref|YP_002551060.1| 16S rRNA-processing protein RimM [Agrobacterium vitis S4]
 gi|221737085|gb|ACM38048.1| 16S rRNA processing protein RimM [Agrobacterium vitis S4]
          Length = 221

 Score =  167 bits (423), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 69/178 (38%), Positives = 109/178 (61%), Gaps = 1/178 (0%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKR 59
           M KL+  VLMA IG   GL GEV + S+  +P+ L  Y  L++ D R   +L +      
Sbjct: 32  MTKLENPVLMAVIGAAQGLRGEVRVKSFTADPMALGDYGKLHAGDGRVFEVLDIREAKTV 91

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +  F G+++ ++A  L  L+L+ +R    DEEL++DEF+  DLE +   D +G  +G V
Sbjct: 92  VVVRFRGVNDRNAAEALNGLELFIERSALPDEELDDDEFYYADLEGLAVVDAEGNSYGTV 151

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNP 177
             V++FGAG +LE+K   ++  L+PF++ AVL+++L+E K+LIDP AAGL +   + P
Sbjct: 152 TAVFDFGAGDLLEVKGPGKRPVLVPFSEAAVLQIDLEEGKLLIDPEAAGLKDDGSEEP 209


>gi|163757327|ref|ZP_02164416.1| 16S rRNA-processing protein [Hoeflea phototrophica DFL-43]
 gi|162284829|gb|EDQ35111.1| 16S rRNA-processing protein [Hoeflea phototrophica DFL-43]
          Length = 202

 Score =  165 bits (419), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 68/189 (35%), Positives = 104/189 (55%), Gaps = 2/189 (1%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYV-LYSNDNRELRILKMYRKNKR 59
           M KL+  +L+  IG   G+ GEV +  +  +P+ +  Y  LYS D R   IL        
Sbjct: 8   MSKLENPILIGIIGAAQGIRGEVRVKPFTEDPMAIAEYGALYSEDGRRFEILDHRLAKTV 67

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +  F GI++ ++A  L+ L LY  R    DE+LEE E+F+ DLE +E +D +G++WG+V
Sbjct: 68  VVVRFRGINDRNAAEALKGLNLYIDRSSLDDEDLEEGEYFHADLEGLEAWDAEGQFWGEV 127

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPI-AAGLNNTTMKNPQ 178
            GV +FG G +LE++    K  +IPFT  AV +V+L+  +IL+DPI A  ++      P 
Sbjct: 128 SGVLDFGGGDLLELREDGRKPVVIPFTLAAVPKVDLEAGRILVDPIAAGLIDTGEDDEPG 187

Query: 179 YDCPLDSAG 187
                   G
Sbjct: 188 EGFDGKGEG 196


>gi|260428907|ref|ZP_05782884.1| 16S rRNA processing protein RimM [Citreicella sp. SE45]
 gi|260419530|gb|EEX12783.1| 16S rRNA processing protein RimM [Citreicella sp. SE45]
          Length = 168

 Score =  163 bits (412), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 51/170 (30%), Positives = 80/170 (47%), Gaps = 5/170 (2%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDN--RELRILKMYRKNKRFI 61
           +   + + TI    G++GEV + S+  +P  +  Y   +N++  R   +         F 
Sbjct: 1   MSDTICVGTIAGAFGVHGEVRLKSFTADPEAIADYAPLTNEDGTRSFDLQITRAVKGGFA 60

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
           A  SG+ +   A  LR   LY  R       L +DEF++TDL  +  +D  G   G+V  
Sbjct: 61  ARLSGVRSKEEADALRGTGLYVPRDRLPA--LPDDEFYHTDLIGLAVYDTGGVELGRVKA 118

Query: 122 VYNFGAGSILEIKNTME-KTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           V N GA  +LE++     KT L+PFT+  V  V+L   +I+ DP    L 
Sbjct: 119 VLNHGAADLLELQLPGGSKTVLLPFTRAVVPTVDLASGRIVADPPEGLLE 168


>gi|118591421|ref|ZP_01548819.1| 16S rRNA processing protein RimM [Stappia aggregata IAM 12614]
 gi|118436093|gb|EAV42736.1| 16S rRNA processing protein RimM [Stappia aggregata IAM 12614]
          Length = 184

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 54/186 (29%), Positives = 93/186 (50%), Gaps = 6/186 (3%)

Query: 1   MVKLDK-LVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS--NDNRELRILKMYRKN 57
           M   D   VLMA IG  HG+ GEV +  Y ++P+    Y + +  +  R   + +   + 
Sbjct: 1   MTSEDDQKVLMAKIGAAHGIRGEVRVKPYGDDPLSFADYGILTTRDGKRSFEVERARVQK 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              I  F GI + + A EL  + L+  R    + E +E  F+ +DL  ++  D+ G+  G
Sbjct: 61  TVVITKFKGITDRNQAEELNGIDLFIDRDQLPEPEEDE--FYYSDLTGLDVLDQTGETLG 118

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNP 177
           ++  V +FGAG +LE++    ++F IPFTK  V E++L+  ++ +       +  T + P
Sbjct: 119 KIIAVQDFGAGDLLEVRPKRGRSFYIPFTKDFVPEIDLENGRVCVSLPEDYFSEGTPE-P 177

Query: 178 QYDCPL 183
             D P 
Sbjct: 178 STDAPD 183


>gi|86359540|ref|YP_471432.1| 16S rRNA-processing protein [Rhizobium etli CFN 42]
 gi|86283642|gb|ABC92705.1| 16S rRNA processing protein [Rhizobium etli CFN 42]
          Length = 217

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 73/184 (39%), Positives = 110/184 (59%), Gaps = 2/184 (1%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVL-YSNDNRELRILKMYRKNKR 59
           M KL+  VLMATIG   GL GEV   +Y  +P  L  Y L +S D R   IL++      
Sbjct: 30  MTKLENPVLMATIGGAQGLRGEVRAKAYTADPTALGDYGLLHSTDGRSFEILEIREMKNV 89

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +  F GI++ ++A  L  L+LY +R +  DEELE+DEF+  DLE +E  D +G  +G V
Sbjct: 90  VVVRFRGINDRNAAEALNGLELYIERDNLPDEELEDDEFYYADLEGLEALDDKGVSYGTV 149

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPI-AAGLNNTTMKNPQ 178
            GV++FGAG +LE+K   ++  LIPF++ +VLE++L+   +LIDP+ A  +++  +    
Sbjct: 150 TGVFDFGAGDLLELKGPGKRPVLIPFSEASVLEIDLEAGTLLIDPLAAGLVDDPELSQFT 209

Query: 179 YDCP 182
              P
Sbjct: 210 AGKP 213


>gi|148251974|ref|YP_001236559.1| 16S rRNA-processing protein RimM [Bradyrhizobium sp. BTAi1]
 gi|166226426|sp|A5E909|RIMM_BRASB RecName: Full=Ribosome maturation factor rimM
 gi|146404147|gb|ABQ32653.1| 16S rRNA processing protein RimM [Bradyrhizobium sp. BTAi1]
          Length = 198

 Score =  158 bits (401), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 49/185 (26%), Positives = 88/185 (47%), Gaps = 4/185 (2%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS--NDNRELRILKMYRKNKRFI 61
           + KL+ +A IG  HG+ GEV + ++  +P+ +  Y   +  + +R   + K        +
Sbjct: 1   MSKLICVAKIGAAHGVRGEVRLWTFTEDPLAVLHYGPLTTKDGSRSFEVAKAREAKDHLV 60

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
           AT  G+ + ++A  L  L+LY  R    +   ++DE+++ DL  +      G   G+V  
Sbjct: 61  ATIKGVTDRNAAERLNGLELYVPRDRLPET--DDDEYYHADLIGLAAETTAGAPLGRVLA 118

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQYDC 181
           ++NFGAG I+EI      T ++PFT   V  V+L   +++I+  A         +     
Sbjct: 119 IHNFGAGDIIEIAPPSGSTLMLPFTNAVVPTVDLAGGRVIIELPAEIEGEDQDSSDNAGS 178

Query: 182 PLDSA 186
           P   A
Sbjct: 179 PEGDA 183


>gi|209551324|ref|YP_002283241.1| 16S rRNA-processing protein RimM [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|238058953|sp|B5ZTH9|RIMM_RHILW RecName: Full=Ribosome maturation factor rimM
 gi|209537080|gb|ACI57015.1| 16S rRNA processing protein RimM [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 189

 Score =  158 bits (399), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 74/176 (42%), Positives = 110/176 (62%), Gaps = 1/176 (0%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKR 59
           M KL+  VLMATIG   GL GEV   +Y  +P  L  Y  L+S D R   +L++      
Sbjct: 1   MTKLENPVLMATIGGAQGLRGEVRAKAYTADPSALGDYGHLHSMDGRSFEVLEIRETKNV 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F G+++ ++A  L  L+LY +R +  DEELE+DEF+  DLE +E  D +G  +G V
Sbjct: 61  VIVRFRGVNDRNAAEALNGLELYIERDNLPDEELEDDEFYYADLEGLEARDDKGASYGTV 120

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMK 175
            GV++FGAG +LE+K   ++  LIPF++ +VLE++L+   +LIDP+AAGL +   +
Sbjct: 121 TGVFDFGAGDLLELKGPGKRPVLIPFSEASVLEIDLEAGTLLIDPLAAGLVDDPEE 176


>gi|254504892|ref|ZP_05117043.1| 16S rRNA processing protein RimM [Labrenzia alexandrii DFL-11]
 gi|222440963|gb|EEE47642.1| 16S rRNA processing protein RimM [Labrenzia alexandrii DFL-11]
          Length = 186

 Score =  157 bits (398), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 54/189 (28%), Positives = 92/189 (48%), Gaps = 8/189 (4%)

Query: 1   MVKLD-KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS--NDNRELRILKMYRKN 57
           M   + + VLMA IG  HG+ GEV +  + ++P+    Y + +  +  +   ++    + 
Sbjct: 1   MSSKETQKVLMAKIGAAHGVRGEVRVKPFGDDPLSFTDYGVLTTKDGKQSFEVVSARVQK 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              +  F  + + + A EL   +LY  R    +   +EDEF+ +DL  ++  D QG+  G
Sbjct: 61  TVVVTKFKEVTDRNRAEELNGTELYIDRDQLPET--DEDEFYYSDLNGLDVKDPQGELLG 118

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNP 177
           ++  V +FGAG + EI+    KTF IPFTK  V  +NL    ++ D     L   + + P
Sbjct: 119 KIVAVQDFGAGDLFEIRPKRGKTFYIPFTKEFVPTINLDSGFVVADLPEDYL---SDEKP 175

Query: 178 QYDCPLDSA 186
             +   DS 
Sbjct: 176 DPESSTDSP 184


>gi|218513354|ref|ZP_03510194.1| 16S rRNA-processing protein [Rhizobium etli 8C-3]
          Length = 206

 Score =  157 bits (397), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 75/176 (42%), Positives = 109/176 (61%), Gaps = 1/176 (0%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKR 59
           M KL+  VLMATIG   GL GEV   +Y  +P  L  Y  L+S D R   IL++      
Sbjct: 18  MTKLENPVLMATIGGAQGLRGEVRAKAYTADPTALGDYGHLHSMDGRSFEILEIREMKNV 77

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +  F GI++ ++A  L  L+LY +R +  DEELE+DEF+  DLE +E  D  G  +G V
Sbjct: 78  VVVRFRGINDRNAAEALNGLELYIERDNLPDEELEDDEFYYADLEGLEARDDHGVSYGTV 137

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMK 175
            GV++FGAG +LE+K   ++  LIPF++ +VLE++L+   +LIDP+AAGL +   +
Sbjct: 138 TGVFDFGAGDLLELKGPGKRPVLIPFSEASVLEIDLEAGTLLIDPLAAGLVDDPEE 193


>gi|109893039|sp|Q2K381|RIMM_RHIEC RecName: Full=Ribosome maturation factor rimM
          Length = 188

 Score =  156 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 73/184 (39%), Positives = 110/184 (59%), Gaps = 2/184 (1%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVL-YSNDNRELRILKMYRKNKR 59
           M KL+  VLMATIG   GL GEV   +Y  +P  L  Y L +S D R   IL++      
Sbjct: 1   MTKLENPVLMATIGGAQGLRGEVRAKAYTADPTALGDYGLLHSTDGRSFEILEIREMKNV 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +  F GI++ ++A  L  L+LY +R +  DEELE+DEF+  DLE +E  D +G  +G V
Sbjct: 61  VVVRFRGINDRNAAEALNGLELYIERDNLPDEELEDDEFYYADLEGLEALDDKGVSYGTV 120

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPI-AAGLNNTTMKNPQ 178
            GV++FGAG +LE+K   ++  LIPF++ +VLE++L+   +LIDP+ A  +++  +    
Sbjct: 121 TGVFDFGAGDLLELKGPGKRPVLIPFSEASVLEIDLEAGTLLIDPLAAGLVDDPELSQFT 180

Query: 179 YDCP 182
              P
Sbjct: 181 AGKP 184


>gi|114763698|ref|ZP_01443092.1| 16S rRNA processing protein RimM [Pelagibaca bermudensis HTCC2601]
 gi|114543699|gb|EAU46712.1| 16S rRNA processing protein RimM [Roseovarius sp. HTCC2601]
          Length = 173

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 55/169 (32%), Positives = 80/169 (47%), Gaps = 5/169 (2%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDN--RELRILKMYRKNKRFIA 62
            + + + TI    G+NGEV + S+   P  L  Y   + ++  R   +         F A
Sbjct: 7   SETICVGTIAGAFGVNGEVRLKSFTAEPEALAEYAPLTTEDGSRSFEVQITRSVKGGFAA 66

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
             SG+ +   A  LR   LYA R       L +DEF++TDL  +  FD  G   G+V  V
Sbjct: 67  RLSGVRSKEEADALRGTGLYAPRDRLP--TLPDDEFYHTDLIGLAVFDTGGAELGRVKAV 124

Query: 123 YNFGAGSILEIKNTME-KTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
            N GA  +LE+    + KT L+PFT+ AV  V+L   +I+ DP    L 
Sbjct: 125 LNHGATDLLELTAPGQSKTVLLPFTREAVPTVDLASGRIVADPPEGLLE 173


>gi|159042900|ref|YP_001531694.1| 16S rRNA-processing protein RimM [Dinoroseobacter shibae DFL 12]
 gi|209573577|sp|A8LMB6|RIMM_DINSH RecName: Full=Ribosome maturation factor rimM
 gi|157910660|gb|ABV92093.1| 16S rRNA processing protein RimM [Dinoroseobacter shibae DFL 12]
          Length = 166

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 48/168 (28%), Positives = 77/168 (45%), Gaps = 4/168 (2%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY-SNDNRELRILKMYRKNKRFIA 62
           +   V +  +    G+ GE+ I S+   P D+  Y      D RE  +    +       
Sbjct: 1   MSDRVCVGAVAGAFGVRGELRIKSFCAVPEDIASYNPLSFEDGRETTLRLTGQIKNGLSG 60

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
             +G+ N  +A  LR  +LYA R       L +DEF++ DL  +   D  G   G+V  V
Sbjct: 61  RLTGVSNKEAADALRGARLYAPRDRLPR--LPDDEFYHADLIGLAVHDTGGTLLGKVAAV 118

Query: 123 YNFGAGSILEIKNTM-EKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           +N GAG +LE++    + + L+PFT+  V  V+L   +I+ DP     
Sbjct: 119 HNHGAGDLLELRGPGLKGSVLLPFTRAVVPTVDLDAGRIVADPPEGLF 166


>gi|260432698|ref|ZP_05786669.1| 16S rRNA processing protein RimM [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260416526|gb|EEX09785.1| 16S rRNA processing protein RimM [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 167

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 52/169 (30%), Positives = 86/169 (50%), Gaps = 5/169 (2%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRI--LKMYRKNKRFI 61
           +  L+ + ++  ++G+ GEV + SY   P D+  Y   ++++   R   +        F 
Sbjct: 1   MSDLICVGSVAGSYGVRGEVRLKSYCAVPEDIETYSPLTDESGTERYPLIITRAIKNGFA 60

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
           A   G++    A  L+ L+LYA+R       L +DEF++ DL  +E +D  G   G+V  
Sbjct: 61  ARLGGVETKEQADALKGLRLYARRAQLPS--LPDDEFYHADLIGLEVYDTGGTLLGKVKS 118

Query: 122 VYNFGAGSILEIKNTM-EKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           V N GA  +LE+     + T L+PFTK AV  V+L+  +I+ DP    L
Sbjct: 119 VQNHGADDLLELHGPGLKTTVLLPFTKAAVPTVDLEAGRIVADPPDGLL 167


>gi|328541717|ref|YP_004301826.1| ribosome maturation factor rimM [polymorphum gilvum SL003B-26A1]
 gi|326411469|gb|ADZ68532.1| Ribosome maturation factor rimM [Polymorphum gilvum SL003B-26A1]
          Length = 183

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 51/178 (28%), Positives = 87/178 (48%), Gaps = 4/178 (2%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS--NDNRELRILKMYRKNK 58
           M      +LMA IG  HG+ GEV +  + ++P+    Y      + +R   ++    +  
Sbjct: 1   MSSASDRILMARIGAAHGVRGEVRVKPFGDDPLSFADYGPLETADGSRRFEVVGARVQKT 60

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
             I  F GID+  +A  L  L LY  R+   +   +E  F++ DL  +E  D     +G 
Sbjct: 61  VVITRFKGIDDRTAAEALNGLDLYVPRERLPEPGDDE--FYHADLIGLEAVDAAASRFGT 118

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKN 176
           V  V +FGAG +LEI+    ++F +PFT+  V  V+L   ++++D     L+  T ++
Sbjct: 119 VVAVQDFGAGDLLEIRPDRGRSFYVPFTQAFVPTVDLAAGRVVLDLPDDYLSEGTDED 176


>gi|84501321|ref|ZP_00999526.1| 16S rRNA processing protein RimM [Oceanicola batsensis HTCC2597]
 gi|84390612|gb|EAQ03100.1| 16S rRNA processing protein RimM [Oceanicola batsensis HTCC2597]
          Length = 166

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 46/168 (27%), Positives = 77/168 (45%), Gaps = 4/168 (2%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKM-YRKNKRFIA 62
           + + V +  I  ++G+ GEV + S+  +P  +  Y   + DN     + +       F A
Sbjct: 1   MTETVCVGAIAGSYGVRGEVRLKSFCADPEAIAEYGPLTGDNGASYSVTLTRPIKNGFAA 60

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
              G+     A  L+ ++L+A R      E +E  F++ DL  +   D  G   G +  V
Sbjct: 61  RLGGVATKEEADALKGVQLFAPRDRLPATEEDE--FYHADLIGLRVVDTGGTEIGTIRAV 118

Query: 123 YNFGAGSILEIKNTM-EKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
            + GAG +LEIK    + T L+PFT+  V  V+L   K++ DP     
Sbjct: 119 MDHGAGDLLEIKGPGLKNTVLLPFTRACVPTVDLAGGKVVADPPEGLF 166


>gi|190893807|ref|YP_001980349.1| 16S rRNA processing protein [Rhizobium etli CIAT 652]
 gi|209573647|sp|B3PR17|RIMM_RHIE6 RecName: Full=Ribosome maturation factor rimM
 gi|190699086|gb|ACE93171.1| 16S rRNA processing protein [Rhizobium etli CIAT 652]
          Length = 193

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 76/176 (43%), Positives = 110/176 (62%), Gaps = 1/176 (0%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKR 59
           M KL+  VLMATIG   GL GEV   +Y  +P  L  Y  L+S D R   IL++      
Sbjct: 5   MTKLENPVLMATIGGAQGLRGEVRAKAYTADPTALGDYGHLHSMDGRSFEILEIREMKNV 64

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +  F GI++ ++A  L  L+LY +R +  DEELE+DEF+  DLE +E  D QG  +G V
Sbjct: 65  VVVRFRGINDRNAAEALNGLELYIERDNLPDEELEDDEFYYADLEGLEARDDQGVSYGTV 124

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMK 175
            GV++FGAG +LE+K   ++  LIPF++ +VLE++L+   +LIDP+AAGL +   +
Sbjct: 125 TGVFDFGAGDLLELKGPGKRPVLIPFSEASVLEIDLEAGTLLIDPLAAGLVDDPEE 180


>gi|172046212|sp|Q1MAK4|RIMM_RHIL3 RecName: Full=Ribosome maturation factor rimM
          Length = 189

 Score =  155 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 73/176 (41%), Positives = 110/176 (62%), Gaps = 1/176 (0%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKR 59
           M KL+  VLMATIG   GL GEV   +Y  +P  L  Y  L+S D R   +L++      
Sbjct: 1   MTKLENPVLMATIGGAQGLRGEVRAKAYTADPGALGDYGHLHSMDGRSFEVLEIREMKNV 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +  F G+++ ++A  L  L+LY +R +  DEEL+EDEF+  DLE +E  D +G  +G V
Sbjct: 61  VVVRFRGVNDRNAAEALNGLELYIERDNLPDEELDEDEFYYADLEGLEARDDKGVSYGTV 120

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMK 175
            GV++FGAG +LE+K   ++  LIPF++ +VLE++L+   +LIDP+AAGL +   +
Sbjct: 121 TGVFDFGAGDLLELKGPGKRPVLIPFSEASVLEIDLEAGTLLIDPLAAGLVDDPEE 176


>gi|222087527|ref|YP_002546064.1| 16S rRNA processing protein RimM [Agrobacterium radiobacter K84]
 gi|254797739|sp|B9JCM0|RIMM_AGRRK RecName: Full=Ribosome maturation factor rimM
 gi|221724975|gb|ACM28131.1| 16S rRNA processing protein RimM [Agrobacterium radiobacter K84]
          Length = 190

 Score =  155 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 79/176 (44%), Positives = 112/176 (63%), Gaps = 1/176 (0%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKR 59
           M KL+  VLMATIG   GL GEV   ++ ++P  L  Y  L+S D R   +L++      
Sbjct: 1   MTKLENPVLMATIGAAQGLRGEVRARAFTSDPTALGDYGHLHSMDGRIFEVLEIREAKNV 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F G++N  +A  L  L+LY +R +  D+ELE+DEFF TDLE +E  D +G  +G V
Sbjct: 61  VIVRFRGVNNRDAAEALNGLELYIERDNLPDDELEDDEFFYTDLEGLEAVDDKGTAYGTV 120

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMK 175
            GVY+FGAG +LE+K   ++  LIPF++ AVLE++L+  KILIDP+AAGL ++   
Sbjct: 121 SGVYDFGAGDLLELKGPGKRPVLIPFSEAAVLEIDLEGGKILIDPMAAGLIDSPDD 176


>gi|241206760|ref|YP_002977856.1| 16S rRNA-processing protein RimM [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240860650|gb|ACS58317.1| 16S rRNA processing protein RimM [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 189

 Score =  154 bits (390), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 73/176 (41%), Positives = 109/176 (61%), Gaps = 1/176 (0%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKR 59
           M KL+  VLMATIG   GL GEV   +Y  +P  L  Y  L+S D R   +L++      
Sbjct: 1   MTKLENPVLMATIGGAQGLRGEVRAKAYTADPGALGDYGHLHSMDGRSFEVLEIREMKNV 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +  F G+++ ++A  L  L+LY +R +  DEELE+DEF+  DLE +E  D +G  +G V
Sbjct: 61  VVVRFRGVNDRNAAEALNGLELYIERDNLPDEELEDDEFYYADLEGLEARDDKGVSYGTV 120

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMK 175
            GV++FGAG +LE+K   ++  LIPF++ +VLE++L+   +LIDP+AAGL     +
Sbjct: 121 TGVFDFGAGDLLELKGPGKRPVLIPFSEASVLEIDLEAGTLLIDPLAAGLVEDPEE 176


>gi|110635771|ref|YP_675979.1| 16S rRNA-processing protein [Mesorhizobium sp. BNC1]
 gi|122965539|sp|Q11CR1|RIMM_MESSB RecName: Full=Ribosome maturation factor rimM
 gi|110286755|gb|ABG64814.1| 16S rRNA processing protein RimM [Chelativorans sp. BNC1]
          Length = 212

 Score =  154 bits (390), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 63/188 (33%), Positives = 102/188 (54%), Gaps = 4/188 (2%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKRFIAT 63
           +  V +A IG  HG+ GEV + ++  +P+ L  Y  L+  D R L++  +    +  I  
Sbjct: 15  ENPVQLAVIGAAHGIKGEVRVKTFTEDPMALGSYGPLHMVDGRVLQVAAIRPAKEVVIVR 74

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F G+D  ++A  L    L+  R    + +LEE+EF+  DL  M   D +G+  G+V  V+
Sbjct: 75  FKGVDGRNAAEALNGEALFVDRSALPE-KLEEEEFYYADLIGMAVLDEKGENLGRVVAVH 133

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTM--KNPQYDC 181
           NFGAG +LE +     T +IPFT+ AV +++L  N I ID I AGL+N  +  +  + + 
Sbjct: 134 NFGAGDLLEFRENSGPTVIIPFTRDAVPDIDLSNNTIRIDSITAGLDNAELSGEEDEAEG 193

Query: 182 PLDSAGKK 189
           P  + G +
Sbjct: 194 PESARGSR 201


>gi|116254277|ref|YP_770115.1| 16S rRNA-processing protein RimM [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115258925|emb|CAK10034.1| putative 16S rRNA processing protein [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 193

 Score =  154 bits (390), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 73/176 (41%), Positives = 110/176 (62%), Gaps = 1/176 (0%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKR 59
           M KL+  VLMATIG   GL GEV   +Y  +P  L  Y  L+S D R   +L++      
Sbjct: 5   MTKLENPVLMATIGGAQGLRGEVRAKAYTADPGALGDYGHLHSMDGRSFEVLEIREMKNV 64

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +  F G+++ ++A  L  L+LY +R +  DEEL+EDEF+  DLE +E  D +G  +G V
Sbjct: 65  VVVRFRGVNDRNAAEALNGLELYIERDNLPDEELDEDEFYYADLEGLEARDDKGVSYGTV 124

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMK 175
            GV++FGAG +LE+K   ++  LIPF++ +VLE++L+   +LIDP+AAGL +   +
Sbjct: 125 TGVFDFGAGDLLELKGPGKRPVLIPFSEASVLEIDLEAGTLLIDPLAAGLVDDPEE 180


>gi|163743781|ref|ZP_02151154.1| 16S rRNA processing protein RimM [Phaeobacter gallaeciensis 2.10]
 gi|161382930|gb|EDQ07326.1| 16S rRNA processing protein RimM [Phaeobacter gallaeciensis 2.10]
          Length = 167

 Score =  153 bits (388), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 50/169 (29%), Positives = 79/169 (46%), Gaps = 5/169 (2%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILK--MYRKNKRFI 61
           + + + +  I  ++G+ GEV + S+   P D+  Y   S ++         +      F 
Sbjct: 1   MTEQICVGAISGSYGVRGEVRLKSFCAMPEDIEDYSPLSTEDGSQTYTITLVRAIKNGFT 60

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
           A   GI+    A  L+ ++L+A R       L +DE+++TDL  +E +D  G   G V  
Sbjct: 61  ARIGGIETKEQADALKGIRLFAPRDRLPS--LPDDEYYHTDLMGLEVYDTGGTLLGTVKS 118

Query: 122 VYNFGAGSILEIK-NTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           V N GA  +LEI      KT L+PFT  AV  V+L   +I+ DP     
Sbjct: 119 VQNHGASDLLEITIPADSKTVLLPFTLAAVPTVDLAAGRIIADPPEGLF 167


>gi|114705611|ref|ZP_01438514.1| 16S rRNA-processing protein [Fulvimarina pelagi HTCC2506]
 gi|114538457|gb|EAU41578.1| 16S rRNA-processing protein [Fulvimarina pelagi HTCC2506]
          Length = 185

 Score =  153 bits (388), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 54/186 (29%), Positives = 90/186 (48%), Gaps = 2/186 (1%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILK-MYRKNKRF 60
           +KL+  VL+  +G  HG+ GEV + SY   P D+  Y    ++N     +K    +    
Sbjct: 1   MKLENPVLLGVVGGAHGVRGEVRVKSYTEEPTDIGAYGPLQDENGNRYTVKTARSQKTVV 60

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +  F  ++  + A  L   +L+ +R    + E +++ +   DLE +      G   G V 
Sbjct: 61  VVKFDEVNERNHAERLNGRELFVERALLPEPEEDDEFYL-DDLEGLAVETLSGDPVGIVV 119

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQYD 180
            V+NFGAG ILE+      T +IPF++ AV E++L+   + +DP+AAGL          D
Sbjct: 120 AVHNFGAGDILEVAPEEGTTLMIPFSEAAVPELDLETGLLKVDPLAAGLAEGPDDEETGD 179

Query: 181 CPLDSA 186
               S+
Sbjct: 180 EADQSS 185


>gi|85706778|ref|ZP_01037870.1| 16S rRNA processing protein RimM [Roseovarius sp. 217]
 gi|85668836|gb|EAQ23705.1| 16S rRNA processing protein RimM [Roseovarius sp. 217]
          Length = 169

 Score =  153 bits (388), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 54/171 (31%), Positives = 81/171 (47%), Gaps = 5/171 (2%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDN--RELRILKMYRKNKR 59
           +     + +  IG   G+ GEV + S+   P D+  Y   ++++  R+  I    +    
Sbjct: 1   MSDSDRICVGAIGGAFGVRGEVRLKSFTAMPEDIASYSPLTSEDGTRQFDISLTGQTTNG 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
           F A  SGI    +A  LR  +LYA R       L +DE+++ DL  +E FD  G   G+V
Sbjct: 61  FTAHLSGIATKEAADALRGTRLYALRAQLP--NLPDDEYYHADLIGLEVFDTGGTLLGRV 118

Query: 120 CGVYNFGAGSILEIKNTM-EKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
             V N GA  +LEI       T L+PFT  AV  V+L   +I+ DP    +
Sbjct: 119 KAVLNHGASDLLEIHGPGLSATVLLPFTLEAVPTVDLASGRIIADPPDGLI 169


>gi|254464202|ref|ZP_05077613.1| 16S rRNA processing protein RimM [Rhodobacterales bacterium Y4I]
 gi|206685110|gb|EDZ45592.1| 16S rRNA processing protein RimM [Rhodobacterales bacterium Y4I]
          Length = 167

 Score =  153 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 49/169 (28%), Positives = 79/169 (46%), Gaps = 5/169 (2%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRI--LKMYRKNKRFI 61
           +  L+ +  I  + G+ GEV + S+   P ++  Y   SN++                F 
Sbjct: 1   MSDLICVGAIAGSFGVRGEVRLKSFCAVPEEIEDYSPLSNEDGSKTYSLTITRPIKNGFA 60

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
           A   G++    A  ++ L+L+A+R       L +DEF++ DL  +E +D  G   G V  
Sbjct: 61  ALLEGVETKEDADAIKGLRLFARRDQLP--LLPDDEFYHADLIGLEVYDTGGTLLGTVKS 118

Query: 122 VYNFGAGSILEIKNTM-EKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           V N GA  +LEI     + T L+PFT  AV  V+L + +I+ DP     
Sbjct: 119 VQNHGASDLLEIHGPGLKATVLLPFTLEAVPTVDLTQGRIIADPPDGLF 167


>gi|83951191|ref|ZP_00959924.1| putative 16S rRNA processing protein [Roseovarius nubinhibens ISM]
 gi|83839090|gb|EAP78386.1| putative 16S rRNA processing protein [Roseovarius nubinhibens ISM]
          Length = 167

 Score =  153 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 48/169 (28%), Positives = 76/169 (44%), Gaps = 5/169 (2%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDN--RELRILKMYRKNKRFI 61
           +   + +  I    G+ GE+ + S+   P D+  Y     ++  R   +    +      
Sbjct: 1   MTDKICVGAIAGAFGVRGELRLKSFTATPEDIATYGPLETEDGARSFAVTLTGQTTNALT 60

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
           A  SG+ +   A  LR  +LY  R       L +DE+++ DL  +E FD  G   G+V  
Sbjct: 61  ARLSGVQSKEEADALRGTQLYVARDRLPS--LPDDEYYHADLIGLEVFDSGGALLGRVKA 118

Query: 122 VYNFGAGSILEIKNTM-EKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           V N GA  +LEI     + T L+PFT+ AV  V+L   +I+ DP     
Sbjct: 119 VLNHGASDLLEIHGPGLKSTVLLPFTRAAVPTVDLATGRIVADPPEGLF 167


>gi|260464186|ref|ZP_05812379.1| 16S rRNA processing protein RimM [Mesorhizobium opportunistum
           WSM2075]
 gi|259029989|gb|EEW31272.1| 16S rRNA processing protein RimM [Mesorhizobium opportunistum
           WSM2075]
          Length = 199

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 67/189 (35%), Positives = 98/189 (51%), Gaps = 2/189 (1%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKR 59
           M K    V MA IG  HG+ GE+ + ++   P+ L  Y  LYS D R  +I+ +   N  
Sbjct: 1   MSKPQNPVQMAVIGAAHGIKGELRVKTFTGEPMALADYGPLYSRDGRAFQIIDIRPANTV 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +  F G+ + ++A  L   +L+  R    D+  EEDEF++ DL  +E  D  G   G+V
Sbjct: 61  VVVRFKGVTDRNTAEALAGTELFVDRSMLPDDG-EEDEFYHADLIGLEVRDDTGAALGKV 119

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQY 179
             V+NFG G IL++     K  LIPFT+ AV +V++ E  + IDP AAGL       P  
Sbjct: 120 VAVHNFGGGDILDVTLGGRKGVLIPFTQAAVPQVSIAEGFVRIDPAAAGLVEDEDGEPPR 179

Query: 180 DCPLDSAGK 188
           +   D  G+
Sbjct: 180 EEDFDPKGR 188


>gi|295399788|ref|ZP_06809769.1| 16S rRNA processing protein RimM [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|312111700|ref|YP_003990016.1| 16S rRNA processing protein RimM [Geobacillus sp. Y4.1MC1]
 gi|294978191|gb|EFG53788.1| 16S rRNA processing protein RimM [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|311216801|gb|ADP75405.1| 16S rRNA processing protein RimM [Geobacillus sp. Y4.1MC1]
          Length = 172

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 38/174 (21%), Positives = 71/174 (40%), Gaps = 9/174 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-------YVLYSNDNRELRILKMYRK 56
           ++K   +  I  THG+ GEV + S  + P +  +       ++  S +  E+ +      
Sbjct: 1   MEKWFNVGKIVNTHGIRGEVRVISRTDFPEERYKKGNTLYIFMEKSQEPIEVIVKSHRVH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
               + +F G DNI+   + +   L          EL E E++  ++        +G+  
Sbjct: 61  KSFDLLSFEGYDNINLVEKFKGAMLKVPESQL--GELNEGEYYFHEIIGCTVVTEEGETV 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           G V  +   GA  +  +K    K  LIP+ +  V  V+++   I I P+   L 
Sbjct: 119 GTVSEILTPGANDVWVVKRNNGKEALIPYIEDIVKNVDVEAKIITIRPMEGLLE 172


>gi|239826593|ref|YP_002949217.1| 16S rRNA-processing protein RimM [Geobacillus sp. WCH70]
 gi|259585645|sp|C5D8U4|RIMM_GEOSW RecName: Full=Ribosome maturation factor rimM
 gi|239806886|gb|ACS23951.1| 16S rRNA processing protein RimM [Geobacillus sp. WCH70]
          Length = 172

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 37/174 (21%), Positives = 70/174 (40%), Gaps = 9/174 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-------YVLYSNDNRELRILKMYRK 56
           ++K   +  I  THG+ GEV + S  + P +  +       ++  S +   + +      
Sbjct: 1   MEKWFNVGKIVNTHGIRGEVRVISRTDFPEERYKKGNTLYIFMEKSKEPVAVTVKSHRVH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
               +  F G DNI+   + +   L          EL+E E++  ++        +G+  
Sbjct: 61  KSFDLLAFEGYDNINLVEKFKGAMLKVPESQL--GELDEGEYYFHEIIGCTVVTEEGETI 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           G V  +   GA  +  +K    K  LIP+ +  V  V+++   I I P+   L 
Sbjct: 119 GTVKEILTPGANDVWVVKRDNGKEVLIPYIEDVVKNVDVETKTITIRPMEGLLE 172


>gi|150398292|ref|YP_001328759.1| 16S rRNA-processing protein RimM [Sinorhizobium medicae WSM419]
 gi|150029807|gb|ABR61924.1| 16S rRNA processing protein RimM [Sinorhizobium medicae WSM419]
          Length = 206

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 76/187 (40%), Positives = 112/187 (59%), Gaps = 1/187 (0%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKR 59
           M +L   VLMATIG   GL GEV + S+ ++P  L  Y  L+S D R   +L++      
Sbjct: 20  MTQLKNPVLMATIGAAQGLRGEVRVKSFTDDPTALGDYGNLHSEDGRVFEVLEIREAKNV 79

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +  F G+++  +A  L  L+L+ +R +  D++L+EDEFF  DLE ME  DR GK +G V
Sbjct: 80  VVVRFRGVNDRTAAEALNGLELFIERDNLPDDDLDEDEFFYADLEGMEAVDRTGKSYGSV 139

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQY 179
            GV++FGAG +LE+K    +  LIPFT+++VLE++L+  K++IDP AAGL +     P  
Sbjct: 140 TGVFDFGAGDLLELKGPGLRPVLIPFTEWSVLEIDLEAGKLVIDPTAAGLVDDEKSGPGK 199

Query: 180 DCPLDSA 186
             P    
Sbjct: 200 PFPTKRK 206


>gi|89069752|ref|ZP_01157088.1| putative 16S rRNA processing protein [Oceanicola granulosus
           HTCC2516]
 gi|89044698|gb|EAR50809.1| putative 16S rRNA processing protein [Oceanicola granulosus
           HTCC2516]
          Length = 175

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 51/168 (30%), Positives = 80/168 (47%), Gaps = 5/168 (2%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNREL-RILKMYRKNKRFIA 62
           D  V++ +I    G+ GEV + SY  +P  +  Y  L++ D R + +++         IA
Sbjct: 6   DSRVVVGSIAGAFGVRGEVRLKSYCADPAAIADYTPLHTEDGRTIAQVVITGETKGALIA 65

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
              GI     A  LR   L+A R       L +DEF++ DL  +  +D  G   G V  V
Sbjct: 66  RLDGIATKEQADALRGTALHAARDRLPS--LPDDEFYHADLLGLPVYDGGGTMLGTVKAV 123

Query: 123 YNFGAGSILEIKNTM-EKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           ++ GAG +LE+     + T L+PFT+  V  V+L   +I+ DP     
Sbjct: 124 HDHGAGDLLEVHGPGLKSTVLLPFTREIVPTVDLAAGRIVADPPEGLF 171


>gi|146337523|ref|YP_001202571.1| 16S rRNA-processing protein RimM [Bradyrhizobium sp. ORS278]
 gi|166226427|sp|A4YK99|RIMM_BRASO RecName: Full=Ribosome maturation factor rimM
 gi|146190329|emb|CAL74325.1| 16S rRNA processing protein, putative function [Bradyrhizobium sp.
           ORS278]
          Length = 199

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 46/171 (26%), Positives = 85/171 (49%), Gaps = 4/171 (2%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS--NDNRELRILKMYRKNKRFI 61
           + KL+ +A IG  HG+ GEV + ++  +P+ +  Y   +  + +R   + K        +
Sbjct: 2   MSKLICVARIGAAHGVRGEVRLWTFTEDPLAVLHYGPLTTKDGSRSFEVTKAREAKDHLV 61

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
           A+F GI + ++A  L  ++LY  R    +   ++DE+++ DL  +      G   G+V  
Sbjct: 62  ASFKGITDRNAAERLNGVELYVPRDRLPET--DDDEYYHADLIGLAAETTAGAPLGRVLA 119

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNT 172
           ++NFGAG I+EI      T ++PFT   V  V+L   +++I+         
Sbjct: 120 IHNFGAGDIIEIAPPSGSTLMLPFTNAVVPTVDLAGGRVIIELPDEIDGED 170


>gi|254510633|ref|ZP_05122700.1| 16S rRNA processing protein RimM [Rhodobacteraceae bacterium KLH11]
 gi|221534344|gb|EEE37332.1| 16S rRNA processing protein RimM [Rhodobacteraceae bacterium KLH11]
          Length = 167

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 50/169 (29%), Positives = 85/169 (50%), Gaps = 5/169 (2%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND--NRELRILKMYRKNKRFI 61
           +  L+ + +I  ++G+ GEV + S+   P D+  Y   +++   +   ++        F 
Sbjct: 1   MSDLICVGSIAGSYGVRGEVRLKSFCAVPEDIEGYSPLTDEAGAKRFPVVLTRTIKNGFA 60

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
           A   G++    A  L  L+L+A+R       L +DEF++TDL  +E +D  G   G+V  
Sbjct: 61  ARLGGVETKEEADALSGLRLFARRDQLPS--LPDDEFYHTDLIGLEVYDTGGTLLGRVKS 118

Query: 122 VYNFGAGSILEIKNTM-EKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           V N GA  +LE+     + T L+PFT  AV  V+L + +I+ DP    L
Sbjct: 119 VQNHGAADLLELHGPGLKSTVLLPFTLDAVPTVDLDKGRIIADPPEGLL 167


>gi|325294071|ref|YP_004279935.1| Ribosome maturation factor rimM [Agrobacterium sp. H13-3]
 gi|325061924|gb|ADY65615.1| Ribosome maturation factor rimM [Agrobacterium sp. H13-3]
          Length = 188

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 73/184 (39%), Positives = 111/184 (60%), Gaps = 2/184 (1%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKR 59
           M KL+  +LMA IG   GL GEV + +Y + P+ L  Y  L S D R   IL++      
Sbjct: 1   MAKLENPILMAKIGGAQGLRGEVRVSTYTDEPMALGDYGNLVSADGRVFEILEVREGKNV 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +  F GI++ ++A  L  L+L+ +R +  D+EL++DEF+  DLE +E  D +GK +G V
Sbjct: 61  VVVRFRGINDRNAAESLNGLELFIERDNLPDDELDDDEFYYADLEGLEAVDAEGKSYGAV 120

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPI-AAGLNNTTMKNPQ 178
             VY+FGAG +LE+K    +  LIPF++ AVLE++L+  +ILIDP+ A  ++N   K+  
Sbjct: 121 SAVYDFGAGDLLELKGAGRRPALIPFSEAAVLEIDLEARRILIDPMAAGLIDNPDDKDET 180

Query: 179 YDCP 182
              P
Sbjct: 181 GASP 184


>gi|126732673|ref|ZP_01748469.1| 16S rRNA processing protein RimM [Sagittula stellata E-37]
 gi|126706803|gb|EBA05873.1| 16S rRNA processing protein RimM [Sagittula stellata E-37]
          Length = 167

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 50/169 (29%), Positives = 80/169 (47%), Gaps = 4/169 (2%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKRFIA 62
           +D+ + +  I    G+ GE  + S+  +P  +  Y  L + D R   +         F  
Sbjct: 1   MDQTICVGAIAGAFGVQGEARLKSFTADPRAIEDYAPLTTEDGRSFGLNITREIANGFAV 60

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
             +G+     A  L+ ++LYA R       L +DEF++TDL  +  FD  G   G+V  V
Sbjct: 61  RLTGVATKEEADALKGVRLYAPRDRLPS--LPDDEFYHTDLIGLSVFDTGGVELGKVKAV 118

Query: 123 YNFGAGSILEIKNTMEK-TFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
            N GA  +LE+  T +  T L+PFT+  V  V+L   +I+ DP    L+
Sbjct: 119 LNHGATDLLELHATGKSGTVLLPFTRACVPTVDLTAGRIVADPPEGLLD 167


>gi|13473626|ref|NP_105194.1| 16S rRNA-processing protein RimM [Mesorhizobium loti MAFF303099]
 gi|21362871|sp|Q98EE0|RIMM_RHILO RecName: Full=Ribosome maturation factor rimM
 gi|14024376|dbj|BAB50980.1| putative 16S rRNA processing protein [Mesorhizobium loti
           MAFF303099]
          Length = 199

 Score =  151 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 65/189 (34%), Positives = 98/189 (51%), Gaps = 2/189 (1%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKR 59
           M K    V MA IG  HG+ GE+ + ++   P+ L  Y  LY+ D R  +I  +   N  
Sbjct: 1   MSKPQNPVQMAVIGAAHGIKGELRVKTFTGEPMALADYGPLYARDGRAFQITDIRPANTV 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +  F GI + ++A  L   +L+  R    D+  EEDEF++ DL  +E  D  G   G+V
Sbjct: 61  VVVRFKGISDRNAAEALAGTELFVDRSMLPDDG-EEDEFYHADLVGLEVRDDTGTALGKV 119

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQY 179
             V+NFG G IL++     K  LIPFT+ AV +V++ E  + +DP+AAGL      +   
Sbjct: 120 VAVHNFGGGDILDVTLAGRKGVLIPFTQAAVPDVSVAEGFVRVDPVAAGLVEDEDGDAPR 179

Query: 180 DCPLDSAGK 188
           +   D  G+
Sbjct: 180 EEDFDPKGR 188


>gi|56698087|ref|YP_168458.1| 16S rRNA-processing protein RimM [Ruegeria pomeroyi DSS-3]
 gi|67461274|sp|Q5LNF0|RIMM_SILPO RecName: Full=Ribosome maturation factor rimM
 gi|56679824|gb|AAV96490.1| 16S rRNA processing protein RimM [Ruegeria pomeroyi DSS-3]
          Length = 167

 Score =  151 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 51/169 (30%), Positives = 85/169 (50%), Gaps = 5/169 (2%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRI--LKMYRKNKRFI 61
           +  L+ + ++  + G+ GEV + S+   P D+  Y   ++++   R   +        F 
Sbjct: 1   MSDLICVGSVAGSFGVRGEVRLKSFCAVPEDIEMYSPLTDESGTARYPIVLTRAIKNGFA 60

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
           A   G++    A  L+ L+LY +R       L +DEF++TDL  +E FD  G   G+V  
Sbjct: 61  AHLGGVETKEEADALKGLRLYTQRDRLPS--LPDDEFYHTDLIGLEVFDTGGTLLGKVIS 118

Query: 122 VYNFGAGSILEIKNTMEKT-FLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           V N GA  +LEI     K+  L+PFT+ AV  V+L++ +I+ DP     
Sbjct: 119 VQNHGAADLLEIGGAGLKSPVLLPFTQAAVPTVDLEQRRIVADPPEGLF 167


>gi|83592522|ref|YP_426274.1| 16S rRNA processing protein RimM [Rhodospirillum rubrum ATCC 11170]
 gi|109893043|sp|Q2RV58|RIMM_RHORT RecName: Full=Ribosome maturation factor rimM
 gi|83575436|gb|ABC21987.1| 16S rRNA processing protein RimM [Rhodospirillum rubrum ATCC 11170]
          Length = 201

 Score =  151 bits (381), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 45/187 (24%), Positives = 88/187 (47%), Gaps = 3/187 (1%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND-NRELRILKMYRK-NKRFI 61
           + + +L+  I  +HG+ G V + S+  + + L  Y   S++       +++  +     I
Sbjct: 1   MTERLLVGVIVGSHGVRGLVRVKSFTQDEMALCDYGPLSDETGTRRFAVEVRNQAKGVVI 60

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               G+ +  +A  L+  +L+  R     + LEEDE+++ DL  +      G   G V  
Sbjct: 61  CQIPGVSDRTAADALKGTRLFLDRAALPADALEEDEYYHADLIGLPVDLVDGGRLGVVHS 120

Query: 122 VYNFGAGSILEIKNTME-KTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQYD 180
           V++FGAG +LE+      ++ L+PFTK  V  V+++  +++ DP    L++T        
Sbjct: 121 VHDFGAGDMLEVTLAQGRRSVLLPFTKAVVPLVDVKAGRLVADPPLGLLDDTRPPAGVEG 180

Query: 181 CPLDSAG 187
              +  G
Sbjct: 181 EVEEDPG 187


>gi|149201387|ref|ZP_01878362.1| 16S rRNA processing protein RimM [Roseovarius sp. TM1035]
 gi|149145720|gb|EDM33746.1| 16S rRNA processing protein RimM [Roseovarius sp. TM1035]
          Length = 169

 Score =  151 bits (381), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 54/170 (31%), Positives = 78/170 (45%), Gaps = 5/170 (2%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDN--RELRILKMYRKNKR 59
           +     + +  IG   G+ GEV + S+   P D+  Y   S ++  R   +    +    
Sbjct: 1   MSDSDRICVGAIGGAFGVRGEVRLKSFTAMPEDIAAYSPLSTEDGARAFDVTLTGQTTNG 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
             A  SGI    +A  LR ++LYA R       L +DEF++ DL  +E +D  G   G+V
Sbjct: 61  LTAQLSGISTKEAADALRGMRLYALRAQLP--NLPDDEFYHADLIGLEVYDTGGAVLGRV 118

Query: 120 CGVYNFGAGSILEIKNTM-EKTFLIPFTKFAVLEVNLQENKILIDPIAAG 168
             V N GA  ILEI       T L+PFT  AV  V+L   +I+ DP    
Sbjct: 119 KAVLNHGASDILEIHAPGMSATILLPFTTEAVPTVDLAAGRIIADPPDGL 168


>gi|56419735|ref|YP_147053.1| 16S rRNA-processing protein RimM [Geobacillus kaustophilus HTA426]
 gi|67461272|sp|Q5L0P5|RIMM_GEOKA RecName: Full=Ribosome maturation factor rimM
 gi|56379577|dbj|BAD75485.1| 16S rRNA processing protein [Geobacillus kaustophilus HTA426]
          Length = 175

 Score =  151 bits (381), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 35/177 (19%), Positives = 67/177 (37%), Gaps = 9/177 (5%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-------YVLYSNDNRELRILKM 53
           M  +++   +  I  THG+ GEV + S  + P +  +       +     +  E+ +   
Sbjct: 1   MKAMERWFNVGKIVNTHGIRGEVRVISRTDFPEERYKKGNKLYIFRERDTEPIEVTVKSH 60

Query: 54  YRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQG 113
                  + +F G D+I+     +   L          EL E E++  ++         G
Sbjct: 61  RVHKSFDLLSFEGYDSINDVERFKGAMLKVPESQL--GELAEGEYYFHEIIGCTVVTEGG 118

Query: 114 KYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           +  G V  +   GA  +  ++       LIP+    VL V+ +   I+I P+   L 
Sbjct: 119 ETIGAVKEILTPGANDVWVVRREDGSEALIPYIDEVVLHVDPERKTIIIRPMEGLLE 175


>gi|254437096|ref|ZP_05050590.1| 16S rRNA processing protein RimM [Octadecabacter antarcticus 307]
 gi|198252542|gb|EDY76856.1| 16S rRNA processing protein RimM [Octadecabacter antarcticus 307]
          Length = 183

 Score =  150 bits (380), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 55/185 (29%), Positives = 88/185 (47%), Gaps = 5/185 (2%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS--NDNRELRILKMYRKNK 58
           M   D  +++ TI  + G+NG+V + S+  +P  L  Y   +  + ++ + I+   +   
Sbjct: 1   MPMSDDRIVVGTIAGSFGVNGDVRLKSFCADPEALANYTPLTRADGSQIMTIVIKGQTKG 60

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
             IA   GI     A  LR + LYA+R       L +DEF++TDL  + T+D  G   G+
Sbjct: 61  SLIARVDGITTKEEADGLRGMDLYAQRDQLPS--LPDDEFYHTDLVGLMTYDTGGAKLGR 118

Query: 119 VCGVYNFGAGSILEIKNTMEK-TFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNP 177
           V  V   GA  +LEI +  +K T L+PFTK  V  V+L   +I++DP      +      
Sbjct: 119 VKAVQTNGADDLLEIISPSDKDTVLVPFTKANVPTVDLASGRIVVDPPRGLFADEADTQD 178

Query: 178 QYDCP 182
                
Sbjct: 179 TSAAD 183


>gi|83855064|ref|ZP_00948594.1| 16S rRNA processing protein RimM [Sulfitobacter sp. NAS-14.1]
 gi|83941588|ref|ZP_00954050.1| 16S rRNA processing protein RimM [Sulfitobacter sp. EE-36]
 gi|83842907|gb|EAP82074.1| 16S rRNA processing protein RimM [Sulfitobacter sp. NAS-14.1]
 gi|83847408|gb|EAP85283.1| 16S rRNA processing protein RimM [Sulfitobacter sp. EE-36]
          Length = 173

 Score =  150 bits (380), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 51/174 (29%), Positives = 83/174 (47%), Gaps = 5/174 (2%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDN--RELRILKMYRKNKRFI 61
           +   + +  I   +G+ GE+ I SY   P D+  Y   S+++  R   +  +      F+
Sbjct: 1   MSDKISVGAISGAYGVRGELRIKSYCAVPEDIESYSPLSSEDGTRSFNLALVRPVKNGFV 60

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
           A  + + +   A  LR   L+A+R       L +DEF++TDL  +E +D  G   G+V  
Sbjct: 61  ARITDVTSKEEADALRGTVLFAQRDQLPS--LPDDEFYHTDLIGLEVYDTGGTLIGKVKT 118

Query: 122 VYNFGAGSILEIKNTME-KTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTM 174
           V N GA  +LE +     +T  +PFTK AV  V+L   +I+ DP    L +   
Sbjct: 119 VQNHGADDLLETQLAGSAQTVFLPFTKAAVPTVDLATGRIIADPPEGILPDAKD 172


>gi|319780737|ref|YP_004140213.1| 16S rRNA processing protein RimM [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317166625|gb|ADV10163.1| 16S rRNA processing protein RimM [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 199

 Score =  150 bits (380), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 66/189 (34%), Positives = 99/189 (52%), Gaps = 2/189 (1%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKR 59
           M KL   V MA IG  HG+ GE+ + ++   P+ L  Y  LY+ D R  +I+ +   N  
Sbjct: 1   MSKLQNPVQMAVIGAAHGIKGELRVKTFTGEPLALADYGPLYARDGRAFQIVDIRPANTV 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +  F GI + ++A  L   +L+  R    D+  EEDEF++ DL  +E  D  G   G+V
Sbjct: 61  VVVRFKGIADRNAAEALAGTELFVDRSMLPDDG-EEDEFYHADLVGLEVRDDTGAVLGKV 119

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQY 179
             V+NFG G IL++     K  LIPFT+ AV +V++ E  + +DP AAGL +        
Sbjct: 120 VAVHNFGGGDILDVTLGGRKGVLIPFTQAAVPQVSIAEGFVRVDPAAAGLVDDEDGGGPR 179

Query: 180 DCPLDSAGK 188
           +   D  G+
Sbjct: 180 EEDFDPKGR 188


>gi|254487378|ref|ZP_05100583.1| 16S rRNA processing protein RimM [Roseobacter sp. GAI101]
 gi|214044247|gb|EEB84885.1| 16S rRNA processing protein RimM [Roseobacter sp. GAI101]
          Length = 194

 Score =  150 bits (380), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 51/183 (27%), Positives = 81/183 (44%), Gaps = 5/183 (2%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRI--LKMYRKNKRFI 61
           +   + +  I  ++G+ GE+ I SY   P D+  Y   ++++   R     +      F+
Sbjct: 14  MSDKIPVGAISGSYGVRGELRIKSYCAVPEDIENYSPLTSEDGSRRYALALVRPIKNGFV 73

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
           A  + + +   A  LR   LYA R       L +DEF++ DL  +E +D  G   G+V  
Sbjct: 74  ARITDVTSKEEADALRGTLLYADRAQLPS--LPDDEFYHADLLGLEVYDTGGTLIGKVKT 131

Query: 122 VYNFGAGSILEIKNTM-EKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQYD 180
           V N GA  +LE +      T  +PFTK AV  V+L   +I+ DP    L +T        
Sbjct: 132 VQNHGADDLLETQLAGTSATVFLPFTKAAVPTVDLASGRIIADPPDGILPDTKADADADH 191

Query: 181 CPL 183
              
Sbjct: 192 KGA 194


>gi|119386589|ref|YP_917644.1| 16S rRNA processing protein RimM [Paracoccus denitrificans PD1222]
 gi|171704477|sp|A1B8V4|RIMM_PARDP RecName: Full=Ribosome maturation factor rimM
 gi|119377184|gb|ABL71948.1| 16S rRNA processing protein RimM [Paracoccus denitrificans PD1222]
          Length = 167

 Score =  150 bits (379), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 49/167 (29%), Positives = 77/167 (46%), Gaps = 5/167 (2%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS--NDNRELRILKMYRKNKRFI 61
           + + V +  I    G+ GEV + S+ + P D+  Y      + NR   I           
Sbjct: 1   MTERVCVGAIAGAFGVRGEVRLKSFTSQPNDIAGYSPLYTEDGNRSFTIRLTRPVTGGLG 60

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
           A  SG++    A  L+ + L+A R       L +DEF++ DL  +  +D  G   G+V  
Sbjct: 61  ARLSGVETREQAEALKGVTLWADRDKLPA--LPDDEFYHADLIGLSVYDTGGALLGKVRA 118

Query: 122 VYNFGAGSILEIKNTMEKTF-LIPFTKFAVLEVNLQENKILIDPIAA 167
           +Y+ GAG ILEI     +   L+PFT+  V  V+L   +I+ DP   
Sbjct: 119 IYDHGAGDILEIFGPGRRQVLLLPFTRAFVPTVDLAAGRIVADPPEE 165


>gi|254476323|ref|ZP_05089709.1| 16S rRNA processing protein RimM [Ruegeria sp. R11]
 gi|214030566|gb|EEB71401.1| 16S rRNA processing protein RimM [Ruegeria sp. R11]
          Length = 167

 Score =  150 bits (379), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 50/169 (29%), Positives = 83/169 (49%), Gaps = 5/169 (2%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDN--RELRILKMYRKNKRFI 61
           + + + +  I  ++G+ GEV + S+   P D+  Y   SN++  +   ++ +      F 
Sbjct: 1   MTEQICVGAIAGSYGVRGEVRLKSFCAIPEDIEAYSPLSNEDGTQSYTLVLVRAIKNGFT 60

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
           A   G++    A  L+ L+L+A+R       L +DE+++TDL  +E +D  G   G V  
Sbjct: 61  ARVGGVETKEQADALKGLRLFAQRDRLPS--LPDDEYYHTDLMGLEVYDTGGTLLGTVKT 118

Query: 122 VYNFGAGSILEIKNTM-EKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           V N GA  +LEI       T L+PFT  AV  V+L   +I+ DP     
Sbjct: 119 VQNHGASDLLEITVPGHSSTILLPFTLAAVPTVDLASGRIIADPPEGLF 167


>gi|153008278|ref|YP_001369493.1| 16S rRNA-processing protein RimM [Ochrobactrum anthropi ATCC 49188]
 gi|166226460|sp|A6WXG0|RIMM_OCHA4 RecName: Full=Ribosome maturation factor rimM
 gi|151560166|gb|ABS13664.1| 16S rRNA processing protein RimM [Ochrobactrum anthropi ATCC 49188]
          Length = 189

 Score =  150 bits (379), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 54/183 (29%), Positives = 100/183 (54%), Gaps = 2/183 (1%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND-NRELRILKMYRKNKR 59
           M + +  + +A IG  HG  GEV + ++  +P+ +  Y L  ++  +   +L+       
Sbjct: 1   MPRPENPIQLAVIGAAHGTRGEVRVKTFTGDPLAIAEYGLLYDEQGKSYEVLEARPAKTV 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +  F GI++ ++A  L   +L+  R    D+EL+EDEFF TDL  +   D +GK +G V
Sbjct: 61  VVVRFKGINDRNAAEALNGTELFIDRSQLPDDELDEDEFFQTDLIGLLAVDAEGKTYGVV 120

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP-IAAGLNNTTMKNPQ 178
             +++FG G ++E+    ++  LIPFT+ AV E++L +  +L++P  A  + +   + PQ
Sbjct: 121 SALFDFGGGDLIELSEKGKRPMLIPFTEAAVPEIDLDKGTLLVEPYAAGLIADDEDERPQ 180

Query: 179 YDC 181
            + 
Sbjct: 181 NEK 183


>gi|227823735|ref|YP_002827708.1| 16S rRNA-processing protein RimM [Sinorhizobium fredii NGR234]
 gi|254797759|sp|C3MAG2|RIMM_RHISN RecName: Full=Ribosome maturation factor rimM
 gi|227342737|gb|ACP26955.1| 16S rRNA processing protein RimM [Sinorhizobium fredii NGR234]
          Length = 187

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 76/187 (40%), Positives = 113/187 (60%), Gaps = 1/187 (0%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKR 59
           M KL+  VLMATIG   GL GEV + S+ ++P  L  Y  L+S D R   +L++      
Sbjct: 1   MTKLENPVLMATIGAAQGLRGEVRVKSFTDDPTALGDYGNLHSEDGRVFEVLEVRETKNV 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F GI++  +A  L  L+L+ +R +  D++L+EDEFF  DLE +E  D  GK +G V
Sbjct: 61  VIVRFRGINDRSAAEALNGLELFIERDNLPDDDLDEDEFFYADLEGLEAVDGTGKSYGSV 120

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQY 179
            GV++FGAG +LE+K    +  LIPFT+++VLE++L+  K+L+DP+AAGL     ++   
Sbjct: 121 TGVFDFGAGDLLELKGPGRRPVLIPFTEWSVLEIDLEAGKLLVDPVAAGLVEDKDESLDK 180

Query: 180 DCPLDSA 186
             P    
Sbjct: 181 QFPTKRK 187


>gi|27375594|ref|NP_767123.1| 16S rRNA-processing protein RimM [Bradyrhizobium japonicum USDA
           110]
 gi|46397690|sp|Q89X39|RIMM_BRAJA RecName: Full=Ribosome maturation factor rimM
 gi|27348731|dbj|BAC45748.1| 16S rRNA processing protein [Bradyrhizobium japonicum USDA 110]
          Length = 173

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 45/174 (25%), Positives = 83/174 (47%), Gaps = 4/174 (2%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY--SNDNRELRILKMYRKNKRFI 61
           +  LV +A IG  HG+ G V + ++  +P  + RY      +  R+  + +        +
Sbjct: 1   MSALVCVARIGAAHGVRGAVKLWTFTEDPFAIKRYGPLLSKDGKRQFEVAQAREAKDHLV 60

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
           ATF G+     A  L  ++LY  R+       +EDE+++TDL  +      G+  G+V  
Sbjct: 61  ATFKGVTTRDEAERLNGIELYVAREKLPAT--DEDEYYHTDLIGLAAVTTDGEPLGRVLA 118

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMK 175
           ++NFGAG I+EI      + L+PF+   V EV++   ++++        +   +
Sbjct: 119 IHNFGAGDIIEIAPPKGASLLLPFSNAVVPEVDVAGGRVVVALPQEIAGDEAEE 172


>gi|146276238|ref|YP_001166397.1| 16S rRNA-processing protein RimM [Rhodobacter sphaeroides ATCC
           17025]
 gi|166226472|sp|A4WNX8|RIMM_RHOS5 RecName: Full=Ribosome maturation factor rimM
 gi|145554479|gb|ABP69092.1| 16S rRNA processing protein RimM [Rhodobacter sphaeroides ATCC
           17025]
          Length = 169

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 53/171 (30%), Positives = 78/171 (45%), Gaps = 6/171 (3%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS--NDNRELRILKMYRKNK 58
           M + D+L  +  I    G+ GEV + S+   P D+  Y      +  R  R+        
Sbjct: 1   MTRTDRL-CVGAIAGAFGVKGEVRLKSFCAEPSDIASYGPLFTEDGGRSFRVTLTRPVAG 59

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
              A  SG+     A  LR ++LYA R       L +DEF++ DL  +E  D  G   G+
Sbjct: 60  ALGARLSGVATKEEADALRGVQLYADRDRLPS--LGDDEFYHADLIGLEVRDTGGALLGR 117

Query: 119 VCGVYNFGAGSILEIKNTMEKT-FLIPFTKFAVLEVNLQENKILIDPIAAG 168
           V  V+N GAG ILE+     +   L+PFT+  V  V+L   +I+ DP    
Sbjct: 118 VHAVHNHGAGDILEVTGAGRREALLLPFTRAVVPTVDLSIGRIVADPPEGL 168


>gi|22001903|sp|Q8UBZ8|RIMM_AGRT5 RecName: Full=Ribosome maturation factor rimM
          Length = 188

 Score =  150 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 72/184 (39%), Positives = 112/184 (60%), Gaps = 2/184 (1%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKR 59
           M KL+  +LMA IG   GL GEV + +Y ++P+ L  Y  L + D R   IL++      
Sbjct: 1   MAKLENPILMAKIGGAQGLRGEVRVSTYTDDPMALGDYGNLVTADGRVFEILEVREGKNV 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +  F GI++ ++A  L  L+L+ +R +  D+EL++DEF+  DLE +E  D +GK +G V
Sbjct: 61  VVVRFRGINDRNAAESLNGLELFIERDNLPDDELDDDEFYYADLEGLEAVDAEGKSYGAV 120

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPI-AAGLNNTTMKNPQ 178
             VY+FGAG +LE+K    +  LIPF++ AVLE++L+  +ILIDP+ A  ++N   K+  
Sbjct: 121 SAVYDFGAGDLLELKGAGRRPALIPFSEAAVLEIDLEAGRILIDPMAAGLIDNPDDKDQN 180

Query: 179 YDCP 182
              P
Sbjct: 181 GMSP 184


>gi|77464628|ref|YP_354132.1| 16S rRNA-processing protein RimM [Rhodobacter sphaeroides 2.4.1]
 gi|332559521|ref|ZP_08413843.1| 16S rRNA-processing protein RimM [Rhodobacter sphaeroides WS8N]
 gi|109893044|sp|Q3IZ03|RIMM_RHOS4 RecName: Full=Ribosome maturation factor rimM
 gi|77389046|gb|ABA80231.1| 16S rRNA processing protein RimM [Rhodobacter sphaeroides 2.4.1]
 gi|332277233|gb|EGJ22548.1| 16S rRNA-processing protein RimM [Rhodobacter sphaeroides WS8N]
          Length = 169

 Score =  150 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 50/170 (29%), Positives = 74/170 (43%), Gaps = 5/170 (2%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND--NRELRILKMYRKNKR 59
           +     V +  I    G+ GEV + S+   P D+  Y   S +  +R  R+         
Sbjct: 1   MTKTDRVCVGAIAGAFGVKGEVRLKSFCTEPTDIASYGPLSTEKGDRSFRVTLTRPVAGG 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
             A  S +     A  LR + LY  R       L +DEF++ DL  +E  D  G   G+V
Sbjct: 61  LGARLSDVTTKEEADALRGVGLYVDRARLPS--LGDDEFYHADLIGLEVRDTGGALLGRV 118

Query: 120 CGVYNFGAGSILEIKNTMEKT-FLIPFTKFAVLEVNLQENKILIDPIAAG 168
             V+N GAG ILE+     +   L+PFT+  V  V+L   +I+ DP    
Sbjct: 119 HAVHNHGAGDILEVAGAAGREGLLLPFTRAVVPTVDLAAGRIVADPPEGL 168


>gi|149915428|ref|ZP_01903955.1| putative 16S rRNA processing protein [Roseobacter sp. AzwK-3b]
 gi|149810717|gb|EDM70558.1| putative 16S rRNA processing protein [Roseobacter sp. AzwK-3b]
          Length = 170

 Score =  150 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 48/172 (27%), Positives = 77/172 (44%), Gaps = 6/172 (3%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRIL---KMYRKNK 58
           +  D  + +  I    G++GE+ + S+   P D+  Y     ++                
Sbjct: 1   MTDDTRICLGAIAGAFGVHGELRLKSFTATPEDIAAYGPLETEDGARSFEITLSGQSAKG 60

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
             IA  SG+     A  LR ++LY +R       L ++E+++ DL  +E +D  G   G+
Sbjct: 61  GLIARLSGVTTKEQADALRGVRLYTERDRLPA--LPDEEYYHADLIGLEVYDTGGTLLGR 118

Query: 119 VCGVYNFGAGSILEIKNTM-EKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           V  V N GAG ILE+       T L+PFT+ AV  V+L   +I+ DP     
Sbjct: 119 VKAVLNHGAGDILELHGQGLTSTVLLPFTRQAVPTVDLAAGRIVADPPEGLF 170


>gi|259417349|ref|ZP_05741268.1| 16S rRNA processing protein RimM [Silicibacter sp. TrichCH4B]
 gi|259346255|gb|EEW58069.1| 16S rRNA processing protein RimM [Silicibacter sp. TrichCH4B]
          Length = 171

 Score =  150 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 52/173 (30%), Positives = 82/173 (47%), Gaps = 6/173 (3%)

Query: 1   MVK-LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKM--YRKN 57
           M    + L+ +  +  + G+ GEV + S+  NP ++  Y     ++ + R          
Sbjct: 1   MSNVSEDLICVGALAGSFGVRGEVRLKSFCANPEEIEDYSPLFGEDGQTRYTLAITRAVK 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
             F A    +D    A  L+ ++LYA R D     L +DEF++ DL  +E FD  G   G
Sbjct: 61  NGFAARIVDVDTKEQADALKGVQLYALRDDLPS--LPDDEFYHADLIGLEVFDTGGTLLG 118

Query: 118 QVCGVYNFGAGSILEIKNTM-EKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           +V  V N+GA  +LE+       T L+PFTK AV  V+L + +I+ DP     
Sbjct: 119 RVKAVQNYGADDLLELHGPGLSATVLLPFTKAAVPTVDLTQGRIIADPPEGVF 171


>gi|209573734|sp|A6UE44|RIMM_SINMW RecName: Full=Ribosome maturation factor rimM
          Length = 187

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 76/187 (40%), Positives = 112/187 (59%), Gaps = 1/187 (0%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKR 59
           M +L   VLMATIG   GL GEV + S+ ++P  L  Y  L+S D R   +L++      
Sbjct: 1   MTQLKNPVLMATIGAAQGLRGEVRVKSFTDDPTALGDYGNLHSEDGRVFEVLEIREAKNV 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +  F G+++  +A  L  L+L+ +R +  D++L+EDEFF  DLE ME  DR GK +G V
Sbjct: 61  VVVRFRGVNDRTAAEALNGLELFIERDNLPDDDLDEDEFFYADLEGMEAVDRTGKSYGSV 120

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQY 179
            GV++FGAG +LE+K    +  LIPFT+++VLE++L+  K++IDP AAGL +     P  
Sbjct: 121 TGVFDFGAGDLLELKGPGLRPVLIPFTEWSVLEIDLEAGKLVIDPTAAGLVDDEKSGPGK 180

Query: 180 DCPLDSA 186
             P    
Sbjct: 181 PFPTKRK 187


>gi|15966996|ref|NP_387349.1| 16S rRNA-processing protein [Sinorhizobium meliloti 1021]
 gi|307302464|ref|ZP_07582221.1| 16S rRNA processing protein RimM [Sinorhizobium meliloti BL225C]
 gi|307316206|ref|ZP_07595650.1| 16S rRNA processing protein RimM [Sinorhizobium meliloti AK83]
 gi|21362866|sp|Q92L42|RIMM_RHIME RecName: Full=Ribosome maturation factor rimM
 gi|15076269|emb|CAC47822.1| Probable 16S rRNA processing protein [Sinorhizobium meliloti 1021]
 gi|306898046|gb|EFN28788.1| 16S rRNA processing protein RimM [Sinorhizobium meliloti AK83]
 gi|306903134|gb|EFN33724.1| 16S rRNA processing protein RimM [Sinorhizobium meliloti BL225C]
          Length = 187

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 76/187 (40%), Positives = 112/187 (59%), Gaps = 1/187 (0%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKR 59
           M +L   VLMATIG   GL GEV + S+ ++P  L  Y  L+S D R   +L++      
Sbjct: 1   MTQLKNPVLMATIGAAQGLRGEVRVKSFTDDPAALGDYGNLHSEDGRVFEVLEIREAKNV 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +  F GI++  +A  L  L+L+ +R +  D++L+EDEFF  DLE +E  DR GK +G V
Sbjct: 61  VVVRFRGINDRTAAEALNGLELFIERDNLPDDDLDEDEFFYADLEGLEAVDRTGKSYGSV 120

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQY 179
            GV++FGAG +LE+K    +  LIPFT+++VLE++L+  K++IDP AAGL +     P  
Sbjct: 121 TGVFDFGAGDLLELKGPGLRPVLIPFTEWSVLEIDLEAGKLVIDPTAAGLVDDEKSGPGK 180

Query: 180 DCPLDSA 186
             P    
Sbjct: 181 PFPTKRK 187


>gi|239833041|ref|ZP_04681370.1| 16S rRNA processing protein RimM [Ochrobactrum intermedium LMG
           3301]
 gi|239825308|gb|EEQ96876.1| 16S rRNA processing protein RimM [Ochrobactrum intermedium LMG
           3301]
          Length = 212

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 52/183 (28%), Positives = 98/183 (53%), Gaps = 2/183 (1%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND-NRELRILKMYRKNKR 59
           M + +  + +A IG  HG  GEV + ++  +P+ +  Y L  ++  +   +L+       
Sbjct: 25  MPRPENPIQLAVIGAAHGTRGEVRVKTFTGDPLAIADYGLLYDEQGKSYEVLEARPAKTV 84

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +  F GI++ ++A  L   +L+  R    D+EL+EDEF+ TDL  +   D +GK +G V
Sbjct: 85  VVVRFKGINDRNAAEALNGTELFIDRSQLPDDELDEDEFYQTDLIGLLAVDAEGKPYGVV 144

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP-IAAGLNNTTMKNPQ 178
             +++FG G ++E+    ++  LIPFT+ AV E++  +  +L++P  A  +     + PQ
Sbjct: 145 SALFDFGGGDLIELSEKGKRPMLIPFTEAAVPEIDFDKGILLVEPHAAGLIAEDEDERPQ 204

Query: 179 YDC 181
            + 
Sbjct: 205 GEK 207


>gi|221640540|ref|YP_002526802.1| 16S rRNA-processing protein RimM [Rhodobacter sphaeroides KD131]
 gi|221161321|gb|ACM02301.1| 16S rRNA-processing protein rimM [Rhodobacter sphaeroides KD131]
          Length = 176

 Score =  149 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 50/170 (29%), Positives = 74/170 (43%), Gaps = 5/170 (2%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND--NRELRILKMYRKNKR 59
           +     V +  I    G+ GEV + S+   P D+  Y   S +  +R  R+         
Sbjct: 8   MTKTDRVCVGAIAGAFGVKGEVRLKSFCTEPTDIASYGPLSTEKGDRSFRVTLTRPVAGG 67

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
             A  S +     A  LR + LY  R       L +DEF++ DL  +E  D  G   G+V
Sbjct: 68  LGARLSDVTTKEEADALRGVGLYVDRARLPS--LGDDEFYHADLIGLEVRDTGGALLGRV 125

Query: 120 CGVYNFGAGSILEIKNTMEKT-FLIPFTKFAVLEVNLQENKILIDPIAAG 168
             V+N GAG ILE+     +   L+PFT+  V  V+L   +I+ DP    
Sbjct: 126 HAVHNHGAGDILEVAGAAGREGLLLPFTRAVVPTVDLAAGRIVADPPEGL 175


>gi|269127627|ref|YP_003300997.1| 16S rRNA processing protein RimM [Thermomonospora curvata DSM
           43183]
 gi|268312585|gb|ACY98959.1| 16S rRNA processing protein RimM [Thermomonospora curvata DSM
           43183]
          Length = 172

 Score =  149 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 41/172 (23%), Positives = 74/172 (43%), Gaps = 6/172 (3%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDN----RELRILKMYRKNKRF 60
           D  V++  IG  HG+ GEV +D   ++P          + +      L + +      R 
Sbjct: 3   DDQVVVGRIGRPHGVRGEVTVDVRTDDPDARFAPGAVLDTDPPHLGPLTVERARWHVGRL 62

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +  F+G+D+  +A +LR   L     D    E  ++ F + +L  +      G   G V 
Sbjct: 63  LLRFTGVDDRTAAEKLRGTWLVVDTGDLPPLEDPDE-FHDHELIGLTAVTTDGTPVGTVR 121

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNT 172
            + ++ A  +L I+       L+PF    V EV++   +I+IDP    L+ +
Sbjct: 122 DILHY-AQDLLVIRRETGGEALVPFVAALVPEVDVAGGRIVIDPPPGLLDES 172


>gi|15615043|ref|NP_243346.1| 16S rRNA processing protein [Bacillus halodurans C-125]
 gi|14423895|sp|Q9KA14|RIMM_BACHD RecName: Full=Ribosome maturation factor rimM
 gi|10175100|dbj|BAB06199.1| 16S rRNA processing protein [Bacillus halodurans C-125]
          Length = 173

 Score =  148 bits (375), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 37/175 (21%), Positives = 72/175 (41%), Gaps = 10/175 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-------YVLYSNDNRELRILKMYRK 56
           + K + +  I  THG+ GEV + S  +   D               N+   + +    + 
Sbjct: 1   MSKWLNVGKIVNTHGVRGEVRVLSTTDFEDDRFSSGKTLYVMRPNQNERVAVTVASHRKH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
               +  F G  +I+     +  +L    +D  +  L E EFF  ++         G+  
Sbjct: 61  KNFDLLCFEGYPSINDVEAFKGGRLQVPIEDRPE--LGEGEFFYHEIIGCSVVTIAGEEL 118

Query: 117 GQVCGVYNFGAGSILEIK-NTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           G+V  + + GA  +  ++     K  LIP+ +  V +V+L++ +I I+P+   L 
Sbjct: 119 GKVKEILSPGANDVWVVQCRRGGKDLLIPYIEQVVKQVDLEKQQITIEPMEGLLE 173


>gi|296268965|ref|YP_003651597.1| 16S rRNA processing protein RimM [Thermobispora bispora DSM 43833]
 gi|296091752|gb|ADG87704.1| 16S rRNA processing protein RimM [Thermobispora bispora DSM 43833]
          Length = 171

 Score =  148 bits (375), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 35/170 (20%), Positives = 67/170 (39%), Gaps = 6/170 (3%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNR----YVLYSNDNRELRILKMYRKNKRFIAT 63
           +++  IG  HG+ GEV ++   + P               D   L + +        +  
Sbjct: 3   LVVGRIGRPHGVRGEVTVEVRTDEPEARFAPGSVLATDPADAGPLTVERARWHRGILLVA 62

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F+G+ + ++A  LR   L     D       ++ F + +L  +      G+  G+V  V 
Sbjct: 63  FAGVPDRNAAERLRGTLLVIDSADIPPSGDPDE-FHDHELLGLAVVTTDGQRVGEVADVL 121

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTT 173
           + G   +L ++    +   +PF K  V EV+    +++IDP    L    
Sbjct: 122 HHG-QDLLVVRRPSGEEVYVPFVKAIVPEVDPGAGRLVIDPPPGLLELNA 170


>gi|158425577|ref|YP_001526869.1| 16S rRNA-processing protein RimM [Azorhizobium caulinodans ORS 571]
 gi|172048026|sp|A8IKV0|RIMM_AZOC5 RecName: Full=Ribosome maturation factor rimM
 gi|158332466|dbj|BAF89951.1| 16S rRNA processing protein [Azorhizobium caulinodans ORS 571]
          Length = 177

 Score =  148 bits (375), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 52/182 (28%), Positives = 88/182 (48%), Gaps = 8/182 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDN-RELRILKMYRKNKRFIA 62
           +   +L+A IG  HG+ GEV + ++  +P+ L RY L      R  ++  +      F+A
Sbjct: 1   MTDRILIARIGAPHGVKGEVRLFAFGEDPLALKRYPLTDESGARRFKVQSLRAAKDHFVA 60

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
              GI + ++A  L +  L+  R      E +ED F++ DL  +   D+ G   G V  +
Sbjct: 61  RLEGIADRNAAEALTNTDLFVPRDALPAAE-DEDTFYHADLMGLRVEDQSGALLGTVLAM 119

Query: 123 YNFGAGSILEIKNT-MEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQYDC 181
           ++FGAG +LE       +T L+PFTK AV  V++   +I++ P     +    + P  D 
Sbjct: 120 HDFGAGDVLEYTPEGGGRTLLLPFTKAAVPVVDVPGGRIVVVP-----DTNPDETPPEDA 174

Query: 182 PL 183
             
Sbjct: 175 DQ 176


>gi|126463468|ref|YP_001044582.1| 16S rRNA-processing protein RimM [Rhodobacter sphaeroides ATCC
           17029]
 gi|166226471|sp|A3PN94|RIMM_RHOS1 RecName: Full=Ribosome maturation factor rimM
 gi|126105132|gb|ABN77810.1| 16S rRNA processing protein RimM [Rhodobacter sphaeroides ATCC
           17029]
          Length = 169

 Score =  148 bits (374), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 51/170 (30%), Positives = 75/170 (44%), Gaps = 5/170 (2%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND--NRELRILKMYRKNKR 59
           +     V +  I    G+ GEV + S+   P D+  Y   S +  +R  R+         
Sbjct: 1   MTKTDRVCVGAIAGAFGVKGEVRLKSFCTEPTDIASYGPLSTEKGDRSFRVTLTRPVAGG 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
             A  S +     A  LR + LY  R       L +DEF++ DL  +E  D  G   G+V
Sbjct: 61  LGARLSDVTTKEEADALRGVGLYVDRARLPS--LGDDEFYHADLIGLEVRDTGGALLGRV 118

Query: 120 CGVYNFGAGSILEIKNTMEKT-FLIPFTKFAVLEVNLQENKILIDPIAAG 168
             V+N GAG ILEI   + +   L+PFT+  V  V+L   +I+ DP    
Sbjct: 119 HAVHNHGAGDILEIAGAVGREGLLLPFTRAVVPTVDLAAGRIVADPPEGL 168


>gi|126738059|ref|ZP_01753780.1| 16S rRNA processing protein RimM [Roseobacter sp. SK209-2-6]
 gi|126720556|gb|EBA17261.1| 16S rRNA processing protein RimM [Roseobacter sp. SK209-2-6]
          Length = 167

 Score =  148 bits (374), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 47/169 (27%), Positives = 80/169 (47%), Gaps = 5/169 (2%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS--NDNRELRILKMYRKNKRFI 61
           + +L+ +  I  ++G+ GEV + S+   P ++  Y   S  + ++   +         F 
Sbjct: 1   MSELICVGAIAGSYGVRGEVRLKSFCAVPEEIEAYSPLSSEDGSQSYSLTLTRAIKGGFS 60

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               G++    A  ++ LKL+A R       L  DE++  DL  ME +D  G   G V  
Sbjct: 61  GYLGGVETKEQADAIKGLKLFAPRDRLPS--LPSDEYYYADLVGMEVYDTGGVLLGTVKS 118

Query: 122 VYNFGAGSILEIKNTM-EKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           V N GA  +LE++    + T L+PFT  AV  V+L++ +I+ DP     
Sbjct: 119 VQNHGASDLLELQGEAIKGTALLPFTMAAVPTVDLEQGRIIADPPEGLF 167


>gi|261419400|ref|YP_003253082.1| 16S rRNA-processing protein RimM [Geobacillus sp. Y412MC61]
 gi|297530625|ref|YP_003671900.1| 16S rRNA processing protein RimM [Geobacillus sp. C56-T3]
 gi|319766215|ref|YP_004131716.1| 16S rRNA processing protein RimM [Geobacillus sp. Y412MC52]
 gi|261375857|gb|ACX78600.1| 16S rRNA processing protein RimM [Geobacillus sp. Y412MC61]
 gi|297253877|gb|ADI27323.1| 16S rRNA processing protein RimM [Geobacillus sp. C56-T3]
 gi|317111081|gb|ADU93573.1| 16S rRNA processing protein RimM [Geobacillus sp. Y412MC52]
          Length = 172

 Score =  148 bits (374), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 34/174 (19%), Positives = 66/174 (37%), Gaps = 9/174 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-------YVLYSNDNRELRILKMYRK 56
           +++   +  I  THG+ GEV + S  + P +  +       +     +  E+ +      
Sbjct: 1   MERWFNVGKIVNTHGIRGEVRVISRTDFPEERYKKGNKLYIFRERDTEPIEVTVKSHRVH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
               + +F G D+I+     +   L          EL E E++  ++         G+  
Sbjct: 61  KSFDLLSFEGYDSINDVERFKGAMLKVPESQL--GELAEGEYYFHEIIGCTVVTEGGETI 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           G V  +   GA  +  ++       LIP+    VL V+ +   I+I P+   L 
Sbjct: 119 GAVKEILTPGANDVWVVRREDGSEALIPYIDEVVLHVDPERKTIIIRPMEGLLE 172


>gi|315121878|ref|YP_004062367.1| 16S rRNA-processing protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495280|gb|ADR51879.1| 16S rRNA-processing protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 190

 Score =  148 bits (374), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 126/188 (67%), Positives = 158/188 (84%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRF 60
           MVK +KLVL+ATIGTTHGL GEVY++SYA+NP+DL+RY+LYS+D +E +IL +Y+ NKR 
Sbjct: 1   MVKSEKLVLIATIGTTHGLKGEVYVNSYASNPMDLSRYILYSDDAKEFKILDIYQNNKRL 60

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           IATF GI +IHSA +LR LKLYA+RQDFKDEELEEDEFFN DLEE+ETFD QGKYWG++C
Sbjct: 61  IATFDGIYDIHSAEKLRHLKLYARRQDFKDEELEEDEFFNADLEELETFDLQGKYWGKIC 120

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQYD 180
           G+Y+FGAG++LE K++ EK FLIPFTK  VL VNL+ENKILID ++AGL+  T K+  ++
Sbjct: 121 GIYDFGAGAVLEFKDSKEKKFLIPFTKSTVLSVNLKENKILIDSVSAGLDCMTKKDKNHE 180

Query: 181 CPLDSAGK 188
           C   S G 
Sbjct: 181 CQSSSPGD 188


>gi|90421747|ref|YP_530117.1| 16S rRNA-processing protein RimM [Rhodopseudomonas palustris
           BisB18]
 gi|109893042|sp|Q21CT8|RIMM_RHOPB RecName: Full=Ribosome maturation factor rimM
 gi|90103761|gb|ABD85798.1| 16S rRNA processing protein RimM [Rhodopseudomonas palustris
           BisB18]
          Length = 176

 Score =  148 bits (374), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 45/174 (25%), Positives = 77/174 (44%), Gaps = 4/174 (2%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS--NDNRELRILKMYRKNKRFIAT 63
             + +A IG  HG+ G V +  +  +P+ +  Y   S  +  R   +          +AT
Sbjct: 4   DKICVARIGAPHGVRGAVKLWPFTADPLAVLDYGPLSTKDGKRSFEVETAREAKGHLVAT 63

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
             G+ +   A  L  ++LY  R        EE E+++ DL  +   D  G   G+V  ++
Sbjct: 64  LQGVVSREDAERLNGVELYIDRAQLPPP--EEGEYYHADLIGLAAVDAAGAPIGKVLAIH 121

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNP 177
           NFGAG I+EI      T L+PFT   V  V++   +++I+  A    +   +  
Sbjct: 122 NFGAGDIIEIAPPSGPTLLLPFTNAVVPTVDIASGRVVIELPAEIEGDDPAQAD 175


>gi|302558141|ref|ZP_07310483.1| 16S rRNA processing protein RimM [Streptomyces griseoflavus Tu4000]
 gi|302475759|gb|EFL38852.1| 16S rRNA processing protein RimM [Streptomyces griseoflavus Tu4000]
          Length = 191

 Score =  148 bits (373), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 40/186 (21%), Positives = 82/186 (44%), Gaps = 5/186 (2%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPI-DLNRYVLYSNDN---RELRILKMYRKNKRFIAT 63
           +++A IG  HG+ GEV ++   + P   L    + + D      L I      + R +  
Sbjct: 3   LVVARIGRAHGIKGEVTVEVRTDEPELRLGPGAVLTTDPASAGPLTIETGRVHSGRLLLR 62

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F G+ + + A  LR+  L A     +  E +EDE+++  L +++   + G+  G++  + 
Sbjct: 63  FEGVRDRNGAEALRNTLLIADVDPDERPE-DEDEYYDHQLIDLDVVTKDGEEVGRITEIS 121

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQYDCPL 183
           +     +  ++        +PF +  V E++L+E + +IDP    +++        D   
Sbjct: 122 HLPTQDLFVVERPDGSEVYVPFVEEIVTEIDLEEQRAVIDPPPGLIDDRAETASARDAAE 181

Query: 184 DSAGKK 189
           D  G  
Sbjct: 182 DERGAA 187


>gi|294675923|ref|YP_003576538.1| 16S rRNA processing protein RimM [Rhodobacter capsulatus SB 1003]
 gi|294474743|gb|ADE84131.1| 16S rRNA processing protein RimM [Rhodobacter capsulatus SB 1003]
          Length = 169

 Score =  148 bits (373), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 49/170 (28%), Positives = 73/170 (42%), Gaps = 5/170 (2%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDN--RELRILKMYRKNKR 59
           +     V +  I    G+ GEV + S+   P D+  Y    +++  R   +         
Sbjct: 1   MSKTDRVCVGAIAGGFGVKGEVRLKSFCATPEDIAAYGPLYSEDGTRSFTVRLTRPVTGG 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
             A  SGI     A  L+   L+A R       L +DEF++ DL  +   D  G   G V
Sbjct: 61  LGARLSGIATKEEADALKGATLWADRDRLP--HLPDDEFYHADLIGLPVQDTGGALIGTV 118

Query: 120 CGVYNFGAGSILEIKNTMEK-TFLIPFTKFAVLEVNLQENKILIDPIAAG 168
             V +FGAG ILE+     K T ++PFT+  V  V+L   +I+ DP    
Sbjct: 119 RAVLDFGAGDILEVHVPGRKTTLMLPFTRAVVPTVDLTAGRIIADPPEEL 168


>gi|316931784|ref|YP_004106766.1| 16S rRNA processing protein RimM [Rhodopseudomonas palustris DX-1]
 gi|315599498|gb|ADU42033.1| 16S rRNA processing protein RimM [Rhodopseudomonas palustris DX-1]
          Length = 176

 Score =  148 bits (373), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 47/175 (26%), Positives = 78/175 (44%), Gaps = 5/175 (2%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY--SNDNRELRILKMYRKNKRFIATF 64
           L+ +A IG  HG+ G V + S+  +P  +N Y      +  R+  I          + T 
Sbjct: 5   LICVARIGAPHGVRGAVRLWSFTADPFAVNDYGPLVTKDGARQFEIASAREAKSHLVVTL 64

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
            G+     A  L  ++LY  R      E +E  +++ DL  +      G   G+V  ++N
Sbjct: 65  KGVTTRDEAERLNGVELYVARDKLPPTEADE--YYHADLIGLAAVTTAGDALGKVVAIHN 122

Query: 125 FGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQY 179
           FGAG I+EI      T L+PFT   V  V+L   +++I+     +   T  +P+ 
Sbjct: 123 FGAGDIIEIAPPSGPTLLLPFTNAVVPTVDLAAGQVVIELPNE-IEGDTPNHPEA 176


>gi|299133091|ref|ZP_07026286.1| 16S rRNA processing protein RimM [Afipia sp. 1NLS2]
 gi|298593228|gb|EFI53428.1| 16S rRNA processing protein RimM [Afipia sp. 1NLS2]
          Length = 180

 Score =  147 bits (372), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 44/182 (24%), Positives = 81/182 (44%), Gaps = 4/182 (2%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDN--RELRILKMYRKNK 58
           M K  + + +A IG  HG+ GEV +  +  + + +  Y   S  +  R+  + +      
Sbjct: 1   MAKAAQKICVAKIGAAHGVRGEVRLWPFTEDLLAVLHYGPLSTKDGARQFEVARARAAKD 60

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
             +AT  G+ +  +A  L  ++LY  R    +   ++ E+++ DL  +   D QG   G 
Sbjct: 61  HLVATLKGVADRDAAERLNGIELYISRDALPET--DDGEYYHADLIGLAAIDAQGASLGT 118

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQ 178
           V  ++NFGAG I+EI      + L+PFT   V  V+L    ++++       +       
Sbjct: 119 VTAIHNFGAGDIIEIAPKSGPSLLLPFTNAVVPTVDLAAGHVIVELPNEIEGDGPDSTDS 178

Query: 179 YD 180
             
Sbjct: 179 AP 180


>gi|228998618|ref|ZP_04158205.1| Ribosome maturation factor rimM [Bacillus mycoides Rock3-17]
 gi|228761086|gb|EEM10045.1| Ribosome maturation factor rimM [Bacillus mycoides Rock3-17]
          Length = 188

 Score =  147 bits (371), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 34/176 (19%), Positives = 74/176 (42%), Gaps = 9/176 (5%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-------YVLYSNDNRELRILKM 53
           M+ + K   +  I  THG+ GE+ + S  + P +  +       +     +   +++   
Sbjct: 15  MLFMTKWFNVGKIVNTHGVRGEIRVISRTDFPEERYKVGNTLYIWHDKGTEPLSVKVASH 74

Query: 54  YRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQG 113
            +     + TF G +N+    +L+   +    +     EL E E++  ++   +    +G
Sbjct: 75  RQHKTFDLLTFEGYNNVDEVEKLKGSSIKVPEEQL--GELAEGEYYYHEIIGCKVVTEEG 132

Query: 114 KYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           +  G +  + + GA  +  IK    +  LIP+    VL+VN++   + I  +   L
Sbjct: 133 EDLGTIKEILSPGANDVWVIKRPKGQDLLIPYIDDIVLQVNIENKLVTIHVMEGLL 188


>gi|306843366|ref|ZP_07475967.1| 16S rRNA processing protein RimM [Brucella sp. BO1]
 gi|306276057|gb|EFM57757.1| 16S rRNA processing protein RimM [Brucella sp. BO1]
          Length = 189

 Score =  147 bits (371), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 59/183 (32%), Positives = 99/183 (54%), Gaps = 1/183 (0%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND-NRELRILKMYRKNKR 59
           M + +  + +A IG  HG  GEV + ++  +P+ +  Y L  ++  +   IL+       
Sbjct: 1   MPRPENPIQLAVIGAAHGTRGEVRVKTFTGDPLAIADYGLLYDEQGKAYEILEARVAKTV 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F G+++ ++A  L   +L+  R    DEEL+EDEFF TDL  +E  D  GK +G V
Sbjct: 61  VIVRFKGVNDRNTAEALNGTELFIDRSQLPDEELDEDEFFQTDLIGLEAVDEDGKSYGVV 120

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQY 179
             +++FG G ++E+    ++  LIPFT+ AV E++  +  I ++P AAGL      NP +
Sbjct: 121 SAIFDFGGGDLIELSEKGKRPMLIPFTEAAVPEIDFDKGIIKVEPYAAGLIADEHDNPPH 180

Query: 180 DCP 182
           +  
Sbjct: 181 ESG 183


>gi|192288675|ref|YP_001989280.1| 16S rRNA-processing protein RimM [Rhodopseudomonas palustris TIE-1]
 gi|238692575|sp|B3Q855|RIMM_RHOPT RecName: Full=Ribosome maturation factor rimM
 gi|192282424|gb|ACE98804.1| 16S rRNA processing protein RimM [Rhodopseudomonas palustris TIE-1]
          Length = 176

 Score =  147 bits (371), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 46/175 (26%), Positives = 78/175 (44%), Gaps = 5/175 (2%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY--SNDNRELRILKMYRKNKRFIATF 64
           L+ +A IG  HG+ G V + S+  +P  ++ Y      +  R+  I          + T 
Sbjct: 5   LICVARIGAPHGVRGAVRLWSFTADPFAVSDYGPLVTKDGARQFEIASAREAKSHLVVTL 64

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
            G+     A  L  ++LY  R      E +E  +++ DL  +      G   G+V  ++N
Sbjct: 65  KGVATRDEAERLNGVELYVARDKLPPTEADE--YYHADLIGLAAVTTAGDALGKVVAIHN 122

Query: 125 FGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQY 179
           FGAG I+EI      T L+PFT   V  V+L   +++I+     +   T  +P+ 
Sbjct: 123 FGAGDIIEIAPPSGPTLLLPFTNAVVPTVDLAAGQVVIELPNE-IEGDTPNHPEA 176


>gi|228992570|ref|ZP_04152497.1| Ribosome maturation factor rimM [Bacillus pseudomycoides DSM 12442]
 gi|228767204|gb|EEM15840.1| Ribosome maturation factor rimM [Bacillus pseudomycoides DSM 12442]
          Length = 188

 Score =  147 bits (371), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 34/176 (19%), Positives = 74/176 (42%), Gaps = 9/176 (5%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-------YVLYSNDNRELRILKM 53
           M+ + K   +  I  THG+ GE+ + S  + P +  +       +     +   +++   
Sbjct: 15  MLFMTKWFNVGKIVNTHGVRGEIRVISRTDFPEERYKVGNTLYIWHDKGTEPLSVKVASH 74

Query: 54  YRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQG 113
            +     + TF G +N+    +L+   +    +     EL E E++  ++   +    +G
Sbjct: 75  RQHKTFDLLTFEGYNNVDEVEKLKGSSIKVPEEQL--GELAEGEYYYHEIIGCKVVTEEG 132

Query: 114 KYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           +  G +  + + GA  +  IK    +  LIP+    VL+VN++   + I  +   L
Sbjct: 133 EDLGTIKEILSPGANDVWVIKRPKGQDLLIPYIDDVVLQVNIENKLVTIHVMEGLL 188


>gi|229086395|ref|ZP_04218571.1| Ribosome maturation factor rimM [Bacillus cereus Rock3-44]
 gi|228696911|gb|EEL49720.1| Ribosome maturation factor rimM [Bacillus cereus Rock3-44]
          Length = 174

 Score =  147 bits (371), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 35/176 (19%), Positives = 70/176 (39%), Gaps = 9/176 (5%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-------YVLYSNDNRELRILKM 53
           M+ + K   +  I  THG+ GE+ + S  + P +  +       +     +   ++I   
Sbjct: 1   MLFMTKWFNVGKIVNTHGVRGEIRVISRTDFPEERYKVGNTLYIWSDKGTEPLPVKITSH 60

Query: 54  YRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQG 113
            +     + TF G  N+    + +   L    +     EL E E++  ++         G
Sbjct: 61  RQHKTFDLLTFEGYGNVDEVEKFKGSLLKVPEEQL--GELAEGEYYYHEIIGCNVVTEDG 118

Query: 114 KYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           +  G +  + + GA  +  IK    +  LIP+    VL+VN++   + I  +   L
Sbjct: 119 EALGTIKEILSPGANDVWVIKRPKGQDLLIPYIDDVVLQVNVENKLVTIHVMEGLL 174


>gi|163738187|ref|ZP_02145603.1| 16S rRNA processing protein RimM [Phaeobacter gallaeciensis BS107]
 gi|161388803|gb|EDQ13156.1| 16S rRNA processing protein RimM [Phaeobacter gallaeciensis BS107]
          Length = 167

 Score =  147 bits (371), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 50/169 (29%), Positives = 80/169 (47%), Gaps = 5/169 (2%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILK--MYRKNKRFI 61
           + + + +  I  ++G+ GEV + S+   P D+  Y   S ++         +      F 
Sbjct: 1   MTEQICVGAISGSYGVRGEVRLKSFCAMPEDIEDYSPLSTEDGSQTYTITLVRAIKNGFT 60

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
           A   GI+    A  L+ ++L+A R+      L +DE+++TDL  +E +D  G   G V  
Sbjct: 61  ARIGGIETKEQADALKGVRLFAPRERLP--NLPDDEYYHTDLMGLEVYDTGGTLLGSVKS 118

Query: 122 VYNFGAGSILEIK-NTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           V N GA  +LEI      KT L+PFT  AV  V+L   +I+ DP     
Sbjct: 119 VQNHGASDLLEIAIPAESKTVLLPFTLAAVPTVDLASGRIIADPPDGVF 167


>gi|115522357|ref|YP_779268.1| 16S rRNA-processing protein RimM [Rhodopseudomonas palustris
           BisA53]
 gi|122297959|sp|Q07UU6|RIMM_RHOP5 RecName: Full=Ribosome maturation factor rimM
 gi|115516304|gb|ABJ04288.1| 16S rRNA processing protein RimM [Rhodopseudomonas palustris
           BisA53]
          Length = 176

 Score =  146 bits (370), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 44/176 (25%), Positives = 84/176 (47%), Gaps = 5/176 (2%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS--NDNRELRILKMYRKNKRFIAT 63
           K + +A IG  HG+ G + +  +  +P+ +  Y   +  + +R   +          +AT
Sbjct: 4   KRICVARIGAPHGVRGALKLWPFTEDPLAVLDYGPLTTQDGSRRFEVETAREAKDHLVAT 63

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
             G+ +   A  L  ++LY  R    +   +E E+++ DL  +      G+  G+V  ++
Sbjct: 64  LKGVASRDDAVRLNGIELYIDRDQLPET--DEGEYYHADLIGLAAVTAAGEPLGKVAAIH 121

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQY 179
           NFGAG I+EI      T L+PFT   V  V+L+  +++I+ +   +   T  +P+ 
Sbjct: 122 NFGAGDIIEIAPPSGPTLLLPFTNAVVPTVDLEGGRVVIE-MPGEIEGDTPNHPEA 176


>gi|254472163|ref|ZP_05085563.1| 16S rRNA processing protein RimM [Pseudovibrio sp. JE062]
 gi|211958446|gb|EEA93646.1| 16S rRNA processing protein RimM [Pseudovibrio sp. JE062]
          Length = 185

 Score =  146 bits (370), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 50/182 (27%), Positives = 89/182 (48%), Gaps = 3/182 (1%)

Query: 3   KLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS--NDNRELRILKMYRKNKRF 60
           K +  +LMA IG  HG+ GEV +  + ++P+    Y      + +R+ ++ +   +    
Sbjct: 4   KPEDRILMAQIGAAHGIRGEVRVKPFGDDPLSFGDYGKLESEDGSRKFKVKRARVQKNVV 63

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +  F G+++ + A  L  LKLY  R+   + E +EDEF+++DL  ++  D   +  G V 
Sbjct: 64  VTKFEGVNDRNEAEALNGLKLYIPRERLPETE-DEDEFYHSDLIGLKALDENKEQIGTVL 122

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQYD 180
            + +FGAG ++EI     K+ L PFTK  V  +NL+E  + +            +     
Sbjct: 123 ALLDFGAGDLIEIAPKSGKSLLFPFTKAVVPVINLKEGFVEVHAPEGFYEEGEKEPEDGS 182

Query: 181 CP 182
            P
Sbjct: 183 EP 184


>gi|152976208|ref|YP_001375725.1| 16S rRNA-processing protein [Bacillus cereus subsp. cytotoxis NVH
           391-98]
 gi|189040125|sp|A7GRH2|RIMM_BACCN RecName: Full=Ribosome maturation factor rimM
 gi|152024960|gb|ABS22730.1| 16S rRNA processing protein RimM [Bacillus cytotoxicus NVH 391-98]
          Length = 171

 Score =  146 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 34/173 (19%), Positives = 72/173 (41%), Gaps = 9/173 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-------YVLYSNDNRELRILKMYRK 56
           + K   +  I  THG+ GEV + S  + P +  +       +     +   +++    + 
Sbjct: 1   MTKWFNVGKIVNTHGVRGEVRVISRTDFPEERYKVGNTLYIWGEKGTEPLPVKVTSHRQH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
               + TF G  N++   + +   L    +     EL E E++  ++   +     G+  
Sbjct: 61  KTFDLLTFEGYSNVNEVEKFKGSLLKVPEEQL--GELAEGEYYYHEVIGCKVVTENGEEL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           G +  + + GA  +  IK    +  LIP+    VL+VN+++ ++ I  +   L
Sbjct: 119 GTITEILSPGANDVWVIKRPKGQDLLIPYIDDIVLQVNVEQKQVTIHVMEGLL 171


>gi|121533793|ref|ZP_01665620.1| 16S rRNA processing protein RimM [Thermosinus carboxydivorans Nor1]
 gi|121307784|gb|EAX48699.1| 16S rRNA processing protein RimM [Thermosinus carboxydivorans Nor1]
          Length = 303

 Score =  146 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 36/165 (21%), Positives = 73/165 (44%), Gaps = 4/165 (2%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVL-YSNDNRELRILKMYRKNKRFIAT 63
           + LV +  I   HG+ G+V I    + P    +    Y +D   L +    +  +  +  
Sbjct: 141 EDLVAIGKIVAPHGVRGDVRIIPLTDFPERFQQLKTAYFDDGTRLSVESARQHKQFILLK 200

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F G+ + ++   LR   +   R+D     L E  ++  ++  ++ +D  G Y G+V  V 
Sbjct: 201 FKGLQDRNAVENLRGKLVKVPRKDL--VPLPEGHYYIFEIIGLKVYDIDGAYLGKVTDVM 258

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAG 168
             G+  +  +++   +  LIP  K  V E++L + +++I P    
Sbjct: 259 QTGSNDVYVVEDCD-RPLLIPAIKEVVKEIDLAQGRMVIKPQEEW 302


>gi|255262386|ref|ZP_05341728.1| 16S rRNA processing protein RimM [Thalassiobium sp. R2A62]
 gi|255104721|gb|EET47395.1| 16S rRNA processing protein RimM [Thalassiobium sp. R2A62]
          Length = 168

 Score =  146 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 48/170 (28%), Positives = 76/170 (44%), Gaps = 5/170 (2%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRI--LKMYRKNKRFI 61
           +   + + T+G + G+ GEV + S+  +P D+  Y   +  +           R    F 
Sbjct: 1   MSDKITIGTLGGSFGVKGEVRLKSFCADPQDIEAYSPLTTPDGVAFDGLTLTGRLKNGFS 60

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
           A   G++    A  LR  +L   R       L +DE++ TDL  +E  D  G   G V  
Sbjct: 61  ARLLGVETKEQADALRGTELQVDRDAMP--NLPDDEYYYTDLMGLEVRDTGGTVLGTVKS 118

Query: 122 VYNFGAGSILEIKN-TMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           V N GA  +LE+   T  +T L+PFT  +V  V+L   +I+ DP     +
Sbjct: 119 VQNHGATDLLEVLPSTGGETILLPFTMTSVPTVDLTAGRIIADPPDGLFD 168


>gi|209883426|ref|YP_002287283.1| 16S rRNA processing protein RimM [Oligotropha carboxidovorans OM5]
 gi|209871622|gb|ACI91418.1| 16S rRNA processing protein RimM [Oligotropha carboxidovorans OM5]
          Length = 174

 Score =  146 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 47/170 (27%), Positives = 79/170 (46%), Gaps = 4/170 (2%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS--NDNRELRILKMYRKNKRFIATFS 65
           + +A IG  HG+ GEV +  +  +P+ +  Y   S  +  ++  +L+        +AT  
Sbjct: 7   ICVAKIGAAHGVRGEVRLWPFTEDPLAVLHYGPLSTRDGAKQFTVLRARAAKDHLVATLD 66

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNF 125
           G+ N   A  L  ++LY  R    D   +E E+++ DL  +   D QGK  G +  ++NF
Sbjct: 67  GVANRDDAERLNGIELYVSRDALPDT--DEGEYYHADLIGLAAVDPQGKSIGTIIAIHNF 124

Query: 126 GAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMK 175
           GAG I+EI      T L+PFT   V  ++L    ++I+            
Sbjct: 125 GAGDIIEIAPNNGPTLLLPFTNAVVPTIDLAAGHVVIELPGEIEGEDEPS 174


>gi|317152479|ref|YP_004120527.1| 16S rRNA processing protein RimM [Desulfovibrio aespoeensis Aspo-2]
 gi|316942730|gb|ADU61781.1| 16S rRNA processing protein RimM [Desulfovibrio aespoeensis Aspo-2]
          Length = 199

 Score =  146 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 42/194 (21%), Positives = 69/194 (35%), Gaps = 7/194 (3%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDL---NRYVLYSNDNRELRI--LKMYRK 56
           +    L+L+  +   HG+ GE+ I S+A++P          L       +          
Sbjct: 1   MGQTGLILVGGVVRPHGIRGEICIKSHADSPSLFGLVAALYLQDKGKPPIPHAVRSWREH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
               + T  G+D+   A  LR  ++  +  D  +  L+E E +   L         G   
Sbjct: 61  KGMVLLTLDGVDDRDKAEALRGREVLVREADLPE--LDEGEHYLYQLMGCRVTLADGTDV 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKN 176
           G +   +  G      I N      ++P     VL+V+L    I+IDP A  L+      
Sbjct: 119 GVLEHFFETGEQDTWVIINEAGTEIMLPAVPEFVLDVDLDAGVIVIDPPAGLLDLYLNPE 178

Query: 177 PQYDCPLDSAGKKS 190
           P    P      KS
Sbjct: 179 PPRAKPARPERAKS 192


>gi|298292732|ref|YP_003694671.1| 16S rRNA processing protein RimM [Starkeya novella DSM 506]
 gi|296929243|gb|ADH90052.1| 16S rRNA processing protein RimM [Starkeya novella DSM 506]
          Length = 180

 Score =  146 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 50/182 (27%), Positives = 93/182 (51%), Gaps = 8/182 (4%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND--NRELRILKMYRKNKRFIA 62
           +  +L+A IG  HG+ GEV +  +A++P  L RY   +++   R  ++  +      F+A
Sbjct: 3   NDRILLARIGAPHGVRGEVRLFVFADDPDSLKRYKPLTDEAGKRVFKVKALRPAKDHFVA 62

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
              G+D   +A  L +  L+  R    + E +ED+F++ DL  +     +G  +G++  V
Sbjct: 63  RIEGVDTREAAEALTNQGLHVSRDLLPEPE-DEDDFYHADLIGLAAVTTEGAPFGKIVAV 121

Query: 123 YNFGAGSILEIKNT-MEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQYDC 181
           ++FGAG I+E+      KT ++PFTK  V  V+++  ++++DP          + P  D 
Sbjct: 122 HDFGAGDIIEVAPEGGGKTLMLPFTKAVVPTVDIKGGRVVVDPAE----WAREEAPPPDA 177

Query: 182 PL 183
             
Sbjct: 178 DQ 179


>gi|114771309|ref|ZP_01448729.1| 16S rRNA processing protein RimM [alpha proteobacterium HTCC2255]
 gi|114548234|gb|EAU51121.1| 16S rRNA processing protein RimM [alpha proteobacterium HTCC2255]
          Length = 189

 Score =  146 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 52/191 (27%), Positives = 93/191 (48%), Gaps = 5/191 (2%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND--NRELRILKMYRKNKR 59
           + + + V +  +    G++GE+ + S+ ++P  +  Y   +++   +  ++  +      
Sbjct: 1   MTIPERVCVGAVVGAFGIHGEIRVKSFCSDPESIAEYDQLTDETGKKVFKLKIINPIKGG 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
           F A  SG+     A EL+ + LY  R +     L++DEF+ +DL  +E FD  G   G+V
Sbjct: 61  FSARISGVKYRDQAEELKGIALYVCRSEMP--NLDDDEFYYSDLINLEVFDTGGIKIGKV 118

Query: 120 CGVYNFGAGSILEIKNTMEKTF-LIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQ 178
             V + GAG  LEIK   +K   L+PFTK +V  ++L+  +I+IDP      N   + P 
Sbjct: 119 ISVNDHGAGDFLEIKAYGQKNLALLPFTKKSVPTIDLKLGRIIIDPPHGVFENNEPEEPP 178

Query: 179 YDCPLDSAGKK 189
                   G +
Sbjct: 179 SPRNHLELGDE 189


>gi|254449413|ref|ZP_05062850.1| 16S rRNA processing protein RimM [Octadecabacter antarcticus 238]
 gi|198263819|gb|EDY88089.1| 16S rRNA processing protein RimM [Octadecabacter antarcticus 238]
          Length = 183

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 56/185 (30%), Positives = 90/185 (48%), Gaps = 7/185 (3%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSN-DNRELRILKMYRK-NK 58
           M   D  +++ T+  + G+NG+V + S+  +P  L  Y   +  D  E+  + +  +   
Sbjct: 1   MPMSDDRIVVGTLAGSFGVNGDVRLKSFCADPEALADYTPLTRADGSEITTIVIKGQTKG 60

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
             IA   GI     A  LR ++LYA+R       L +DE+++ DL  + T+D  G   G+
Sbjct: 61  SLIARVDGITTKEEADGLRGMELYARRDQLPS--LPDDEYYHADLVGLMTYDTGGAKLGR 118

Query: 119 VCGVYNFGAGSILEIKNTMEK-TFLIPFTKFAVLEVNLQENKILIDPIAAGLNN--TTMK 175
           V  V   GA  +LEI +  +K T L+PFTK  V  V+L   +I++DP      +   T  
Sbjct: 119 VKAVQTNGADDLLEIISPSDKDTVLVPFTKVIVPTVDLASGRIVLDPPRGLFADEADTQD 178

Query: 176 NPQYD 180
            P  D
Sbjct: 179 TPAAD 183


>gi|323489561|ref|ZP_08094788.1| 16S rRNA-processing protein [Planococcus donghaensis MPA1U2]
 gi|323396692|gb|EGA89511.1| 16S rRNA-processing protein [Planococcus donghaensis MPA1U2]
          Length = 171

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 41/171 (23%), Positives = 80/171 (46%), Gaps = 9/171 (5%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLN----RYVLYSNDNRELRILKM---YRKNK 58
           +   +  I  THG+ GEV + S  + P +      +  L++ D ++  ++K+    +   
Sbjct: 2   QWFNVGKIVNTHGIRGEVRVLSRTDFPEERFAVGTKLGLFTPDAKKPIMVKIASHRQHKN 61

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
             + TF G  NI+     ++  L     D    ELEE+ F++ ++     +  +G+  G+
Sbjct: 62  FELLTFEGYPNINDVEPFKESYLRIAEHDL--TELEENAFYHHEILGCAVYSTEGQELGK 119

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           +  +   GA  + E+     K   IP+T+  V EV++ E K++I+ I   L
Sbjct: 120 ITEILETGANDVWEVTPEKGKKHYIPYTEEIVKEVDIDEKKVIIEVIEGLL 170


>gi|332976616|gb|EGK13457.1| 16S rRNA processing protein RimM [Desmospora sp. 8437]
          Length = 173

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 34/174 (19%), Positives = 67/174 (38%), Gaps = 9/174 (5%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-------YVLYSNDNRELRILKMY 54
           ++   L+ +  I  THG+ GEV + S  + P                  + R + +++  
Sbjct: 1   MQEPDLLTVGRIAGTHGIRGEVRVHSRTDYPELRFAPGTQLLLVHPSLEEGRPITVVRAR 60

Query: 55  RKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGK 114
                ++  F    NI+ A   +   L   R++    E EED F+  ++        +G+
Sbjct: 61  PHKDFWLVQFEEWTNINQAEPFKGGLLRVSREE--AVEPEEDAFYLHEIVGARVVTTEGE 118

Query: 115 YWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAG 168
             G +  +   GA  +  I+       LIPF    V +V+    +++I  +   
Sbjct: 119 PVGVITEILQPGANDVWVIRKDGGGEVLIPFIDDVVRKVDPSAKQVIIRWMEGL 172


>gi|310814611|ref|YP_003962575.1| putative 16S rRNA processing protein [Ketogulonicigenium vulgare
           Y25]
 gi|308753346|gb|ADO41275.1| putative 16S rRNA processing protein [Ketogulonicigenium vulgare
           Y25]
          Length = 168

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 49/170 (28%), Positives = 82/170 (48%), Gaps = 5/170 (2%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMY--RKNKRFI 61
           +   +++  I  + G+ G++ + S+   P D+  Y     D+  +  + +   + N   +
Sbjct: 1   MSDRIVLGQIAGSFGVRGDLRLKSFCAIPEDIAIYTPLYTDDGRVFRVVVITGQTNGALV 60

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
           A   GI +   A  LR   L A R       L +DEF+++DL ++E  D  G   G+V  
Sbjct: 61  ARIEGISSKEEADALRGQNLSADRDRLP--NLPDDEFYHSDLIDLEVLDTGGAILGRVKT 118

Query: 122 VYNFGAGSILEIKNTME-KTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           V N GAG ILE++ T +  T L+PFT   V  V+L+  +I+ DP      
Sbjct: 119 VLNHGAGDILEVQLTGKPATALLPFTLAIVPTVDLKAGRIIADPPEGLFE 168


>gi|163744763|ref|ZP_02152123.1| 16S rRNA processing protein RimM [Oceanibulbus indolifex HEL-45]
 gi|161381581|gb|EDQ05990.1| 16S rRNA processing protein RimM [Oceanibulbus indolifex HEL-45]
          Length = 175

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 53/177 (29%), Positives = 82/177 (46%), Gaps = 6/177 (3%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDN--RELRILKMYRKNK 58
           M     L+ +  I   +G+ GEV + SY   P D+  Y     ++  R   +  +++   
Sbjct: 1   MSDQ-DLICVGAIAGAYGVRGEVRVKSYCAAPEDIETYRPLYTEDGSRTFNLALLHQVKN 59

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
            F A  + I     A E+R L L+A R       L +DEF++ DL  +E +D  G   G+
Sbjct: 60  GFAARIAEITTKEEADEMRGLSLFAARDQLPS--LPDDEFYHADLIGLEVYDTGGTLLGR 117

Query: 119 VCGVYNFGAGSILEIKNTM-EKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTM 174
           V  V N GA  +LE++      T  +PFTK AV  V+L   +I+ DP    L +   
Sbjct: 118 VKTVQNHGADDLLELQLKGTSATTFLPFTKAAVPTVDLASGRIVADPPHGVLPDAAD 174


>gi|255281045|ref|ZP_05345600.1| 16S rRNA processing protein RimM [Bryantella formatexigens DSM
           14469]
 gi|255268493|gb|EET61698.1| 16S rRNA processing protein RimM [Bryantella formatexigens DSM
           14469]
          Length = 168

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 42/170 (24%), Positives = 77/170 (45%), Gaps = 6/170 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR----YVLYSNDNRELRILKMYRKNKR 59
           +++ + +  + +THG+ GEV +    ++     +    +    + N  L I ++      
Sbjct: 1   MEQYLQVGVVSSTHGIRGEVKVYPTTDDAARFKKLKEVFAETKHGNVPLAIEQVKFFKNM 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F GIDNI+   + R   L   R++    +L   E+F  DL  +      G+  G +
Sbjct: 61  VILKFKGIDNINDVEKYRGCPLLVTREN--AVKLAPGEYFLCDLIGLSVSTDTGEELGTL 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
             V   GA  +  +K   EK  LIP TK  ++EV+L++N + +  +   L
Sbjct: 119 TEVIRTGANDVYVVKTKNEKEVLIPNTKECIIEVSLEKNTMTVHLLEGLL 168


>gi|39933320|ref|NP_945596.1| 16S rRNA-processing protein RimM [Rhodopseudomonas palustris
           CGA009]
 gi|59798745|sp|Q6ND66|RIMM_RHOPA RecName: Full=Ribosome maturation factor rimM
 gi|39652945|emb|CAE25687.1| putative 16S rRNA processing protein [Rhodopseudomonas palustris
           CGA009]
          Length = 176

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 47/175 (26%), Positives = 79/175 (45%), Gaps = 5/175 (2%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY--SNDNRELRILKMYRKNKRFIATF 64
           L+ +A IG  HG+ G V + S+  +P  ++ Y      +  R+  I          + T 
Sbjct: 5   LICVARIGAPHGVRGAVRLWSFTADPFAVSDYGPLVTKDGARQFEIASAREAKSHLVVTL 64

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
            G+     A  L  ++LY  R      E +E  +++ DL  +      G   G+V  ++N
Sbjct: 65  KGVTTRDEAERLNGVELYVARDKLPPTEADE--YYHADLIGLAAVTTTGDPLGKVVAIHN 122

Query: 125 FGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQY 179
           FGAG I+EI      T L+PFT   V  V+L   +++I+P    +   T  +P+ 
Sbjct: 123 FGAGDIIEIAPPSGPTLLLPFTNAVVPTVDLAVGQVVIEPPNE-IEGDTPNHPEA 176


>gi|17986432|ref|NP_539066.1| 16S rRNA-processing protein RimM [Brucella melitensis bv. 1 str.
           16M]
 gi|23502765|ref|NP_698892.1| 16S rRNA-processing protein RimM [Brucella suis 1330]
 gi|62290769|ref|YP_222562.1| 16S rRNA-processing protein RimM [Brucella abortus bv. 1 str.
           9-941]
 gi|82700681|ref|YP_415255.1| 16S rRNA-processing protein RimM [Brucella melitensis biovar
           Abortus 2308]
 gi|148559613|ref|YP_001259739.1| 16S rRNA-processing protein RimM [Brucella ovis ATCC 25840]
 gi|161619833|ref|YP_001593720.1| 16S rRNA-processing protein [Brucella canis ATCC 23365]
 gi|163843938|ref|YP_001628342.1| 16S rRNA-processing protein [Brucella suis ATCC 23445]
 gi|189024984|ref|YP_001935752.1| 16S rRNA-processing protein RimM [Brucella abortus S19]
 gi|225628114|ref|ZP_03786149.1| 16S rRNA processing protein RimM [Brucella ceti str. Cudo]
 gi|225853352|ref|YP_002733585.1| 16S rRNA-processing protein RimM [Brucella melitensis ATCC 23457]
 gi|237816276|ref|ZP_04595269.1| 16S rRNA processing protein RimM [Brucella abortus str. 2308 A]
 gi|254690059|ref|ZP_05153313.1| 16S rRNA-processing protein RimM [Brucella abortus bv. 6 str. 870]
 gi|254694547|ref|ZP_05156375.1| 16S rRNA-processing protein RimM [Brucella abortus bv. 3 str.
           Tulya]
 gi|254696172|ref|ZP_05158000.1| 16S rRNA-processing protein RimM [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254700559|ref|ZP_05162387.1| 16S rRNA-processing protein RimM [Brucella suis bv. 5 str. 513]
 gi|254704929|ref|ZP_05166757.1| 16S rRNA-processing protein RimM [Brucella suis bv. 3 str. 686]
 gi|254707557|ref|ZP_05169385.1| 16S rRNA-processing protein RimM [Brucella pinnipedialis
           M163/99/10]
 gi|254708906|ref|ZP_05170717.1| 16S rRNA-processing protein RimM [Brucella pinnipedialis B2/94]
 gi|254713667|ref|ZP_05175478.1| 16S rRNA-processing protein RimM [Brucella ceti M644/93/1]
 gi|254715979|ref|ZP_05177790.1| 16S rRNA-processing protein RimM [Brucella ceti M13/05/1]
 gi|254731090|ref|ZP_05189668.1| 16S rRNA-processing protein RimM [Brucella abortus bv. 4 str. 292]
 gi|256030432|ref|ZP_05444046.1| 16S rRNA-processing protein RimM [Brucella pinnipedialis M292/94/1]
 gi|256045522|ref|ZP_05448405.1| 16S rRNA-processing protein RimM [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256059891|ref|ZP_05450078.1| 16S rRNA-processing protein RimM [Brucella neotomae 5K33]
 gi|256112249|ref|ZP_05453170.1| 16S rRNA-processing protein RimM [Brucella melitensis bv. 3 str.
           Ether]
 gi|256258312|ref|ZP_05463848.1| 16S rRNA-processing protein RimM [Brucella abortus bv. 9 str. C68]
 gi|256263162|ref|ZP_05465694.1| ribosome maturation factor rimM [Brucella melitensis bv. 2 str.
           63/9]
 gi|256370317|ref|YP_003107828.1| 16S rRNA-processing protein [Brucella microti CCM 4915]
 gi|260169342|ref|ZP_05756153.1| 16S rRNA-processing protein RimM [Brucella sp. F5/99]
 gi|260546036|ref|ZP_05821776.1| ribosome maturation factor rimM [Brucella abortus NCTC 8038]
 gi|260562832|ref|ZP_05833318.1| ribosome maturation factor rimM [Brucella melitensis bv. 1 str.
           16M]
 gi|260567596|ref|ZP_05838066.1| ribosome maturation factor rimM [Brucella suis bv. 4 str. 40]
 gi|260755594|ref|ZP_05867942.1| ribosome maturation factor rimM [Brucella abortus bv. 6 str. 870]
 gi|260758820|ref|ZP_05871168.1| ribosome maturation factor rimM [Brucella abortus bv. 4 str. 292]
 gi|260760544|ref|ZP_05872887.1| ribosome maturation factor rimM [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260884620|ref|ZP_05896234.1| ribosome maturation factor rimM [Brucella abortus bv. 9 str. C68]
 gi|261214867|ref|ZP_05929148.1| ribosome maturation factor rimM [Brucella abortus bv. 3 str. Tulya]
 gi|261217744|ref|ZP_05932025.1| ribosome maturation factor rimM [Brucella ceti M13/05/1]
 gi|261315041|ref|ZP_05954238.1| ribosome maturation factor rimM [Brucella pinnipedialis M163/99/10]
 gi|261316402|ref|ZP_05955599.1| ribosome maturation factor rimM [Brucella pinnipedialis B2/94]
 gi|261321408|ref|ZP_05960605.1| ribosome maturation factor rimM [Brucella ceti M644/93/1]
 gi|261323862|ref|ZP_05963059.1| ribosome maturation factor rimM [Brucella neotomae 5K33]
 gi|261751063|ref|ZP_05994772.1| ribosome maturation factor rimM [Brucella suis bv. 5 str. 513]
 gi|261755625|ref|ZP_05999334.1| ribosome maturation factor rimM [Brucella suis bv. 3 str. 686]
 gi|261758858|ref|ZP_06002567.1| ribosome maturation factor rimM [Brucella sp. F5/99]
 gi|265987474|ref|ZP_06100031.1| ribosome maturation factor rimM [Brucella pinnipedialis M292/94/1]
 gi|265991946|ref|ZP_06104503.1| ribosome maturation factor rimM [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265993678|ref|ZP_06106235.1| ribosome maturation factor rimM [Brucella melitensis bv. 3 str.
           Ether]
 gi|294851156|ref|ZP_06791829.1| 16S rRNA processing protein RimM [Brucella sp. NVSL 07-0026]
 gi|297247157|ref|ZP_06930875.1| 16S rRNA processing protein RimM [Brucella abortus bv. 5 str.
           B3196]
 gi|54039057|sp|P66652|RIMM_BRUSU RecName: Full=Ribosome maturation factor rimM
 gi|54041927|sp|P66651|RIMM_BRUME RecName: Full=Ribosome maturation factor rimM
 gi|75496198|sp|Q57AY3|RIMM_BRUAB RecName: Full=Ribosome maturation factor rimM
 gi|109893002|sp|Q2YLT0|RIMM_BRUA2 RecName: Full=Ribosome maturation factor rimM
 gi|166226428|sp|A5VSP2|RIMM_BRUO2 RecName: Full=Ribosome maturation factor rimM
 gi|189040127|sp|A9M8Q1|RIMM_BRUC2 RecName: Full=Ribosome maturation factor rimM
 gi|189040128|sp|B0CIR9|RIMM_BRUSI RecName: Full=Ribosome maturation factor rimM
 gi|238689405|sp|B2S869|RIMM_BRUA1 RecName: Full=Ribosome maturation factor rimM
 gi|254797745|sp|C0RFF9|RIMM_BRUMB RecName: Full=Ribosome maturation factor rimM
 gi|17982028|gb|AAL51330.1| 16S ribosomal RNA processing protein rimm [Brucella melitensis bv.
           1 str. 16M]
 gi|23348784|gb|AAN30807.1| 16S rRNA processing protein RimM [Brucella suis 1330]
 gi|62196901|gb|AAX75201.1| RimM, 16S rRNA processing protein [Brucella abortus bv. 1 str.
           9-941]
 gi|82616782|emb|CAJ11871.1| ATP/GTP-binding site motif A (P-loop):RimM protein [Brucella
           melitensis biovar Abortus 2308]
 gi|148370870|gb|ABQ60849.1| 16S rRNA processing protein RimM [Brucella ovis ATCC 25840]
 gi|161336644|gb|ABX62949.1| 16S rRNA processing protein RimM [Brucella canis ATCC 23365]
 gi|163674661|gb|ABY38772.1| 16S rRNA processing protein RimM [Brucella suis ATCC 23445]
 gi|189020556|gb|ACD73278.1| RimM protein [Brucella abortus S19]
 gi|225616939|gb|EEH13986.1| 16S rRNA processing protein RimM [Brucella ceti str. Cudo]
 gi|225641717|gb|ACO01631.1| 16S rRNA processing protein RimM [Brucella melitensis ATCC 23457]
 gi|237788343|gb|EEP62558.1| 16S rRNA processing protein RimM [Brucella abortus str. 2308 A]
 gi|256000480|gb|ACU48879.1| 16S rRNA-processing protein [Brucella microti CCM 4915]
 gi|260096143|gb|EEW80019.1| ribosome maturation factor rimM [Brucella abortus NCTC 8038]
 gi|260152848|gb|EEW87940.1| ribosome maturation factor rimM [Brucella melitensis bv. 1 str.
           16M]
 gi|260157114|gb|EEW92194.1| ribosome maturation factor rimM [Brucella suis bv. 4 str. 40]
 gi|260669138|gb|EEX56078.1| ribosome maturation factor rimM [Brucella abortus bv. 4 str. 292]
 gi|260670976|gb|EEX57797.1| ribosome maturation factor rimM [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260675702|gb|EEX62523.1| ribosome maturation factor rimM [Brucella abortus bv. 6 str. 870]
 gi|260874148|gb|EEX81217.1| ribosome maturation factor rimM [Brucella abortus bv. 9 str. C68]
 gi|260916474|gb|EEX83335.1| ribosome maturation factor rimM [Brucella abortus bv. 3 str. Tulya]
 gi|260922833|gb|EEX89401.1| ribosome maturation factor rimM [Brucella ceti M13/05/1]
 gi|261294098|gb|EEX97594.1| ribosome maturation factor rimM [Brucella ceti M644/93/1]
 gi|261295625|gb|EEX99121.1| ribosome maturation factor rimM [Brucella pinnipedialis B2/94]
 gi|261299842|gb|EEY03339.1| ribosome maturation factor rimM [Brucella neotomae 5K33]
 gi|261304067|gb|EEY07564.1| ribosome maturation factor rimM [Brucella pinnipedialis M163/99/10]
 gi|261738842|gb|EEY26838.1| ribosome maturation factor rimM [Brucella sp. F5/99]
 gi|261740816|gb|EEY28742.1| ribosome maturation factor rimM [Brucella suis bv. 5 str. 513]
 gi|261745378|gb|EEY33304.1| ribosome maturation factor rimM [Brucella suis bv. 3 str. 686]
 gi|262764659|gb|EEZ10580.1| ribosome maturation factor rimM [Brucella melitensis bv. 3 str.
           Ether]
 gi|263003012|gb|EEZ15305.1| ribosome maturation factor rimM [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263093067|gb|EEZ17217.1| ribosome maturation factor rimM [Brucella melitensis bv. 2 str.
           63/9]
 gi|264659671|gb|EEZ29932.1| ribosome maturation factor rimM [Brucella pinnipedialis M292/94/1]
 gi|294819745|gb|EFG36744.1| 16S rRNA processing protein RimM [Brucella sp. NVSL 07-0026]
 gi|297174326|gb|EFH33673.1| 16S rRNA processing protein RimM [Brucella abortus bv. 5 str.
           B3196]
 gi|326409917|gb|ADZ66982.1| RimM protein [Brucella melitensis M28]
 gi|326539630|gb|ADZ87845.1| 16S rRNA processing protein RimM [Brucella melitensis M5-90]
          Length = 189

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 59/183 (32%), Positives = 99/183 (54%), Gaps = 1/183 (0%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND-NRELRILKMYRKNKR 59
           M + +  + +A IG  HG  GEV + ++  +P+ +  Y L  ++  +   IL+       
Sbjct: 1   MPRPENPIQLAVIGAAHGTRGEVRVKTFTGDPLAIADYGLLYDEQGKAYEILEARVAKTV 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F G+++ ++A  L   +L+  R    DEEL+EDEFF TDL  +E  D  GK +G V
Sbjct: 61  VIVRFKGVNDRNAAEALNGTELFIDRSQLPDEELDEDEFFQTDLIGLEAVDGDGKSYGVV 120

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQY 179
             +++FG G ++E+    ++  LIPFT+ AV E++  +  I ++P AAGL      NP +
Sbjct: 121 SAIFDFGGGDLIELSEKGKRPMLIPFTEAAVPEIDFDKGIIKVEPHAAGLIADEHDNPPH 180

Query: 180 DCP 182
           +  
Sbjct: 181 ESG 183


>gi|258511337|ref|YP_003184771.1| 16S rRNA processing protein RimM [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
 gi|257478063|gb|ACV58382.1| 16S rRNA processing protein RimM [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
          Length = 177

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 31/179 (17%), Positives = 64/179 (35%), Gaps = 9/179 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLN----RYVLYSNDNR---ELRILKMYRK 56
           +     +  +   HGL GEV +    + P +      R  L    +    EL +    + 
Sbjct: 1   MTAYYTVGVVTKPHGLRGEVRVYPRTDFPEERFSPGSRLWLRPPGSEPVAELEVRSGRQH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
              +I  F G   I      R  +L           L E  ++   L  +E    +G+  
Sbjct: 61  QNLWIVGFKGYHAISDVESWRGYELCVPEDML--HPLPEGAYYYHQLVGLEVISDEGEPL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMK 175
           G +  V+  GA  +  ++   +   L+P  +  +L V+L+  ++ +  +    +    +
Sbjct: 119 GVLAEVWTPGANDVYVVRKPGQPDLLLPAIRDVILSVDLEARRMTVHLLPGLRDGEEDE 177


>gi|138894721|ref|YP_001125174.1| 16S rRNA-processing protein RimM [Geobacillus thermodenitrificans
           NG80-2]
 gi|166226443|sp|A4IM75|RIMM_GEOTN RecName: Full=Ribosome maturation factor rimM
 gi|134266234|gb|ABO66429.1| 16S rRNA processing protein RimM [Geobacillus thermodenitrificans
           NG80-2]
          Length = 175

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 34/177 (19%), Positives = 69/177 (38%), Gaps = 9/177 (5%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-------YVLYSNDNRELRILKM 53
           M  +++   +  I  THG+ GEV + S  + P +  +       +     +  E+ +   
Sbjct: 1   MKVMERWFNVGKIVNTHGIRGEVRVISRTDFPEERYKKGNKLYIFRECDTEPIEVTVKSH 60

Query: 54  YRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQG 113
                  + +F G D+I+     +   L          EL E E++  ++ +       G
Sbjct: 61  RVHKSFDLLSFEGYDSINDVEPFKGAMLKVPESQL--GELNEGEYYFHEIIDCTVVTEAG 118

Query: 114 KYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           +  G+V  +   GA  +  ++       LIP+    V+ V+ +   I+I P+   L 
Sbjct: 119 ETIGKVKEILTPGANDVWVVRRQDGTDALIPYIDDVVMHVDPERKIIIIRPMEGLLE 175


>gi|254717977|ref|ZP_05179788.1| 16S rRNA-processing protein RimM [Brucella sp. 83/13]
 gi|265982920|ref|ZP_06095655.1| ribosome maturation factor rimM [Brucella sp. 83/13]
 gi|306838930|ref|ZP_07471757.1| 16S rRNA processing protein RimM [Brucella sp. NF 2653]
 gi|306842935|ref|ZP_07475569.1| 16S rRNA processing protein RimM [Brucella sp. BO2]
 gi|264661512|gb|EEZ31773.1| ribosome maturation factor rimM [Brucella sp. 83/13]
 gi|306286863|gb|EFM58388.1| 16S rRNA processing protein RimM [Brucella sp. BO2]
 gi|306406000|gb|EFM62252.1| 16S rRNA processing protein RimM [Brucella sp. NF 2653]
          Length = 189

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 58/183 (31%), Positives = 98/183 (53%), Gaps = 1/183 (0%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND-NRELRILKMYRKNKR 59
           M + +  + +A IG  HG  GEV + ++  +P+ +  Y L  ++  +   IL+       
Sbjct: 1   MPRPENPIQLAVIGAAHGTRGEVRVKTFTGDPLAIADYGLLYDEQGKAYEILEARVAKTV 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F G+++ ++A  L   +L+  R    DEEL+EDEFF TDL  +E  D  GK +G V
Sbjct: 61  VIVRFKGVNDRNAAEALNGTELFIDRSQLPDEELDEDEFFQTDLIGLEAVDGDGKSYGVV 120

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQY 179
             +++FG G ++E+    ++  LIPFT+ AV E++  +  I ++P AAGL       P +
Sbjct: 121 SAIFDFGGGDLIELSEKGKRPMLIPFTEAAVPEIDFDKGIIKVEPHAAGLIADEHDTPPH 180

Query: 180 DCP 182
           +  
Sbjct: 181 ESG 183


>gi|86146311|ref|ZP_01064635.1| 16S rRNA-processing protein [Vibrio sp. MED222]
 gi|218710518|ref|YP_002418139.1| 16S rRNA-processing protein RimM [Vibrio splendidus LGP32]
 gi|254797771|sp|B7VK28|RIMM_VIBSL RecName: Full=Ribosome maturation factor rimM
 gi|85835790|gb|EAQ53924.1| 16S rRNA-processing protein [Vibrio sp. MED222]
 gi|218323537|emb|CAV19735.1| 16S rRNA processing protein RimM [Vibrio splendidus LGP32]
          Length = 184

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 37/177 (20%), Positives = 81/177 (45%), Gaps = 12/177 (6%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRK 56
           M + ++ ++M  +G+T+G+ G + + SY +N   +  Y  +      +  E ++    R 
Sbjct: 9   MSEQNERIVMGKLGSTYGIRGWLKVFSYTDNAESIFDYSPWYLKLKGEWVEYKVESWKRH 68

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
            + ++   +G+D    A  + + ++        +  L EDEF+  +L  M+ F  +G   
Sbjct: 69  GQGYVCKLAGLDVREDAQLMTNFEIAIDPASLPE--LSEDEFYWRELFGMQVFTTKGYNL 126

Query: 117 GQVCGVYNFGAGSILEIKNT-----MEKTFLIPFTKF-AVLEVNLQENKILIDPIAA 167
           G+V  +   G+  +L IK        +K  LIP+ +   + +V+ +  +I +D    
Sbjct: 127 GEVTDLLETGSNDVLVIKANLKDAFGQKERLIPYLEEQVIKKVDREARRIEVDWDPG 183


>gi|317129230|ref|YP_004095512.1| 16S rRNA processing protein RimM [Bacillus cellulosilyticus DSM
           2522]
 gi|315474178|gb|ADU30781.1| 16S rRNA processing protein RimM [Bacillus cellulosilyticus DSM
           2522]
          Length = 174

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 41/175 (23%), Positives = 80/175 (45%), Gaps = 9/175 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-----YVLYSNDNR-ELRILKMYRKN 57
           +   + +  I  THG+ GEV + S  + P +        YV    D R  + I    +  
Sbjct: 1   MTDWLNVGKIVNTHGVRGEVRVISRTDFPEERYAIGNTLYVTSDTDVRTPVEITSWRKHK 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
           +  + TF G+DN++   + +   L   + D   +EL E EF+  ++     + + G+  G
Sbjct: 61  QFDLLTFKGLDNLNEVEKFKGSLLQIHQND-ASDELSEGEFYYHEIIGSTVYLQSGEVLG 119

Query: 118 QVCGVYNFGAGSILEIK--NTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
            V  + + GA  +  ++     +K  LIP+    V +V+++  K++I P+   L+
Sbjct: 120 HVKEILSPGANDVWVVQSNTKGKKDMLIPYIDDVVKQVDVKSKKVVIHPMEGLLD 174


>gi|92119040|ref|YP_578769.1| 16S rRNA-processing protein RimM [Nitrobacter hamburgensis X14]
 gi|122416838|sp|Q1QHI8|RIMM_NITHX RecName: Full=Ribosome maturation factor rimM
 gi|91801934|gb|ABE64309.1| 16S rRNA processing protein RimM [Nitrobacter hamburgensis X14]
          Length = 173

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 50/176 (28%), Positives = 81/176 (46%), Gaps = 5/176 (2%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDN--RELRILKMYRKNKRFI 61
           +   V +A IG  HGL GEV + ++  +PI + RY   S  +  R+  +          +
Sbjct: 1   MTARVCVARIGAAHGLRGEVRLWTFTEDPIAVTRYGSLSTKDGARQFEVTHAREVKDYLV 60

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
           AT +G+     A  L    LY  R        +E EF++ DL  +   D  GK  G V  
Sbjct: 61  ATLTGVTTREEAERLNGTDLYVARDKLPAT--DEGEFYHADLIGLAAVDVAGKPLGTVAA 118

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNP 177
           ++NFGAG I+EI      T ++PFT   V  V++   +++I+ +   ++  T    
Sbjct: 119 IHNFGAGDIIEIAPAHGPTLMLPFTDAVVPTVDIAGGRVVIE-MPGEIDGDTPDQA 173


>gi|262172353|ref|ZP_06040031.1| 16S rRNA processing protein RimM [Vibrio mimicus MB-451]
 gi|261893429|gb|EEY39415.1| 16S rRNA processing protein RimM [Vibrio mimicus MB-451]
          Length = 176

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 40/173 (23%), Positives = 79/173 (45%), Gaps = 12/173 (6%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRK 56
           M K ++ +++  +G+++G+ G + + SY +NP  +  Y  +      +  E ++    R 
Sbjct: 1   MSKQNEKLVVGKLGSSYGIRGWLKVFSYTDNPESIFDYSPWFIEQKGEWVEYKVEGWKRH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           NK ++    G+D    A  L + ++    +   +  L EDEF+  +L  M+     G   
Sbjct: 61  NKGWVVKLQGLDVREDAHLLTNFEIAIDPESLPE--LSEDEFYWRELFGMQVVTTSGYDL 118

Query: 117 GQVCGVYNFGAGSILEIKNT-----MEKTFLIPFTKF-AVLEVNLQENKILID 163
           G V  +   G+  +L +K        +K  LIPF +   +  V+ Q  +I +D
Sbjct: 119 GVVTDMMETGSNDVLVVKANLKDAFGQKERLIPFLEEQVIKVVDRQAQRIEVD 171


>gi|262164014|ref|ZP_06031753.1| 16S rRNA processing protein RimM [Vibrio mimicus VM223]
 gi|262027542|gb|EEY46208.1| 16S rRNA processing protein RimM [Vibrio mimicus VM223]
          Length = 182

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 40/173 (23%), Positives = 79/173 (45%), Gaps = 12/173 (6%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRK 56
           M K ++ +++  +G+++G+ G + + SY +NP  +  Y  +      +  E ++    R 
Sbjct: 7   MSKQNEKLVVGKLGSSYGIRGWLKVFSYTDNPESIFDYSPWFIEQKGEWVEYKVEGWKRH 66

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           NK ++    G+D    A  L + ++    +   +  L EDEF+  +L  M+     G   
Sbjct: 67  NKGWVVKLQGLDVREDAHLLTNFEIAIDPESLPE--LSEDEFYWRELFGMQVVTTSGYNL 124

Query: 117 GQVCGVYNFGAGSILEIKNT-----MEKTFLIPFTKF-AVLEVNLQENKILID 163
           G V  +   G+  +L +K        +K  LIPF +   +  V+ Q  +I +D
Sbjct: 125 GVVTDMMETGSNDVLVVKANLKDAFGQKERLIPFLEEQVIKVVDRQAQRIEVD 177


>gi|288553086|ref|YP_003425021.1| 16S rRNA processing protein [Bacillus pseudofirmus OF4]
 gi|288544246|gb|ADC48129.1| 16S rRNA processing protein [Bacillus pseudofirmus OF4]
          Length = 173

 Score =  145 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 44/175 (25%), Positives = 81/175 (46%), Gaps = 10/175 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR--YVLYSNDNRELRILKM-----YRK 56
           +  L+ +  I  THG+ GE+ + S  + P +       L+  D    + + +        
Sbjct: 1   MADLLKVGKIVNTHGVRGEIRVISSTDFPDERYAKGCELWIVDANTKKHISVVVANHRVH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
               + TF G D+I+   E +   LY  +    D  L+E EF+  ++   E +    ++ 
Sbjct: 61  KNFDLLTFEGYDSINQVEEFKGSTLYVSKDQLSD--LDEGEFYYHEIIGCEVYTTNNEHL 118

Query: 117 GQVCGVYNFGAGSILEIKN-TMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           GQ+  +   GA  +  I+     K  LIP+ +  V+E+NL+ENK++IDP+   + 
Sbjct: 119 GQIKEIIETGANDVWVIRRAGGGKDILIPYIEDVVIEINLEENKVIIDPMEGLVE 173


>gi|90414890|ref|ZP_01222855.1| 16S rRNA-processing protein [Photobacterium profundum 3TCK]
 gi|90324004|gb|EAS40598.1| 16S rRNA-processing protein [Photobacterium profundum 3TCK]
          Length = 177

 Score =  145 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 33/178 (18%), Positives = 69/178 (38%), Gaps = 13/178 (7%)

Query: 1   MVKLD-KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYR 55
           M   +  LV++  +G T+G+ G + + SY      +  Y  +      + + ++I    +
Sbjct: 1   MSSQNQDLVVVGKLGATYGIKGWLKVFSYTEQSESIFAYQPWLIKVKGEWKPIQIESWKK 60

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
             +  +A   G+D    A    + ++           L  +EF+  +L  M     +G  
Sbjct: 61  HGQGIVAKLEGLDIREDAQIFTNAEVAVHADQLPA--LSGEEFYWRELYGMSVVTTEGYD 118

Query: 116 WGQVCGVYNFGAGSILEIKNT-----MEKTFLIPFTKF-AVLEVNLQENKILIDPIAA 167
            G+V  +   G+  +L +K        +K  LIPF     +  ++    +I +D    
Sbjct: 119 LGKVTDILETGSNDVLVVKANLKDAFGQKERLIPFLDEQVIKSIDRTAQRIEVDWDPG 176


>gi|327441076|dbj|BAK17441.1| RimM protein required for 16S rRNA processing [Solibacillus
           silvestris StLB046]
          Length = 173

 Score =  145 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 39/172 (22%), Positives = 76/172 (44%), Gaps = 7/172 (4%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-------YVLYSNDNRELRILKMYRKNK 58
           +   +  I  THG+ GE+ I S  +   +          +         + I    R   
Sbjct: 2   EWFNVGRIVNTHGIRGELRILSTTDFEEERFAVGSKLAAFKKDDKKPTWVTISSSRRHKN 61

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
             + TF G++NI+     ++  L        ++ELE++E+++ ++++ E F  +G+  G 
Sbjct: 62  FILVTFEGMENINLVEPFKEGLLKVSMDQLAEDELEDNEYYHFEIKDCEVFSEEGELIGV 121

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           V  +   GA  + E+K    K   IP+ +  V ++N+ E KI+I  +   L 
Sbjct: 122 VTDILETGANDVWEVKAQNGKKHYIPYIEDIVKDINVDEKKIIIHVMEGLLE 173


>gi|163796730|ref|ZP_02190688.1| 50S ribosomal protein L19 [alpha proteobacterium BAL199]
 gi|159177984|gb|EDP62531.1| 50S ribosomal protein L19 [alpha proteobacterium BAL199]
          Length = 179

 Score =  145 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 45/185 (24%), Positives = 82/185 (44%), Gaps = 9/185 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND--NRELRILKMYRKNKRFI 61
           +   V +  +   HG+ G+V +  +  NP D+  Y    ++  +R  ++    R     I
Sbjct: 1   MVDRVCLGAVAGAHGVRGQVKVKPFTENPDDVAAYGPVEDERGDRRFKLSVTGRHKDTVI 60

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               G+ + ++A  LR  +LY  R    +   EE  F++ DL  +      G+  G+V  
Sbjct: 61  VRIDGVSDRNAAEALRGTRLYVARAVLPEP--EEGAFYHADLIGLSVVSVGGETLGRVTS 118

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQYDC 181
           V++FGAG ++E  +      ++PFT   V EV+L   ++++DP        +      D 
Sbjct: 119 VHDFGAGDLVEYVDASGGQHMLPFTLAMVPEVDLAGGRMVVDPPE-----ESPDEGPEDL 173

Query: 182 PLDSA 186
             D A
Sbjct: 174 AQDRA 178


>gi|258623028|ref|ZP_05718041.1| 16S rRNA-processing protein [Vibrio mimicus VM573]
 gi|258623818|ref|ZP_05718775.1| 16S rRNA-processing protein [Vibrio mimicus VM603]
 gi|258583941|gb|EEW08733.1| 16S rRNA-processing protein [Vibrio mimicus VM603]
 gi|258584641|gb|EEW09377.1| 16S rRNA-processing protein [Vibrio mimicus VM573]
          Length = 184

 Score =  145 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 40/173 (23%), Positives = 79/173 (45%), Gaps = 12/173 (6%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRK 56
           M K ++ +++  +G+++G+ G + + SY +NP  +  Y  +      +  E ++    R 
Sbjct: 9   MSKQNEKLVVGKLGSSYGIRGWLKVFSYTDNPESIFDYSPWFIEQKGEWVEYKVEGWKRH 68

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           NK ++    G+D    A  L + ++    +   +  L EDEF+  +L  M+     G   
Sbjct: 69  NKGWVVKLQGLDVREDAHLLTNFEIAIDPESLPE--LSEDEFYWRELFGMQVVTTSGYDL 126

Query: 117 GQVCGVYNFGAGSILEIKNT-----MEKTFLIPFTKF-AVLEVNLQENKILID 163
           G V  +   G+  +L +K        +K  LIPF +   +  V+ Q  +I +D
Sbjct: 127 GVVTDMMETGSNDVLVVKANLKDAFGQKERLIPFLEEQVIKVVDRQAQRIEVD 179


>gi|110678632|ref|YP_681639.1| 16S rRNA-processing protein RimM [Roseobacter denitrificans OCh
           114]
 gi|123172765|sp|Q16AP0|RIMM_ROSDO RecName: Full=Ribosome maturation factor rimM
 gi|109454748|gb|ABG30953.1| 16S rRNA processing protein RimM [Roseobacter denitrificans OCh
           114]
          Length = 168

 Score =  145 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 46/168 (27%), Positives = 83/168 (49%), Gaps = 5/168 (2%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDN--RELRILKMYRKNKRFIA 62
           D+ + +  I   +G+ GE+ I S+     D+  Y   ++++  R   +  +      F+A
Sbjct: 3   DEKICVGAIAGAYGVRGELRIKSFCATAEDIETYSPLTSEDGQRHFHLALVRPIKGGFVA 62

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
             + + +   A  L+ ++L+A R       L +DE++ TDL  ++  D  G+  G V  V
Sbjct: 63  RIAEVSSKEEADALKGVQLFALRDQLPS--LPDDEYYYTDLIGLQVLDTGGELLGSVKTV 120

Query: 123 YNFGAGSILEIKNTM-EKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
            + GAG ILE++     +T L+PFT+  V  V+L   K++ DP    L
Sbjct: 121 ADHGAGDILEVQRPGTSETILLPFTRAVVPTVDLLAGKLIADPPEGAL 168


>gi|134102488|ref|YP_001108149.1| 16S rRNA processing protein [Saccharopolyspora erythraea NRRL 2338]
 gi|291004121|ref|ZP_06562094.1| 16S rRNA processing protein [Saccharopolyspora erythraea NRRL 2338]
 gi|166226476|sp|A4FME9|RIMM_SACEN RecName: Full=Ribosome maturation factor rimM
 gi|133915111|emb|CAM05224.1| 16S rRNA processing protein [Saccharopolyspora erythraea NRRL 2338]
          Length = 180

 Score =  145 bits (366), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 34/181 (18%), Positives = 70/181 (38%), Gaps = 12/181 (6%)

Query: 4   LDKL----VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRE-------LRILK 52
           +D      + +  I   HG+ GE+ ++   ++P             R          +  
Sbjct: 1   MDDKQPLTLAVGRIVRPHGVRGELVVEVRTDSPELRFAPGSVLGMRRRGAHASENFTVAA 60

Query: 53  MYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQ 112
                 R +    G++   +A ELR   L     + +  +  ++ F +  LE +      
Sbjct: 61  ARPHAGRLLVRAEGVEGREAAEELRGALLTVTADELESTDDPDE-FHDHQLEGLRVVFPA 119

Query: 113 GKYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNT 172
           G+  G V  V +  AG +L ++   ++  L+PF    V E++L+  +I++DP     +  
Sbjct: 120 GEEAGVVAEVVHTPAGELLAVRTPDDREVLVPFVSEMVPEIDLEAGRIVVDPPEGLFDAE 179

Query: 173 T 173
            
Sbjct: 180 E 180


>gi|229031472|ref|ZP_04187472.1| Ribosome maturation factor rimM [Bacillus cereus AH1271]
 gi|228729761|gb|EEL80741.1| Ribosome maturation factor rimM [Bacillus cereus AH1271]
          Length = 171

 Score =  145 bits (366), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 35/173 (20%), Positives = 71/173 (41%), Gaps = 9/173 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-------VLYSNDNRELRILKMYRK 56
           + K   +  I  THG+ GE+ + S  + P +  +           S D   +++    + 
Sbjct: 1   MTKWFNVGKIVNTHGVRGEIRVISRTDFPEERYKVGNTLYISNEKSTDYLPVKVTSHRQH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
               + TF G +N+  A + +   +    +     EL E E++  ++        +G+  
Sbjct: 61  KTFDLLTFEGCNNVDEAEKFKGSLIKVPEEQL--GELAEGEYYYHEIIGCSVVTEEGEAL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           G +  + + GA  +  IK    +  LIP+    VL+VN++   + I  +   L
Sbjct: 119 GTIKEILSPGANDVWVIKRPKGQDLLIPYIDDVVLQVNIENKLVTIHVMEGLL 171


>gi|118479064|ref|YP_896215.1| 16S rRNA-processing protein RimM [Bacillus thuringiensis str. Al
           Hakam]
 gi|118418289|gb|ABK86708.1| 16S rRNA processing protein RimM [Bacillus thuringiensis str. Al
           Hakam]
          Length = 193

 Score =  145 bits (366), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 35/173 (20%), Positives = 68/173 (39%), Gaps = 9/173 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-------VLYSNDNRELRILKMYRK 56
           + K   +  I  THG+ GE+ + S  + P +  +             +   ++I    + 
Sbjct: 23  MTKWFNVGKIVNTHGVKGEIRVVSRTDFPEERYKVGNTLYISNEKGGEPFPVKITSHRQH 82

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
               + TF G  N++   + +   L          EL E E++  ++        +G+  
Sbjct: 83  KTFDLLTFEGYGNVNEVEQFKGSLLKVPEDQL--GELAEGEYYYHEIIGCNVVTEEGEAL 140

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           G +  V + GA  +  IK    +  LIP+    VL+VN++   + I  +   L
Sbjct: 141 GTIKEVLSPGANDVWVIKRPKGQDLLIPYIDDVVLQVNIENKLVTIHVMEGLL 193


>gi|256158416|ref|ZP_05456314.1| 16S rRNA-processing protein RimM [Brucella ceti M490/95/1]
 gi|256253836|ref|ZP_05459372.1| 16S rRNA-processing protein RimM [Brucella ceti B1/94]
 gi|261220971|ref|ZP_05935252.1| ribosome maturation factor rimM [Brucella ceti B1/94]
 gi|265996930|ref|ZP_06109487.1| ribosome maturation factor rimM [Brucella ceti M490/95/1]
 gi|260919555|gb|EEX86208.1| ribosome maturation factor rimM [Brucella ceti B1/94]
 gi|262551398|gb|EEZ07388.1| ribosome maturation factor rimM [Brucella ceti M490/95/1]
          Length = 189

 Score =  145 bits (366), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 59/183 (32%), Positives = 99/183 (54%), Gaps = 1/183 (0%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND-NRELRILKMYRKNKR 59
           M + +  + +A IG  HG  GEV + ++  +P+ +  Y L  ++  +   IL+       
Sbjct: 1   MPRPENPIQLAVIGAAHGTRGEVRVKTFTGDPLAIADYGLLYDEQGKAYEILEARVAKTV 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F G+++ ++A  L   +L+  R    DEEL+EDEFF TDL  +E  D  GK +G V
Sbjct: 61  VIVRFKGVNDRNAAEALNGTELFIDRSQLPDEELDEDEFFQTDLIGLEAVDGDGKSYGVV 120

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQY 179
             +++FG G ++E+    ++  LIPFT+ AV E++  +  I ++P AAGL      NP +
Sbjct: 121 SAIFDFGGGDLIELSEKGKRPMLIPFTEAAVPEIDFDKGIIKVEPHAAGLIADEHDNPSH 180

Query: 180 DCP 182
           +  
Sbjct: 181 ESG 183


>gi|52141646|ref|YP_085183.1| 16S rRNA-processing protein [Bacillus cereus E33L]
 gi|59798170|sp|Q636I4|RIMM_BACCZ RecName: Full=Ribosome maturation factor rimM
 gi|51975115|gb|AAU16665.1| 16S rRNA processing protein [Bacillus cereus E33L]
          Length = 171

 Score =  145 bits (366), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 35/173 (20%), Positives = 68/173 (39%), Gaps = 9/173 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-------VLYSNDNRELRILKMYRK 56
           + K   +  I  THG+ GE+ + S  + P +  +             +   ++I    + 
Sbjct: 1   MTKWFNVGKIVNTHGVKGEIRVVSLTDFPEERYKVGNTLYISNEKGGEPFPVKITSHRQH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
               + TF G  N++   + +   L          EL E E++  ++        +G+  
Sbjct: 61  KTFDLLTFEGYGNVNEVEQFKGSLLKVPEDQL--GELAEGEYYYHEIIGCNVVTEEGEAL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           G +  V + GA  +  IK    +  LIP+    VL+VN++   + I  +   L
Sbjct: 119 GTIKEVLSPGANDVWVIKRPKGQDLLIPYIDDVVLQVNIENKLVTIHVMEGLL 171


>gi|54310150|ref|YP_131170.1| 16S rRNA-processing protein RimM [Photobacterium profundum SS9]
 gi|59798725|sp|Q6LMV8|RIMM_PHOPR RecName: Full=Ribosome maturation factor rimM
 gi|46914589|emb|CAG21368.1| putative 16S rRNA processing protein RimM [Photobacterium profundum
           SS9]
          Length = 177

 Score =  145 bits (365), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 33/178 (18%), Positives = 69/178 (38%), Gaps = 13/178 (7%)

Query: 1   MVKLD-KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYR 55
           M   +  LV++  +G T+G+ G + + SY      +  Y  +      + + ++I    +
Sbjct: 1   MSSQNQDLVVVGKLGATYGIKGWLKVFSYTEQSESIFAYQPWLIKVKGEWKPIQIESWKK 60

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
             +  +A   G+D    A    + ++           L  +EF+  +L  M     +G  
Sbjct: 61  HGQGMVAKLEGLDIREDAQIFTNAEVAVHADQLPA--LSGEEFYWRELYGMSVVTTEGYD 118

Query: 116 WGQVCGVYNFGAGSILEIKNT-----MEKTFLIPFTKF-AVLEVNLQENKILIDPIAA 167
            G+V  +   G+  +L +K        +K  LIPF     +  ++    +I +D    
Sbjct: 119 LGKVTDILETGSNDVLVVKANLKDAFGQKERLIPFLDEQVIKSIDRTAQRIEVDWDPG 176


>gi|86137215|ref|ZP_01055793.1| 16S rRNA processing protein RimM [Roseobacter sp. MED193]
 gi|85826539|gb|EAQ46736.1| 16S rRNA processing protein RimM [Roseobacter sp. MED193]
          Length = 171

 Score =  145 bits (365), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 44/169 (26%), Positives = 77/169 (45%), Gaps = 5/169 (2%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDN--RELRILKMYRKNKRFI 61
              L+ +  I  ++G+ GEV + S+   P ++  Y   +N++  +   +         F 
Sbjct: 5   QSDLICVGAIAGSYGVRGEVRLKSFCAQPEEIETYSPLTNEDGSQSFSLTLGRAVKGGFT 64

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
              S ++    A  L+ ++L+  R       L  DE+++ DL  +E FD  G   G V  
Sbjct: 65  GRISTVETKEQADALKGIRLFTTRDKLP--TLPSDEYYHADLIGVEVFDTGGALLGTVKS 122

Query: 122 VYNFGAGSILEIKNTM-EKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           V N GA  +LE+     + T  +PFT  AV  V+L++ +I+ DP     
Sbjct: 123 VQNHGASDLLELTGAGLKGTVFLPFTLAAVPTVDLEQGRIIADPPEGLF 171


>gi|42782934|ref|NP_980181.1| 16S rRNA-processing protein RimM [Bacillus cereus ATCC 10987]
 gi|49186692|ref|YP_029944.1| 16S rRNA-processing protein RimM [Bacillus anthracis str. Sterne]
 gi|49481628|ref|YP_037903.1| 16S rRNA-processing protein RimM [Bacillus thuringiensis serovar
           konkukian str. 97-27]
 gi|217961262|ref|YP_002339830.1| 16S rRNA-processing protein RimM [Bacillus cereus AH187]
 gi|222097287|ref|YP_002531344.1| 16S rRNA-processing protein rimm [Bacillus cereus Q1]
 gi|225865823|ref|YP_002751201.1| 16S rRNA processing protein RimM [Bacillus cereus 03BB102]
 gi|228916479|ref|ZP_04080045.1| Ribosome maturation factor rimM [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|228928890|ref|ZP_04091922.1| Ribosome maturation factor rimM [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228935156|ref|ZP_04097983.1| Ribosome maturation factor rimM [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228947561|ref|ZP_04109851.1| Ribosome maturation factor rimM [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
 gi|228986985|ref|ZP_04147111.1| Ribosome maturation factor rimM [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|229092884|ref|ZP_04224018.1| Ribosome maturation factor rimM [Bacillus cereus Rock3-42]
 gi|229123356|ref|ZP_04252560.1| Ribosome maturation factor rimM [Bacillus cereus 95/8201]
 gi|229140485|ref|ZP_04269040.1| Ribosome maturation factor rimM [Bacillus cereus BDRD-ST26]
 gi|229157418|ref|ZP_04285496.1| Ribosome maturation factor rimM [Bacillus cereus ATCC 4342]
 gi|229186082|ref|ZP_04313251.1| Ribosome maturation factor rimM [Bacillus cereus BGSC 6E1]
 gi|229197952|ref|ZP_04324667.1| Ribosome maturation factor rimM [Bacillus cereus m1293]
 gi|254720890|ref|ZP_05182681.1| 16S rRNA-processing protein RimM [Bacillus anthracis str. A1055]
 gi|301055332|ref|YP_003793543.1| 16S rRNA-processing protein [Bacillus anthracis CI]
 gi|59798280|sp|Q6HEX3|RIMM_BACHK RecName: Full=Ribosome maturation factor rimM
 gi|59798339|sp|Q732M8|RIMM_BACC1 RecName: Full=Ribosome maturation factor rimM
 gi|209573750|sp|A0RHL5|RIMM_BACAH RecName: Full=Ribosome maturation factor rimM
 gi|226694910|sp|B7HLH5|RIMM_BACC7 RecName: Full=Ribosome maturation factor rimM
 gi|254797743|sp|C1EP66|RIMM_BACC3 RecName: Full=Ribosome maturation factor rimM
 gi|254797744|sp|B9IVD1|RIMM_BACCQ RecName: Full=Ribosome maturation factor rimM
 gi|42738861|gb|AAS42789.1| 16S rRNA processing protein RimM [Bacillus cereus ATCC 10987]
 gi|49180619|gb|AAT55995.1| 16S rRNA processing protein RimM [Bacillus anthracis str. Sterne]
 gi|49333184|gb|AAT63830.1| 16S rRNA processing protein [Bacillus thuringiensis serovar
           konkukian str. 97-27]
 gi|217067406|gb|ACJ81656.1| 16S rRNA processing protein RimM [Bacillus cereus AH187]
 gi|221241345|gb|ACM14055.1| 16S rRNA processing protein [Bacillus cereus Q1]
 gi|225790577|gb|ACO30794.1| 16S rRNA processing protein RimM [Bacillus cereus 03BB102]
 gi|228585531|gb|EEK43634.1| Ribosome maturation factor rimM [Bacillus cereus m1293]
 gi|228597258|gb|EEK54909.1| Ribosome maturation factor rimM [Bacillus cereus BGSC 6E1]
 gi|228626145|gb|EEK82894.1| Ribosome maturation factor rimM [Bacillus cereus ATCC 4342]
 gi|228643046|gb|EEK99322.1| Ribosome maturation factor rimM [Bacillus cereus BDRD-ST26]
 gi|228660132|gb|EEL15768.1| Ribosome maturation factor rimM [Bacillus cereus 95/8201]
 gi|228690506|gb|EEL44289.1| Ribosome maturation factor rimM [Bacillus cereus Rock3-42]
 gi|228772763|gb|EEM21203.1| Ribosome maturation factor rimM [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|228812081|gb|EEM58412.1| Ribosome maturation factor rimM [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
 gi|228824521|gb|EEM70326.1| Ribosome maturation factor rimM [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228830697|gb|EEM76302.1| Ribosome maturation factor rimM [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228843058|gb|EEM88140.1| Ribosome maturation factor rimM [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|300377501|gb|ADK06405.1| 16S rRNA-processing protein [Bacillus cereus biovar anthracis str.
           CI]
 gi|324327739|gb|ADY22999.1| 16S rRNA-processing protein RimM [Bacillus thuringiensis serovar
           finitimus YBT-020]
          Length = 171

 Score =  145 bits (365), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 35/173 (20%), Positives = 68/173 (39%), Gaps = 9/173 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-------VLYSNDNRELRILKMYRK 56
           + K   +  I  THG+ GE+ + S  + P +  +             +   ++I    + 
Sbjct: 1   MTKWFNVGKIVNTHGVKGEIRVVSRTDFPEERYKVGNTLYISNEKGGEPFPVKITSHRQH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
               + TF G  N++   + +   L          EL E E++  ++        +G+  
Sbjct: 61  KTFDLLTFEGYGNVNEVEQFKGSLLKVPEDQL--GELAEGEYYYHEIIGCNVVTEEGEAL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           G +  V + GA  +  IK    +  LIP+    VL+VN++   + I  +   L
Sbjct: 119 GTIKEVLSPGANDVWVIKRPKGQDLLIPYIDDVVLQVNIENKLVTIHVMEGLL 171


>gi|84394291|ref|ZP_00993016.1| 16S rRNA-processing protein [Vibrio splendidus 12B01]
 gi|84375094|gb|EAP92016.1| 16S rRNA-processing protein [Vibrio splendidus 12B01]
          Length = 184

 Score =  145 bits (365), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 36/177 (20%), Positives = 79/177 (44%), Gaps = 12/177 (6%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRK 56
           M + +  ++M  +G+T+G+ G + + SY +N   +  Y  +         E ++    R 
Sbjct: 9   MSEQNNRIVMGKLGSTYGIRGWLKVFSYTDNAESIFDYSPWYLNQKGKWVEYKVESWKRH 68

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
            + ++   +G+D    A  + + ++        +  L EDEF+  +L  M+ F  +G   
Sbjct: 69  GQGYVCKLAGLDVREDAQLMTNFEIAIDPASLPE--LSEDEFYWRELFGMQVFTTKGYDL 126

Query: 117 GQVCGVYNFGAGSILEIKNT-----MEKTFLIPFTKF-AVLEVNLQENKILIDPIAA 167
           G+V  +   G+  +L IK        +K  L+P+ +   + +V+ +  +I +D    
Sbjct: 127 GEVTDLLETGSNDVLVIKANLKDAFGQKERLVPYLEEQVIKKVDREARRIEVDWDPG 183


>gi|323702670|ref|ZP_08114331.1| 16S rRNA processing protein RimM [Desulfotomaculum nigrificans DSM
           574]
 gi|323532333|gb|EGB22211.1| 16S rRNA processing protein RimM [Desulfotomaculum nigrificans DSM
           574]
          Length = 169

 Score =  145 bits (365), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 33/169 (19%), Positives = 74/169 (43%), Gaps = 6/169 (3%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR----YVLYSNDNRELRILKMYRKNKRF 60
           ++ + +  I  T G+ GEV +    + P    +    ++L     R+L I + +   +  
Sbjct: 3   EEFITVGEIVNTQGIRGEVRVLPTTDFPERFKQTKKIFLLLQGQRRQLTINRAWEHKQFI 62

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           I  F  + ++  A +L+   L   R +    +L +D ++  ++  ++  D +G+  G+V 
Sbjct: 63  ILKFDEVADMSEAEKLKGGLLQVPRTEL--TDLPKDCYYIFEIVGLKVIDERGQELGKVA 120

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
            V   GA  +  +K    K  LIP  K  V ++++    + ++     +
Sbjct: 121 DVLRTGANDVYVVKRDQGKDILIPALKSVVKKIDVPAGLMQVELPEGLI 169


>gi|229512831|ref|ZP_04402298.1| 16S rRNA processing protein RimM [Vibrio cholerae TMA 21]
 gi|229350080|gb|EEO15033.1| 16S rRNA processing protein RimM [Vibrio cholerae TMA 21]
          Length = 184

 Score =  145 bits (365), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 40/173 (23%), Positives = 78/173 (45%), Gaps = 12/173 (6%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRK 56
           M K ++ +++  +G+++G+ G + + SY +NP  +  Y  +      +  E ++    R 
Sbjct: 9   MSKQNEKLVVGKLGSSYGIRGWLKVFSYTDNPESIFDYSPWYIDQKGEWVEYKVEGWKRH 68

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           NK ++    G+D    A  L + ++        +  L EDEF+  +L  M+     G   
Sbjct: 69  NKGWVVKLQGLDLREDAHLLTNFEIAIDPASLPE--LSEDEFYWRELFGMQVVTTNGYDL 126

Query: 117 GQVCGVYNFGAGSILEIKNT-----MEKTFLIPFTKF-AVLEVNLQENKILID 163
           G V  +   G+  +L +K        +K  LIPF +   +  V+ Q  +I +D
Sbjct: 127 GVVTDMMETGSNDVLVVKANLKDAFGQKERLIPFLEEQVIKVVDRQAQRIEVD 179


>gi|229174508|ref|ZP_04302040.1| Ribosome maturation factor rimM [Bacillus cereus MM3]
 gi|228609068|gb|EEK66358.1| Ribosome maturation factor rimM [Bacillus cereus MM3]
          Length = 171

 Score =  145 bits (365), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 35/173 (20%), Positives = 71/173 (41%), Gaps = 9/173 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-------VLYSNDNRELRILKMYRK 56
           + K   +  I  THG+ GE+ + S  + P +  +           S D   +++    + 
Sbjct: 1   MTKWFNVGKIVNTHGVRGEIRVISRTDFPEERYKVGNTLYISNEKSTDYLPVKVTSHRQH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
               + TF G +N+  A + +   +    +     EL E E++  ++        +G+  
Sbjct: 61  KTFDLLTFEGYNNVDEAEKFKGSLIKVPEEQL--GELAEGEYYYHEIIGCSVVTEEGEAL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           G +  + + GA  +  IK    +  LIP+    VL+VN++   + I  +   L
Sbjct: 119 GTIKEILSPGANDVWVIKRPKGQDLLIPYIDDVVLQVNIENKLVTIHVMEGLL 171


>gi|229525222|ref|ZP_04414627.1| 16S rRNA processing protein RimM [Vibrio cholerae bv. albensis
           VL426]
 gi|229338803|gb|EEO03820.1| 16S rRNA processing protein RimM [Vibrio cholerae bv. albensis
           VL426]
          Length = 184

 Score =  145 bits (365), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 40/173 (23%), Positives = 79/173 (45%), Gaps = 12/173 (6%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRK 56
           M K ++ +++  +G+++G+ G + + SY +NP  +  Y  +      +  E ++    R 
Sbjct: 9   MSKQNEKLVVGKLGSSYGIRGWLKVFSYTDNPESIFDYSPWYIDQKGEWVEYKVEGWKRH 68

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           NK ++    G+D    A+ L + ++        +  L EDEF+  +L  M+     G   
Sbjct: 69  NKGWVVKLQGLDVREDANLLTNFEIAIDPASLPE--LSEDEFYWRELFGMQVVTTNGYDL 126

Query: 117 GQVCGVYNFGAGSILEIKNT-----MEKTFLIPFTKF-AVLEVNLQENKILID 163
           G V  +   G+  +L +K        +K  LIPF +   +  V+ Q  +I +D
Sbjct: 127 GVVTDMMETGSNDVLVVKANLKDAFGQKERLIPFLEEQVIKVVDRQAQRIEVD 179


>gi|15640584|ref|NP_230213.1| 16S rRNA-processing protein RimM [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|147674058|ref|YP_001216061.1| 16S rRNA-processing protein RimM [Vibrio cholerae O395]
 gi|153216300|ref|ZP_01950390.1| 16S rRNA processing protein RimM [Vibrio cholerae 1587]
 gi|153823559|ref|ZP_01976226.1| 16S rRNA processing protein RimM [Vibrio cholerae B33]
 gi|153827344|ref|ZP_01980011.1| 16S rRNA processing protein RimM [Vibrio cholerae MZO-2]
 gi|227080745|ref|YP_002809296.1| 16S rRNA processing protein [Vibrio cholerae M66-2]
 gi|229507173|ref|ZP_04396679.1| 16S rRNA processing protein RimM [Vibrio cholerae BX 330286]
 gi|229509158|ref|ZP_04398643.1| 16S rRNA processing protein RimM [Vibrio cholerae B33]
 gi|229519632|ref|ZP_04409075.1| 16S rRNA processing protein RimM [Vibrio cholerae RC9]
 gi|229520858|ref|ZP_04410280.1| 16S rRNA processing protein RimM [Vibrio cholerae TM 11079-80]
 gi|229530375|ref|ZP_04419763.1| 16S rRNA processing protein RimM [Vibrio cholerae 12129(1)]
 gi|229606149|ref|YP_002876797.1| 16S rRNA-processing protein RimM [Vibrio cholerae MJ-1236]
 gi|254292065|ref|ZP_04962841.1| 16S rRNA processing protein RimM [Vibrio cholerae AM-19226]
 gi|254850799|ref|ZP_05240149.1| 16S rRNA-processing protein [Vibrio cholerae MO10]
 gi|255744213|ref|ZP_05418166.1| 16S rRNA processing protein RimM [Vibrio cholera CIRS 101]
 gi|262147227|ref|ZP_06028029.1| 16S rRNA processing protein RimM [Vibrio cholerae INDRE 91/1]
 gi|262169871|ref|ZP_06037561.1| 16S rRNA processing protein RimM [Vibrio cholerae RC27]
 gi|297580695|ref|ZP_06942621.1| 16S rRNA-processing protein [Vibrio cholerae RC385]
 gi|298500686|ref|ZP_07010489.1| 16S rRNA processing protein RimM [Vibrio cholerae MAK 757]
 gi|172047728|sp|A5F9A8|RIMM_VIBC3 RecName: Full=Ribosome maturation factor rimM
 gi|254797770|sp|C3LS52|RIMM_VIBCM RecName: Full=Ribosome maturation factor rimM
 gi|9654992|gb|AAF93730.1| 16S rRNA processing protein RimM [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|124114342|gb|EAY33162.1| 16S rRNA processing protein RimM [Vibrio cholerae 1587]
 gi|126518913|gb|EAZ76136.1| 16S rRNA processing protein RimM [Vibrio cholerae B33]
 gi|146315941|gb|ABQ20480.1| 16S rRNA processing protein RimM [Vibrio cholerae O395]
 gi|149738739|gb|EDM53081.1| 16S rRNA processing protein RimM [Vibrio cholerae MZO-2]
 gi|150422013|gb|EDN13984.1| 16S rRNA processing protein RimM [Vibrio cholerae AM-19226]
 gi|227008633|gb|ACP04845.1| 16S rRNA processing protein [Vibrio cholerae M66-2]
 gi|227012388|gb|ACP08598.1| 16S rRNA processing protein [Vibrio cholerae O395]
 gi|229332148|gb|EEN97636.1| 16S rRNA processing protein RimM [Vibrio cholerae 12129(1)]
 gi|229342091|gb|EEO07087.1| 16S rRNA processing protein RimM [Vibrio cholerae TM 11079-80]
 gi|229344321|gb|EEO09296.1| 16S rRNA processing protein RimM [Vibrio cholerae RC9]
 gi|229353730|gb|EEO18666.1| 16S rRNA processing protein RimM [Vibrio cholerae B33]
 gi|229355918|gb|EEO20838.1| 16S rRNA processing protein RimM [Vibrio cholerae BX 330286]
 gi|229368804|gb|ACQ59227.1| 16S rRNA processing protein RimM [Vibrio cholerae MJ-1236]
 gi|254846504|gb|EET24918.1| 16S rRNA-processing protein [Vibrio cholerae MO10]
 gi|255738153|gb|EET93545.1| 16S rRNA processing protein RimM [Vibrio cholera CIRS 101]
 gi|262021605|gb|EEY40316.1| 16S rRNA processing protein RimM [Vibrio cholerae RC27]
 gi|262031324|gb|EEY49936.1| 16S rRNA processing protein RimM [Vibrio cholerae INDRE 91/1]
 gi|297535111|gb|EFH73946.1| 16S rRNA-processing protein [Vibrio cholerae RC385]
 gi|297540467|gb|EFH76525.1| 16S rRNA processing protein RimM [Vibrio cholerae MAK 757]
          Length = 184

 Score =  145 bits (365), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 40/173 (23%), Positives = 78/173 (45%), Gaps = 12/173 (6%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRK 56
           M K ++ +++  +G+++G+ G + + SY +NP  +  Y  +      +  E ++    R 
Sbjct: 9   MSKQNEKLVVGKLGSSYGIRGWLKVFSYTDNPESIFDYSPWYIDQKGEWVEYKVEGWKRH 68

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           NK ++    G+D    A  L + ++        +  L EDEF+  +L  M+     G   
Sbjct: 69  NKGWVVKLQGLDVREDAHLLTNFEIAIDPASLPE--LSEDEFYWRELFGMQVVTTNGYDL 126

Query: 117 GQVCGVYNFGAGSILEIKNT-----MEKTFLIPFTKF-AVLEVNLQENKILID 163
           G V  +   G+  +L +K        +K  LIPF +   +  V+ Q  +I +D
Sbjct: 127 GVVTDMMETGSNDVLVVKANLKDAFGQKERLIPFLEEQVIKVVDRQAQRIEVD 179


>gi|126734921|ref|ZP_01750667.1| 16S rRNA processing protein RimM [Roseobacter sp. CCS2]
 gi|126715476|gb|EBA12341.1| 16S rRNA processing protein RimM [Roseobacter sp. CCS2]
          Length = 171

 Score =  145 bits (365), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 50/173 (28%), Positives = 76/173 (43%), Gaps = 5/173 (2%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELR--ILKMYRKNKRFI 61
           +   V++  IG   G+ GEV + SY  +P  +  Y     ++      I+   +    F 
Sbjct: 1   MSDRVIVGAIGGAFGVQGEVRLKSYCADPQAIADYTPLYTEDGRAFAQIVLTGQLKNGFT 60

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
           A   G+     A  LR++ LYA R       L +DE++  DL  +   D  G   G V  
Sbjct: 61  ARIDGVITKEDADALRNVNLYAPRDIMPS--LPDDEYYYADLIGLTVVDTGGATLGTVKN 118

Query: 122 VYNFGAGSILE-IKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTT 173
           V + GAG +LE I      T L+PFT+ AV  V+L   +I+ DP      +  
Sbjct: 119 VMDHGAGDLLEIIVPGASDTILLPFTQAAVPTVDLTAKRIVADPPDGLFPSDD 171


>gi|75676965|ref|YP_319386.1| 16S rRNA processing protein RimM [Nitrobacter winogradskyi Nb-255]
 gi|109893027|sp|Q3SNV7|RIMM_NITWN RecName: Full=Ribosome maturation factor rimM
 gi|74421835|gb|ABA06034.1| 16S rRNA processing protein RimM [Nitrobacter winogradskyi Nb-255]
          Length = 173

 Score =  145 bits (365), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 51/174 (29%), Positives = 84/174 (48%), Gaps = 5/174 (2%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDN--RELRILKMYRKNKRFI 61
           +   V +A IG  HGL GEV + ++  +P+ + RY   S  +  R+L +      +   I
Sbjct: 1   MTARVCVARIGAAHGLRGEVRLWTFTEDPMSVTRYGPLSTKDGARQLEVSHARAASDHLI 60

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
           AT +G+     A  L   +LY  R    +   +E EF++ DL  +  FD  G   G V  
Sbjct: 61  ATLTGVTTREEAERLNGTELYVARDKLPET--DEGEFYHADLIGLAAFDAAGTALGTVAA 118

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMK 175
           ++NFGAG I+EI      T ++PFT   V  V++   +++I+  A  ++     
Sbjct: 119 IHNFGAGDIIEIAPARGPTLMLPFTDAVVPIVDIAGGRVVIEAPAE-IDGEEPN 171


>gi|14423897|sp|Q9KUF9|RIMM_VIBCH RecName: Full=Ribosome maturation factor rimM
          Length = 182

 Score =  144 bits (364), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 40/173 (23%), Positives = 78/173 (45%), Gaps = 12/173 (6%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRK 56
           M K ++ +++  +G+++G+ G + + SY +NP  +  Y  +      +  E ++    R 
Sbjct: 7   MSKQNEKLVVGKLGSSYGIRGWLKVFSYTDNPESIFDYSPWYIDQKGEWVEYKVEGWKRH 66

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           NK ++    G+D    A  L + ++        +  L EDEF+  +L  M+     G   
Sbjct: 67  NKGWVVKLQGLDVREDAHLLTNFEIAIDPASLPE--LSEDEFYWRELFGMQVVTTNGYDL 124

Query: 117 GQVCGVYNFGAGSILEIKNT-----MEKTFLIPFTKF-AVLEVNLQENKILID 163
           G V  +   G+  +L +K        +K  LIPF +   +  V+ Q  +I +D
Sbjct: 125 GVVTDMMETGSNDVLVVKANLKDAFGQKERLIPFLEEQVIKVVDRQAQRIEVD 177


>gi|269926737|ref|YP_003323360.1| 16S rRNA processing protein RimM [Thermobaculum terrenum ATCC
           BAA-798]
 gi|269790397|gb|ACZ42538.1| 16S rRNA processing protein RimM [Thermobaculum terrenum ATCC
           BAA-798]
          Length = 179

 Score =  144 bits (364), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 37/165 (22%), Positives = 74/165 (44%), Gaps = 3/165 (1%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIATF 64
           D  V++  I + HG+ GEV ++   +NP    +       +   +++ +    K  +  F
Sbjct: 14  DNYVIVGRILSPHGVRGEVKVEPITDNPERFKQLRQVYVGDALHKVVSVRVLPKFVLVRF 73

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
            G+++   A  L  + LY  ++      L ED F++ DL+ ME     G+  G +  +  
Sbjct: 74  EGMESPEQAKALSGMYLYIPKEQ--VMPLPEDTFYHFDLQGMEVVSTSGEPLGTLREILI 131

Query: 125 FGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
             A  +  + +      LIP  K  V +V+L+  +++++ I   L
Sbjct: 132 REANDVFVVDHPRG-EILIPAIKDVVKDVDLENRRLVVELIPGLL 175


>gi|307943455|ref|ZP_07658799.1| 16S rRNA processing protein RimM [Roseibium sp. TrichSKD4]
 gi|307773085|gb|EFO32302.1| 16S rRNA processing protein RimM [Roseibium sp. TrichSKD4]
          Length = 179

 Score =  144 bits (364), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 51/181 (28%), Positives = 94/181 (51%), Gaps = 5/181 (2%)

Query: 1   MVKLDK-LVLMATIGTTHGLNGEVYIDSYANNPIDLNRYV--LYSNDNRELRILKMYRKN 57
           M + D  LVLMA IG  HG+ GEV + ++ ++P+    Y   +  + +    + +   + 
Sbjct: 1   MSETDNSLVLMARIGAAHGIRGEVRVKAFGDDPLSFTDYGELITKSGDTTFEVERARIQK 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              +  F GI++ ++A EL  ++L+  R    +  LE+DEF++ DL  M   D +G   G
Sbjct: 61  TVVVTKFKGINDRNAAEELNGVELFVHRDQLPE--LEDDEFYHDDLVGMAVTDLEGTDLG 118

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNP 177
           +V  V +FGAG +LE++     TF +PF+K  V E++++   +  D      + ++    
Sbjct: 119 KVVMVQDFGAGDLLEVRPKRGPTFYMPFSKAFVPEIDIENRVVKADLPDDYFSVSSSDEE 178

Query: 178 Q 178
           +
Sbjct: 179 R 179


>gi|196247660|ref|ZP_03146362.1| 16S rRNA processing protein RimM [Geobacillus sp. G11MC16]
 gi|196212444|gb|EDY07201.1| 16S rRNA processing protein RimM [Geobacillus sp. G11MC16]
          Length = 173

 Score =  144 bits (364), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 33/174 (18%), Positives = 68/174 (39%), Gaps = 9/174 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-------YVLYSNDNRELRILKMYRK 56
           +++   +  I  THG+ GEV + S  + P +  +       +     +  E+ +      
Sbjct: 2   MERWFNVGKIVNTHGIRGEVRVISRTDFPEERYKKGNKLYIFRECDTEPIEVTVKSHRVH 61

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
               + +F G D+I+     +   L          EL E E++  ++ +       G+  
Sbjct: 62  KSFDLLSFEGYDSINDVEPFKGAMLKVPESQL--GELNEGEYYFHEIIDCTVVTEAGETI 119

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           G+V  +   GA  +  ++       LIP+    V+ V+ +   I+I P+   L 
Sbjct: 120 GKVKEILTPGANDVWVVRRQDGTDALIPYIDDVVMHVDPERKIIIIRPMEGLLE 173


>gi|229006118|ref|ZP_04163806.1| Ribosome maturation factor rimM [Bacillus mycoides Rock1-4]
 gi|228755194|gb|EEM04551.1| Ribosome maturation factor rimM [Bacillus mycoides Rock1-4]
          Length = 171

 Score =  144 bits (363), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 33/173 (19%), Positives = 72/173 (41%), Gaps = 9/173 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-------YVLYSNDNRELRILKMYRK 56
           + K   +  I  THG+ GE+ + S  + P +  +       +     +   +++    + 
Sbjct: 1   MTKWFNVGKIVNTHGVRGEIRVISRTDFPEERYKVGNTLYIWHDKGTEPLSVKVASHRQH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
               + TF G +N+    +L+   +    +     EL E E++  ++   +    +G+  
Sbjct: 61  KTFDLLTFEGYNNVDEVEKLKGSSIKVPEEQL--GELAEGEYYYHEIIGCKVVTEEGEDL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           G +  + + GA  +  IK    +  LIP+    VL+VN++   + I  +   L
Sbjct: 119 GTIKEILSPGANDVWVIKRPKGQDLLIPYIDDIVLQVNIENKLVTIHVMEGLL 171


>gi|239996292|ref|ZP_04716816.1| 16S rRNA-processing protein [Alteromonas macleodii ATCC 27126]
          Length = 173

 Score =  144 bits (363), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 43/174 (24%), Positives = 74/174 (42%), Gaps = 9/174 (5%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS-NDNRELRILKMYRKNKR 59
           M      V++  IG  +G+ G V I+SY   P  +  Y  +   D +E +I +     K 
Sbjct: 1   MSLASDKVIVGKIGAPYGVKGWVKINSYTETPEGIFDYAPWFLGDEKEYQIDQWRPHGKS 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +A   G+D+   A  +++L +        D  L ++  +  +L  M+    QG   G V
Sbjct: 61  LVAKIVGVDSRDDAERIKNLDININASQLPD--LGDEGVYWRELTGMKVVTTQGYDLGVV 118

Query: 120 CGVYNFGAGSILEIKNTME-----KTFLIPFT-KFAVLEVNLQENKILIDPIAA 167
             V+N GA  ++ +K  +      K  L+PF     V EV+ +   I +D    
Sbjct: 119 KEVFNTGANDVIHVKANVGDAFGQKERLLPFVFDEVVQEVDKEAKVIKVDWDPG 172


>gi|229098311|ref|ZP_04229258.1| Ribosome maturation factor rimM [Bacillus cereus Rock3-29]
 gi|229104404|ref|ZP_04235073.1| Ribosome maturation factor rimM [Bacillus cereus Rock3-28]
 gi|229117328|ref|ZP_04246706.1| Ribosome maturation factor rimM [Bacillus cereus Rock1-3]
 gi|228666228|gb|EEL21692.1| Ribosome maturation factor rimM [Bacillus cereus Rock1-3]
 gi|228679102|gb|EEL33310.1| Ribosome maturation factor rimM [Bacillus cereus Rock3-28]
 gi|228685209|gb|EEL39140.1| Ribosome maturation factor rimM [Bacillus cereus Rock3-29]
          Length = 171

 Score =  144 bits (363), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 35/173 (20%), Positives = 71/173 (41%), Gaps = 9/173 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-------VLYSNDNRELRILKMYRK 56
           + K   +  I  THG+ GE+ + S  + P +  +           S D   +++    + 
Sbjct: 1   MTKWFNVGKIVNTHGVRGEIRVISRTDFPEERYKVGNTLYISNEKSTDFLPVKVTSHRQH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
               + TF G +N+  A + +   +    +     EL E E++  ++        +G+  
Sbjct: 61  KTFDLLTFEGYNNVDEAEKFKGSLIKVPEEQL--GELAEGEYYYHEIIGCSVVTEEGEAL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           G +  + + GA  +  IK    +  LIP+    VL+VN++   + I  +   L
Sbjct: 119 GTIKEILSPGANDVWVIKRPKGQDLLIPYIDDVVLQVNIENKLVTIHVMEGLL 171


>gi|295696072|ref|YP_003589310.1| 16S rRNA processing protein RimM [Bacillus tusciae DSM 2912]
 gi|295411674|gb|ADG06166.1| 16S rRNA processing protein RimM [Bacillus tusciae DSM 2912]
          Length = 175

 Score =  144 bits (363), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 37/174 (21%), Positives = 68/174 (39%), Gaps = 8/174 (4%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY--VLYSNDNR----ELRILKMY 54
           M   + +  +  +  THGL GEV I    + P    R   VL+ +       ELR+ K  
Sbjct: 1   MAPEEPMYTVGVVVGTHGLRGEVRIFPRTDFPEVRFRQGSVLWLDGGTGPAMELRVEKAR 60

Query: 55  RKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGK 114
           +    FI  F+G  +I +    +  +L           L E  ++   L      D  G+
Sbjct: 61  KHKNVFIVQFAGFHSIQAVEPWKGRELKVPESAL--MPLPEGRYYIHQLVGCRVVDEHGR 118

Query: 115 YWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAG 168
           + G++  V   GA  +  ++    K  L+P     V  V++++  +++      
Sbjct: 119 WLGELSEVLQPGANDVYVVRRPGAKDLLVPAIPSVVKRVSVEDRLMVVSLPEGL 172


>gi|228909667|ref|ZP_04073490.1| Ribosome maturation factor rimM [Bacillus thuringiensis IBL 200]
 gi|228849956|gb|EEM94787.1| Ribosome maturation factor rimM [Bacillus thuringiensis IBL 200]
          Length = 171

 Score =  144 bits (363), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 33/173 (19%), Positives = 69/173 (39%), Gaps = 9/173 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-------VLYSNDNRELRILKMYRK 56
           + K   +  I  THG+ GE+ + S  + P +  +             D   +++    + 
Sbjct: 1   MTKWFNVGKIVNTHGVRGEIRVISRTDFPEERYKVGNTLYISNEKDTDYLPVKVTSHRQH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
               + TF G +N+    + +   +    +     EL E E++  ++        +G+  
Sbjct: 61  KTFDLLTFEGYNNVDEVEKFKGSLIKVPEEQL--GELSEGEYYYHEIIGCSVVTEEGEAL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           G +  + + GA  +  IK    +  LIP+    VL+VN++   + I  +   L
Sbjct: 119 GTIKEILSPGANDVWVIKRPKGQDLLIPYIDDVVLQVNIENKLVTIHVMEGLL 171


>gi|260767212|ref|ZP_05876154.1| 16S rRNA processing protein RimM [Vibrio furnissii CIP 102972]
 gi|260617820|gb|EEX42997.1| 16S rRNA processing protein RimM [Vibrio furnissii CIP 102972]
 gi|315181157|gb|ADT88071.1| 16S rRNA-processing protein [Vibrio furnissii NCTC 11218]
          Length = 184

 Score =  144 bits (363), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 38/173 (21%), Positives = 77/173 (44%), Gaps = 12/173 (6%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRK 56
           M K D+ +++   G ++G+ G + + SY ++   +  Y  +      +  E ++    R 
Sbjct: 9   MSKQDEKIVVGKFGASYGIRGWLKVFSYTDDAESIFDYSPWFVNHKGEWVEYKVESWKRH 68

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           NK  +A   G+D    A+ + + ++        +  L EDEF+  +L  M+    QG   
Sbjct: 69  NKGMVAKLQGLDVREDANLMTNFEIAIDPASLPE--LSEDEFYWRELFGMQVVTTQGYNL 126

Query: 117 GQVCGVYNFGAGSILEIKNT-----MEKTFLIPFTKF-AVLEVNLQENKILID 163
           G+V  +   G+  +L +K        +K  LIPF +   +  ++    +I +D
Sbjct: 127 GEVVDMLETGSNDVLVVKANLKDAFGQKERLIPFLEEQVIKNIDRTAQRIEVD 179


>gi|30021930|ref|NP_833561.1| 16S rRNA-processing protein [Bacillus cereus ATCC 14579]
 gi|29897486|gb|AAP10762.1| 16S rRNA processing protein rimM [Bacillus cereus ATCC 14579]
          Length = 188

 Score =  144 bits (363), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 33/173 (19%), Positives = 69/173 (39%), Gaps = 9/173 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-------VLYSNDNRELRILKMYRK 56
           + K   +  I  THG+ GE+ + S  + P +  +             D   +++    + 
Sbjct: 18  MTKWFNVGKIVNTHGVRGEIRVISRTDFPEERYKVGNTLYISNEKGTDYLPVKVTSHRQH 77

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
               + TF G +N+    + +   +    +     EL E E++  ++        +G+  
Sbjct: 78  KTFDLLTFEGYNNVDEVEKFKGSLIKVPEEQL--GELAEGEYYYHEIIGCSVVTEEGEAL 135

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           G +  + + GA  +  IK    +  LIP+    VL+VN++   + I  +   L
Sbjct: 136 GTIKEILSPGANDVWVIKRPKGQDLLIPYIDDVVLQVNIENKLVTIHVMEGLL 188


>gi|163733915|ref|ZP_02141357.1| 16S rRNA processing protein RimM [Roseobacter litoralis Och 149]
 gi|161393026|gb|EDQ17353.1| 16S rRNA processing protein RimM [Roseobacter litoralis Och 149]
          Length = 173

 Score =  144 bits (363), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 45/168 (26%), Positives = 80/168 (47%), Gaps = 5/168 (2%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDN--RELRILKMYRKNKRFIA 62
           D+ + +  I   +G+ GE+ I S+     D+  Y   ++++  R   +  +      F+A
Sbjct: 8   DEKICVGAIAGAYGVRGELRIKSFCATAEDIETYAPLTSEDGQRHFHLALVRPIKGGFVA 67

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
             + +     A  L+ ++L+A R       L +DE++ TDL  ++  D  G+  G V  V
Sbjct: 68  RIAEVTTKEEADALKGVQLFALRDQLPS--LPDDEYYYTDLIGLQVLDTGGEILGSVKTV 125

Query: 123 YNFGAGSILEIKNTMEKT-FLIPFTKFAVLEVNLQENKILIDPIAAGL 169
            + GAG ILE++        L+PFT   +  V+L+  KI+ DP    L
Sbjct: 126 ADHGAGDILEVQRVGSSETVLLPFTLAVIPTVDLRAGKIIADPPEGAL 173


>gi|99082449|ref|YP_614603.1| 16S rRNA-processing protein RimM [Ruegeria sp. TM1040]
 gi|122397563|sp|Q1GDC5|RIMM_SILST RecName: Full=Ribosome maturation factor rimM
 gi|99038729|gb|ABF65341.1| 16S rRNA processing protein RimM [Ruegeria sp. TM1040]
          Length = 171

 Score =  143 bits (362), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 49/173 (28%), Positives = 80/173 (46%), Gaps = 6/173 (3%)

Query: 1   MVK-LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKM--YRKN 57
           M    + L+ +  +  + G+ GEV + S+  N  ++  Y      + + R          
Sbjct: 1   MSDVSEDLICVGALAGSFGVRGEVRLKSFCANAEEIEDYSPLLGADGQTRYTLAITRAIK 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
             F A    ++    A  L+ ++LYA R       L +DEF++ DL  +E +D  G   G
Sbjct: 61  GGFAARIVDVETKEQADALKGVQLYAPRDRLPS--LPDDEFYHADLIGLEVYDTGGTLLG 118

Query: 118 QVCGVYNFGAGSILEIKNTM-EKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           +V  V N+GA  +LE+       T L+PFTK AV  V+L + +I+ DP A   
Sbjct: 119 RVKAVQNYGADDLLELHGPGLSATVLLPFTKAAVPTVDLSQGRIIADPPAGVF 171


>gi|237809703|ref|YP_002894143.1| 16S rRNA-processing protein RimM [Tolumonas auensis DSM 9187]
 gi|259585653|sp|C4LD26|RIMM_TOLAT RecName: Full=Ribosome maturation factor rimM
 gi|237501964|gb|ACQ94557.1| 16S rRNA processing protein RimM [Tolumonas auensis DSM 9187]
          Length = 173

 Score =  143 bits (362), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 32/174 (18%), Positives = 68/174 (39%), Gaps = 12/174 (6%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKR 59
           +D  +++  +G  +G+ G + ++S+ +NP  +  Y  +        RE+++    R N  
Sbjct: 1   MDSSIVVGRLGAVYGIKGWLKVNSFTDNPESIFDYAPWFIMDKGMWREIQLTGWKRHNNG 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I    G+D+   A  L    +           L + +++  DL        +G   G V
Sbjct: 61  LICKIDGVDSREDAQALTGADIAVLSDQLPA--LPKGDYYWRDLIGCAVVTTKGYQLGTV 118

Query: 120 CGVYNFGAGSILEIKNTME-----KTFLIPFTKF-AVLEVNLQENKILIDPIAA 167
             +   G+  +L ++  +      K  LIPF     +  +++    I +D    
Sbjct: 119 SELMETGSNDVLVVQANLNDAFGMKERLIPFIDEQVIKHIDITARLIEVDWDPG 172


>gi|256822054|ref|YP_003146017.1| 16S rRNA processing protein RimM [Kangiella koreensis DSM 16069]
 gi|256795593|gb|ACV26249.1| 16S rRNA processing protein RimM [Kangiella koreensis DSM 16069]
          Length = 173

 Score =  143 bits (362), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 35/168 (20%), Positives = 76/168 (45%), Gaps = 7/168 (4%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRK 56
           M +  K +++  +    G+ G V + SY +   ++  Y  +        +++ I+    +
Sbjct: 1   MSQAFKPLIVGKLNGASGIKGWVKVFSYTDPKENILNYSPWYLKLDGQWQQVLIINGREQ 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
            K  +A   G ++ ++A   R +++          +LEE E++  DL  +   +  G   
Sbjct: 61  GKTVVAQLEGCNDRNTAESYRGVEIAIDESQLP--QLEEGEYYWRDLVGLTVVNVAGDEM 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFA-VLEVNLQENKILID 163
           G V  +   GA  +L +K   ++  LIP+     V++V+L+  +I +D
Sbjct: 119 GTVEKMMETGANDVLVVKTASKEELLIPYVPEYSVIKVDLESKQITVD 166


>gi|218898995|ref|YP_002447406.1| 16S rRNA processing protein RimM [Bacillus cereus G9842]
 gi|228902345|ref|ZP_04066502.1| Ribosome maturation factor rimM [Bacillus thuringiensis IBL 4222]
 gi|228940930|ref|ZP_04103489.1| Ribosome maturation factor rimM [Bacillus thuringiensis serovar
           berliner ATCC 10792]
 gi|228966787|ref|ZP_04127831.1| Ribosome maturation factor rimM [Bacillus thuringiensis serovar
           sotto str. T04001]
 gi|228973859|ref|ZP_04134435.1| Ribosome maturation factor rimM [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228980449|ref|ZP_04140759.1| Ribosome maturation factor rimM [Bacillus thuringiensis Bt407]
 gi|226694908|sp|B7IUK1|RIMM_BACC2 RecName: Full=Ribosome maturation factor rimM
 gi|218544507|gb|ACK96901.1| 16S rRNA processing protein RimM [Bacillus cereus G9842]
 gi|228779269|gb|EEM27526.1| Ribosome maturation factor rimM [Bacillus thuringiensis Bt407]
 gi|228785884|gb|EEM33887.1| Ribosome maturation factor rimM [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228792886|gb|EEM40444.1| Ribosome maturation factor rimM [Bacillus thuringiensis serovar
           sotto str. T04001]
 gi|228818766|gb|EEM64832.1| Ribosome maturation factor rimM [Bacillus thuringiensis serovar
           berliner ATCC 10792]
 gi|228857314|gb|EEN01817.1| Ribosome maturation factor rimM [Bacillus thuringiensis IBL 4222]
 gi|326941611|gb|AEA17507.1| 16S rRNA-processing protein [Bacillus thuringiensis serovar
           chinensis CT-43]
          Length = 171

 Score =  143 bits (362), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 33/173 (19%), Positives = 69/173 (39%), Gaps = 9/173 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-------VLYSNDNRELRILKMYRK 56
           + K   +  I  THG+ GE+ + S  + P +  +             D   +++    + 
Sbjct: 1   MTKWFNVGKIVNTHGVRGEIRVISRTDFPEERYKVGNTLYISNEKDTDYLPVKVTSHRQH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
               + TF G +N+    + +   +    +     EL E E++  ++        +G+  
Sbjct: 61  KTFDLLTFEGYNNVDEVEKFKGSLIKVPEEQL--GELAEGEYYYHEIIGCSVVTEEGEAL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           G +  + + GA  +  IK    +  LIP+    VL+VN++   + I  +   L
Sbjct: 119 GTIKEILSPGANDVWVIKRPKGQDLLIPYIDDVVLQVNIENKLVTIHVMEGLL 171


>gi|307330036|ref|ZP_07609187.1| 16S rRNA processing protein RimM [Streptomyces violaceusniger Tu
           4113]
 gi|306884297|gb|EFN15332.1| 16S rRNA processing protein RimM [Streptomyces violaceusniger Tu
           4113]
          Length = 215

 Score =  143 bits (362), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 39/186 (20%), Positives = 82/186 (44%), Gaps = 5/186 (2%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPI-DLNRYVLYSNDN---RELRILKMYRKNKRFIAT 63
           +++A IG  HG+ GEV ++   + P   L    + + +      L I      + R +  
Sbjct: 3   LVVARIGRAHGIKGEVTVEVRTDEPELRLGPGAVLTTEPASAGPLTIESGRVHSGRLLLR 62

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F G+ +  +A  LR++ L A+    ++   + +EF++  L +++     G   G++  + 
Sbjct: 63  FEGVRDRSAAEALRNILLIAEVDP-EELPEDPEEFYDHQLIDIDVVTVDGTEVGRISEIS 121

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQYDCPL 183
           +     +L +K       +IPF    V E++L+  + +IDP    L+    +        
Sbjct: 122 HLPYQDLLIVKRPDGGEVMIPFVSEFVPEIDLEAQRAVIDPPPGLLDEAEAEIAGSRKDE 181

Query: 184 DSAGKK 189
            + G+K
Sbjct: 182 TAGGRK 187


>gi|206972753|ref|ZP_03233683.1| 16S rRNA processing protein RimM [Bacillus cereus AH1134]
 gi|218235147|ref|YP_002368643.1| 16S rRNA-processing protein RimM [Bacillus cereus B4264]
 gi|228922596|ref|ZP_04085896.1| Ribosome maturation factor rimM [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228954118|ref|ZP_04116147.1| Ribosome maturation factor rimM [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
 gi|228960058|ref|ZP_04121722.1| Ribosome maturation factor rimM [Bacillus thuringiensis serovar
           pakistani str. T13001]
 gi|229047529|ref|ZP_04193119.1| Ribosome maturation factor rimM [Bacillus cereus AH676]
 gi|229071340|ref|ZP_04204563.1| Ribosome maturation factor rimM [Bacillus cereus F65185]
 gi|229081097|ref|ZP_04213607.1| Ribosome maturation factor rimM [Bacillus cereus Rock4-2]
 gi|229111313|ref|ZP_04240866.1| Ribosome maturation factor rimM [Bacillus cereus Rock1-15]
 gi|229129118|ref|ZP_04258091.1| Ribosome maturation factor rimM [Bacillus cereus BDRD-Cer4]
 gi|229146413|ref|ZP_04274784.1| Ribosome maturation factor rimM [Bacillus cereus BDRD-ST24]
 gi|229152041|ref|ZP_04280236.1| Ribosome maturation factor rimM [Bacillus cereus m1550]
 gi|229180118|ref|ZP_04307462.1| Ribosome maturation factor rimM [Bacillus cereus 172560W]
 gi|229192011|ref|ZP_04318981.1| Ribosome maturation factor rimM [Bacillus cereus ATCC 10876]
 gi|296504337|ref|YP_003666037.1| 16S rRNA-processing protein [Bacillus thuringiensis BMB171]
 gi|33301480|sp|Q819W5|RIMM_BACCR RecName: Full=Ribosome maturation factor rimM
 gi|226694909|sp|B7HDW5|RIMM_BACC4 RecName: Full=Ribosome maturation factor rimM
 gi|206732318|gb|EDZ49510.1| 16S rRNA processing protein RimM [Bacillus cereus AH1134]
 gi|218163104|gb|ACK63096.1| 16S rRNA processing protein RimM [Bacillus cereus B4264]
 gi|228591562|gb|EEK49411.1| Ribosome maturation factor rimM [Bacillus cereus ATCC 10876]
 gi|228603327|gb|EEK60804.1| Ribosome maturation factor rimM [Bacillus cereus 172560W]
 gi|228631390|gb|EEK88024.1| Ribosome maturation factor rimM [Bacillus cereus m1550]
 gi|228637046|gb|EEK93505.1| Ribosome maturation factor rimM [Bacillus cereus BDRD-ST24]
 gi|228654355|gb|EEL10220.1| Ribosome maturation factor rimM [Bacillus cereus BDRD-Cer4]
 gi|228672089|gb|EEL27380.1| Ribosome maturation factor rimM [Bacillus cereus Rock1-15]
 gi|228702141|gb|EEL54617.1| Ribosome maturation factor rimM [Bacillus cereus Rock4-2]
 gi|228711794|gb|EEL63746.1| Ribosome maturation factor rimM [Bacillus cereus F65185]
 gi|228723776|gb|EEL75131.1| Ribosome maturation factor rimM [Bacillus cereus AH676]
 gi|228799574|gb|EEM46527.1| Ribosome maturation factor rimM [Bacillus thuringiensis serovar
           pakistani str. T13001]
 gi|228805684|gb|EEM52274.1| Ribosome maturation factor rimM [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
 gi|228837025|gb|EEM82366.1| Ribosome maturation factor rimM [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|296325389|gb|ADH08317.1| 16S rRNA-processing protein [Bacillus thuringiensis BMB171]
          Length = 171

 Score =  143 bits (362), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 33/173 (19%), Positives = 69/173 (39%), Gaps = 9/173 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-------VLYSNDNRELRILKMYRK 56
           + K   +  I  THG+ GE+ + S  + P +  +             D   +++    + 
Sbjct: 1   MTKWFNVGKIVNTHGVRGEIRVISRTDFPEERYKVGNTLYISNEKGTDYLPVKVTSHRQH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
               + TF G +N+    + +   +    +     EL E E++  ++        +G+  
Sbjct: 61  KTFDLLTFEGYNNVDEVEKFKGSLIKVPEEQL--GELAEGEYYYHEIIGCSVVTEEGEAL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           G +  + + GA  +  IK    +  LIP+    VL+VN++   + I  +   L
Sbjct: 119 GTIKEILSPGANDVWVIKRPKGQDLLIPYIDDVVLQVNIENKLVTIHVMEGLL 171


>gi|238693263|sp|B4RXC6|RIMM_ALTMD RecName: Full=Ribosome maturation factor rimM
          Length = 173

 Score =  143 bits (362), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 42/174 (24%), Positives = 74/174 (42%), Gaps = 9/174 (5%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS-NDNRELRILKMYRKNKR 59
           M      V++  IG  +G+ G V I+SY   P  +  Y  +   + +E +I +     K 
Sbjct: 1   MSLASDKVIVGKIGAPYGVKGWVKINSYTETPEGIFEYAPWFIGEEKEYQIDQWRPHGKS 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +A   G+D+   A  +++L +        D  L ++  +  +L  M+    QG   G V
Sbjct: 61  LVAKIVGVDSRDDAERIKNLDININASQLPD--LGDEGVYWRELTGMKVVTTQGYDLGVV 118

Query: 120 CGVYNFGAGSILEIKNTME-----KTFLIPFT-KFAVLEVNLQENKILIDPIAA 167
             V+N GA  ++ +K  +      K  L+PF     V EV+ +   I +D    
Sbjct: 119 KEVFNTGANDVIHVKANVGDAFGQKERLLPFVFDEVVQEVDKEAKVIKVDWDPG 172


>gi|85714455|ref|ZP_01045443.1| 16S rRNA processing protein RimM [Nitrobacter sp. Nb-311A]
 gi|85698902|gb|EAQ36771.1| 16S rRNA processing protein RimM [Nitrobacter sp. Nb-311A]
          Length = 202

 Score =  143 bits (362), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 49/168 (29%), Positives = 82/168 (48%), Gaps = 4/168 (2%)

Query: 3   KLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS--NDNRELRILKMYRKNKRF 60
           + ++ V +A IG  HGL GEV + ++  +P+ + RY   +  +  R+L +          
Sbjct: 29  EKERRVCVARIGAAHGLRGEVRLWTFTEDPMSVMRYGPLTTRDGARQLEVAHARAAKDHL 88

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +ATF+G+     A  L   +LY  R        ++DEF++ DL  +   D  G   G V 
Sbjct: 89  VATFTGVTTREEAERLNGTELYVARDKLPKT--DDDEFYHADLIGLAAVDAAGTTLGTVA 146

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAG 168
            ++NFGAG I+EI      T L+PFT   V  V++   +++I+     
Sbjct: 147 AIHNFGAGDIIEIAPAQGPTLLLPFTDAVVPTVDIAGGRVVIEIPGEI 194


>gi|148979278|ref|ZP_01815432.1| 16S rRNA-processing protein [Vibrionales bacterium SWAT-3]
 gi|145961926|gb|EDK27217.1| 16S rRNA-processing protein [Vibrionales bacterium SWAT-3]
          Length = 184

 Score =  143 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 39/177 (22%), Positives = 74/177 (41%), Gaps = 12/177 (6%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRK 56
           M K D+ ++M   G T+G+ G + + SY +N   +  Y  +         E ++    R 
Sbjct: 9   MSKQDEKIVMGKFGATYGIRGWLKVFSYTDNAESIFDYSPWYVNQKGKWVEFKVESWKRH 68

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           NK  +    G +    A  L + ++        +  L E+EF+  +L  M+    +G   
Sbjct: 69  NKGMVCKLEGFEVREDAHVLTNFEIAIDPASLPE--LSEEEFYWRELFGMQVVTTKGYDL 126

Query: 117 GQVCGVYNFGAGSILEIKNT-----MEKTFLIPFTKF-AVLEVNLQENKILIDPIAA 167
           G V  +   G+  +L IK        +K  L+P+ +   V +V+ +  +I +D    
Sbjct: 127 GVVTDMLETGSNDVLVIKANLKDAFGQKERLVPYLEEQVVKKVDREAQRIEVDWDPG 183


>gi|21223948|ref|NP_629727.1| 16S rRNA-processing protein RimM [Streptomyces coelicolor A3(2)]
 gi|256784950|ref|ZP_05523381.1| 16S rRNA-processing protein RimM [Streptomyces lividans TK24]
 gi|289768842|ref|ZP_06528220.1| 16S rRNA processing protein RimM [Streptomyces lividans TK24]
 gi|61230608|sp|P0A4D3|RIMM_STRCO RecName: Full=Ribosome maturation factor rimM
 gi|61230611|sp|P0A4D4|RIMM_STRLI RecName: Full=Ribosome maturation factor rimM
 gi|3191986|emb|CAA19385.1| putative 16S rRNA processing protein [Streptomyces coelicolor
           A3(2)]
 gi|3336921|emb|CAB06806.1| hypothetical protein [Streptomyces lividans]
 gi|289699041|gb|EFD66470.1| 16S rRNA processing protein RimM [Streptomyces lividans TK24]
          Length = 188

 Score =  143 bits (361), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 38/187 (20%), Positives = 79/187 (42%), Gaps = 5/187 (2%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPI-DLNRYVLYSNDN---RELRILKMYRKNKRFIAT 63
           +++A IG  HG+ GEV ++   + P   L    + + D      L I      + R +  
Sbjct: 3   LVVARIGRAHGIKGEVTVEVRTDEPELRLGPGAVLATDPASTGPLTIESGRVHSGRLLLR 62

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F+G+ +   A  LR+  L A     +  E +EDE+++  L +++     G   G++  + 
Sbjct: 63  FAGVHDRTGAEALRNTLLIADVDPDERPE-DEDEYYDHQLIDLDVVTEDGTEVGRITEIS 121

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQYDCPL 183
           +     +  ++        +PF    V  ++L   + +IDP    +++        D   
Sbjct: 122 HLPTQDLFVVERPDGSEVYVPFVSEIVTGIDLDAQRAVIDPPPGLIDDRAEIASARDAGA 181

Query: 184 DSAGKKS 190
           + AG ++
Sbjct: 182 EDAGDEA 188


>gi|320008293|gb|ADW03143.1| 16S rRNA processing protein RimM [Streptomyces flavogriseus ATCC
           33331]
          Length = 210

 Score =  143 bits (361), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 37/190 (19%), Positives = 78/190 (41%), Gaps = 11/190 (5%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNR----YVLYSNDNRELRILKMYRKNKRFIAT 63
           +++A IG  HG+ GEV ++   + P                   L I      + R +  
Sbjct: 3   LVVARIGRAHGIKGEVTVEVRTDEPELRLGPGAVLATEPAGTGPLTIETGRVHSGRLLLR 62

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F G+ +  +A  LR+  L     D  +   + +EF++  L +++     G   G++  + 
Sbjct: 63  FEGVRDRSAAEALRN-TLLIAEVDPAELPDDPEEFYDHQLMDLDVVLGDGTEIGRITEIS 121

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMK------NP 177
           +  +  +  ++       +IPF +  V E++L+E +I+I P    ++ +  +        
Sbjct: 122 HLPSQDLFIVERPDGSEVMIPFVEEIVTEIDLEEQRIVIAPPPGLIDESEAEVASARDAE 181

Query: 178 QYDCPLDSAG 187
             +   D AG
Sbjct: 182 GAEEDADPAG 191


>gi|160880538|ref|YP_001559506.1| 16S rRNA processing protein RimM [Clostridium phytofermentans ISDg]
 gi|189040130|sp|A9KLM3|RIMM_CLOPH RecName: Full=Ribosome maturation factor rimM
 gi|160429204|gb|ABX42767.1| 16S rRNA processing protein RimM [Clostridium phytofermentans ISDg]
          Length = 169

 Score =  143 bits (361), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 44/171 (25%), Positives = 79/171 (46%), Gaps = 6/171 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND----NRELRILKMYRKNKR 59
           ++ L+ +  I +THG+ GEV +    ++     +  + + D     +EL I  +    + 
Sbjct: 1   MEDLLRVGVISSTHGIKGEVKVFPTTDDMNRFKKLKMVTLDTGKEQKELEIENVKFFKQF 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F GIDNI+   + +   L   R++    +L E EFF  DL  ++  +  G   G++
Sbjct: 61  VILKFKGIDNINDIEKYKGKDLLISREN--AVDLAEGEFFIFDLIGLQAEEEDGNSLGEL 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
             V   GA  +  IK    K  LIP+    V +++L E K+++  I   + 
Sbjct: 119 TEVLQTGANDVFVIKTKQGKEILIPYIDDCVKKIDLNEKKLVVHLIPGLVE 169


>gi|329936720|ref|ZP_08286427.1| 16S rRNA-processing protein RimM [Streptomyces griseoaurantiacus
           M045]
 gi|329303950|gb|EGG47833.1| 16S rRNA-processing protein RimM [Streptomyces griseoaurantiacus
           M045]
          Length = 211

 Score =  143 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 40/184 (21%), Positives = 79/184 (42%), Gaps = 6/184 (3%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNR----YVLYSNDNRELRILKMYRKNKRFIAT 63
           +++A IG  HG+ GEV ++   + P                   L I      + R +  
Sbjct: 3   LVVARIGRAHGIKGEVTVEVRTDEPELRLAPGAVLATDPPSAGPLTIETGRVHSGRLLLR 62

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F G+ +  +A  LR+  L A   D ++    EDE+++  L +++     G   G++  V 
Sbjct: 63  FEGVRDRTAAEALRNTVLIADV-DPEEMPEGEDEYYDHQLMDLDVVTVDGTEVGRITEVS 121

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN-TTMKNPQYDCP 182
           +  +  +  ++       +IPF +  V E++L E K +IDP    +++   + + + D  
Sbjct: 122 HLPSQDLFVVERPDGTEVMIPFVEEIVTEIDLAEQKAVIDPPPGLIDDRAEIASAREDAA 181

Query: 183 LDSA 186
            D  
Sbjct: 182 EDRP 185


>gi|65321170|ref|ZP_00394129.1| COG0806: RimM protein, required for 16S rRNA processing [Bacillus
           anthracis str. A2012]
          Length = 171

 Score =  143 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 34/173 (19%), Positives = 66/173 (38%), Gaps = 9/173 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-------VLYSNDNRELRILKMYRK 56
           + K   +  I  THG+ GE+ + S  + P +  +             +   ++     + 
Sbjct: 1   MTKWFNVGKIVNTHGVKGEIRVVSRTDFPEERYKVGNTLYISNEKGGEPFPVKXTSHRQH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
               + TF G  N++   + +   L          EL E E++  ++        +G+  
Sbjct: 61  KTFDLLTFEGYGNVNEVEQFKGSLLKVPEDQL--GELAEGEYYYHEIIGCNVVTEEGEAL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           G +  V + GA  +  IK    +  LIP+    VL+VN++   + I      L
Sbjct: 119 GTIKEVLSPGANDVWVIKRPKGQDLLIPYIDDVVLQVNIENKLVTIHVTEGLL 171


>gi|152985572|ref|YP_001346759.1| 16S rRNA-processing protein RimM [Pseudomonas aeruginosa PA7]
 gi|166226466|sp|A6V124|RIMM_PSEA7 RecName: Full=Ribosome maturation factor rimM
 gi|150960730|gb|ABR82755.1| 16S rRNA processing protein RimM [Pseudomonas aeruginosa PA7]
          Length = 175

 Score =  143 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 37/167 (22%), Positives = 77/167 (46%), Gaps = 10/167 (5%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRKNKRF 60
           D LV++  I + +G+ GEV + S+ +   +L  Y  +      + R+  +++     K  
Sbjct: 6   DDLVVIGKIVSVYGIRGEVKVYSFTDPLDNLLDYRRWTLRRDGETRQAELVRGRLHGKVL 65

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
            A   G+D+   A      ++   R +     LEE E++   LE ++  D+ G+  G + 
Sbjct: 66  AAKLKGLDDREEARTFTGYEICIPRSELPS--LEEGEYYWYQLEGLKVIDQGGQLLGVID 123

Query: 121 GVYNFGAGSILEIKNT----MEKTFLIPFTKFAVLEVNLQENKILID 163
            +   GA  ++ +K       ++  L+P+T   VL ++L   ++ +D
Sbjct: 124 HLLETGANDVMVVKPCAGSLDDRERLLPYTGQCVLSIDLAAGEMRVD 170


>gi|86747477|ref|YP_483973.1| 16S rRNA-processing protein RimM [Rhodopseudomonas palustris HaA2]
 gi|109893041|sp|Q2J398|RIMM_RHOP2 RecName: Full=Ribosome maturation factor rimM
 gi|86570505|gb|ABD05062.1| 16S rRNA processing protein RimM [Rhodopseudomonas palustris HaA2]
          Length = 182

 Score =  143 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 48/174 (27%), Positives = 79/174 (45%), Gaps = 5/174 (2%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS--NDNRELRILKMYRKNKRFIATFS 65
           V +A IG  HG+ G + + S+  +P+ +  Y   S  +  R   I          + T  
Sbjct: 12  VCVARIGAPHGVRGAMRLWSFTADPLAVGDYGPLSTKDGTRSFEIATARAAKDHLVVTLK 71

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNF 125
           G+     A  L  L+LY  R      E +E  +++ DL  +      G+  G+V  ++NF
Sbjct: 72  GVTTRDEAVRLNGLELYVPRDALPPTEDDE--YYHADLIGLPAITTSGEPLGRVLAIHNF 129

Query: 126 GAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQY 179
           GAG I+EI      T L+PFT   V  V+L   +++I+  A  +   T  +P+ 
Sbjct: 130 GAGDIIEIAPASGPTLLLPFTNAVVPTVDLAAGQVIIELPAE-IEGDTPNHPEA 182


>gi|308048459|ref|YP_003912025.1| 16S rRNA processing protein RimM [Ferrimonas balearica DSM 9799]
 gi|307630649|gb|ADN74951.1| 16S rRNA processing protein RimM [Ferrimonas balearica DSM 9799]
          Length = 175

 Score =  143 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 37/173 (21%), Positives = 83/173 (47%), Gaps = 13/173 (7%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRK 56
           M   + L+++  +G+ +G+ G + ++++ ++   +  Y  +      + +E+++    R 
Sbjct: 1   MSNKE-LIVVGRLGSAYGIRGWLKVNAFTDSLEGIFEYSPWLVLHQGEWQEMKVADWRRH 59

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           N   I   +G+++ + A +  +  +       +   L EDEF+  DL      + QG   
Sbjct: 60  NNGIICRLAGVEDRNQAEQYINCDVAILPAQLEA--LPEDEFYWRDLVGCTVVNTQGYDM 117

Query: 117 GQVCGVYNFGAGSILEIKNT-----MEKTFLIPFT-KFAVLEVNLQENKILID 163
           G+V G+   G+  +LE++        ++  LIPF  +  +LEV+    KI++D
Sbjct: 118 GKVTGLLETGSNDVLEVEAKSNDAFGKRERLIPFVTEQFILEVDTLGKKIVVD 170


>gi|297559208|ref|YP_003678182.1| 16S rRNA processing protein RimM [Nocardiopsis dassonvillei subsp.
           dassonvillei DSM 43111]
 gi|296843656|gb|ADH65676.1| 16S rRNA processing protein RimM [Nocardiopsis dassonvillei subsp.
           dassonvillei DSM 43111]
          Length = 170

 Score =  143 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 36/170 (21%), Positives = 68/170 (40%), Gaps = 6/170 (3%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNR----YVLYSNDNRELRILKMYRKNKRFIAT 63
           +++  IG  HG+ G+V +D   ++P               +   L ++   R + R +  
Sbjct: 3   LVVGRIGRAHGVRGDVAVDVRTDDPAARFADGSVLATDPAEAGPLTVVSTRRHSGRLLVR 62

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F G+ +  +A  LR   L    +D    E  ++ F + +L  +       +  G V  V 
Sbjct: 63  FEGVADRDAAEGLRGTALLVDSEDIPPLEDPDE-FHDHELIGLAAVTTGAEPVGTVADVL 121

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTT 173
           +  A  +L +         +PF    V EV++   +I+IDP    L+   
Sbjct: 122 HH-AQDLLVVTTPDGAEVYVPFVAALVPEVDVAGGRIVIDPPPGLLDLAD 170


>gi|146281576|ref|YP_001171729.1| 16S rRNA-processing protein RimM [Pseudomonas stutzeri A1501]
 gi|166226469|sp|A4VIT6|RIMM_PSEU5 RecName: Full=Ribosome maturation factor rimM
 gi|145569781|gb|ABP78887.1| 16S rRNA processing protein [Pseudomonas stutzeri A1501]
          Length = 178

 Score =  143 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 38/175 (21%), Positives = 88/175 (50%), Gaps = 14/175 (8%)

Query: 1   MVKL----DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILK 52
           M  +    D+LV++  I + HG+ G+V + S+ +   +L  Y  ++    ++ +++ ++K
Sbjct: 1   MSAMSAPSDELVVIGKIVSVHGVRGDVKVYSFTDPIDNLLDYRRWTLRRGDEVKQVELVK 60

Query: 53  MYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQ 112
              + K  +A+  G+ +   A    D ++   R +     L++ E++   L+ ++  ++ 
Sbjct: 61  GRLQGKILVASLKGLTDREVARTYADFEICVPRSELPA--LDDGEYYWYQLQGLKVLNQA 118

Query: 113 GKYWGQVCGVYNFGAGSILEIKNT----MEKTFLIPFTKFAVLEVNLQENKILID 163
           G+  GQV  +   GA  +L +K       ++  L+P+T   VL+V+L   ++ +D
Sbjct: 119 GQLLGQVDHLLETGANDVLVVKPCAGSLDDRERLLPYTDHCVLKVDLDSGEMQVD 173


>gi|325571318|ref|ZP_08146818.1| 16S rRNA processing protein RimM [Enterococcus casseliflavus ATCC
           12755]
 gi|325155794|gb|EGC67990.1| 16S rRNA processing protein RimM [Enterococcus casseliflavus ATCC
           12755]
          Length = 174

 Score =  143 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 36/176 (20%), Positives = 77/176 (43%), Gaps = 8/176 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR------YVLYSNDNRELRILKMYRKN 57
           + + + +  I  THG+ GEV + S  + P +  R          + +   L +    +  
Sbjct: 1   MTEYLNVGKIVNTHGIRGEVRVISQTDFPEERYRKGAELTLFRENKEPITLIVSGHRKHK 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              + TF G  NI+     R+  L   + D    +L E+EF+  ++  +E  +  G   G
Sbjct: 61  NFDLVTFEGYPNINDVEPFRNGILKVTKDDL--VDLAENEFYYHEIIGLEVVEEDGTIIG 118

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTT 173
           +V  + + GA  +  ++   +K  LIP+ +  V  ++L+  ++ ++     L++  
Sbjct: 119 KVKEILSPGANDVWVVQRKGKKDALIPYIESVVHTIDLENGQVTVEIPEGLLDDEN 174


>gi|257877633|ref|ZP_05657286.1| ribosome maturation factor rimM [Enterococcus casseliflavus EC20]
 gi|257811799|gb|EEV40619.1| ribosome maturation factor rimM [Enterococcus casseliflavus EC20]
          Length = 174

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 36/176 (20%), Positives = 77/176 (43%), Gaps = 8/176 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR------YVLYSNDNRELRILKMYRKN 57
           + + + +  I  THG+ GEV + S  + P +  R          + +   L +    +  
Sbjct: 1   MTEYLNVGKIVNTHGIRGEVRVISQTDFPEERYRKGAELTLFRENKEPLPLIVSGHRKHK 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              + TF G  NI+     R+  L   + D    +L E+EF+  ++  +E  +  G   G
Sbjct: 61  NFDLLTFEGYSNINDVEPFRNGILKVTKDDL--VDLAENEFYYHEIIGLEVVEEDGTVIG 118

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTT 173
           +V  + + GA  +  ++   +K  LIP+ +  V  ++L+  ++ ++     L++  
Sbjct: 119 KVKEILSPGANDVWVVQRKGKKDALIPYIESVVHTIDLENGQVTVEIPEGLLDDEN 174


>gi|296446375|ref|ZP_06888320.1| 16S rRNA processing protein RimM [Methylosinus trichosporium OB3b]
 gi|296256148|gb|EFH03230.1| 16S rRNA processing protein RimM [Methylosinus trichosporium OB3b]
          Length = 186

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 51/168 (30%), Positives = 85/168 (50%), Gaps = 6/168 (3%)

Query: 3   KLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRK---NKR 59
           ++   VL+  +G  HG+ GE+ + S+  +P  ++ Y    + + + R +    +      
Sbjct: 13  RMKNAVLLGRLGAAHGVRGEIRLQSFTADPAAISTYGPLFDASGQRRFVIASLRSLGKDM 72

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
           F+A   G+    +A  LR ++LY  R+       +EDEF+  DLE +    R G+  G V
Sbjct: 73  FVARLQGVSERSAAEALRGVELYVPREALPAP--DEDEFYLADLEGLRAETRAGETLGVV 130

Query: 120 CGVYNFGAGSILEIKNT-MEKTFLIPFTKFAVLEVNLQENKILIDPIA 166
             V NFGAG ILEI      +T L+PFTK  V  V++   ++L++P  
Sbjct: 131 IAVRNFGAGDILEIAPPQGGETLLLPFTKAVVPIVDVSGGRVLVEPPE 178


>gi|257867551|ref|ZP_05647204.1| ribosome maturation factor rimM [Enterococcus casseliflavus EC30]
 gi|257873880|ref|ZP_05653533.1| ribosome maturation factor rimM [Enterococcus casseliflavus EC10]
 gi|257801607|gb|EEV30537.1| ribosome maturation factor rimM [Enterococcus casseliflavus EC30]
 gi|257808044|gb|EEV36866.1| ribosome maturation factor rimM [Enterococcus casseliflavus EC10]
          Length = 174

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 36/176 (20%), Positives = 77/176 (43%), Gaps = 8/176 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR------YVLYSNDNRELRILKMYRKN 57
           + + + +  I  THG+ GEV + S  + P +  R          + +   L +    +  
Sbjct: 1   MTEYLNVGKIVNTHGIRGEVRVISQTDFPEERYRKGAELTLFRENKEPLPLIVSGHRKHK 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              + TF G  NI+     R+  L   + D    +L E+EF+  ++  +E  +  G   G
Sbjct: 61  NFDLLTFEGYPNINDVEPFRNGILKVTKDDL--VDLAENEFYYHEIIGLEVVEEDGTVIG 118

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTT 173
           +V  + + GA  +  ++   +K  LIP+ +  V  ++L+  ++ ++     L++  
Sbjct: 119 KVKEILSPGANDVWVVQRKGKKDALIPYIESVVHTIDLENGQVTVEIPEGLLDDEN 174


>gi|30263845|ref|NP_846222.1| 16S rRNA-processing protein RimM [Bacillus anthracis str. Ames]
 gi|47529270|ref|YP_020619.1| 16S rRNA-processing protein RimM [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|227813250|ref|YP_002813259.1| 16S rRNA processing protein RimM [Bacillus anthracis str. CDC 684]
 gi|229600064|ref|YP_002868079.1| 16S rRNA processing protein RimM [Bacillus anthracis str. A0248]
 gi|254683450|ref|ZP_05147310.1| 16S rRNA-processing protein RimM [Bacillus anthracis str.
           CNEVA-9066]
 gi|254735880|ref|ZP_05193586.1| 16S rRNA-processing protein RimM [Bacillus anthracis str. Western
           North America USA6153]
 gi|254751179|ref|ZP_05203218.1| 16S rRNA-processing protein RimM [Bacillus anthracis str. Vollum]
 gi|254756727|ref|ZP_05208756.1| 16S rRNA-processing protein RimM [Bacillus anthracis str. Australia
           94]
 gi|33301488|sp|Q81WJ5|RIMM_BACAN RecName: Full=Ribosome maturation factor rimM
 gi|254797741|sp|C3P5P3|RIMM_BACAA RecName: Full=Ribosome maturation factor rimM
 gi|254797742|sp|C3L785|RIMM_BACAC RecName: Full=Ribosome maturation factor rimM
 gi|30258489|gb|AAP27708.1| 16S rRNA processing protein RimM [Bacillus anthracis str. Ames]
 gi|47504418|gb|AAT33094.1| 16S rRNA processing protein RimM [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|227005104|gb|ACP14847.1| 16S rRNA processing protein RimM [Bacillus anthracis str. CDC 684]
 gi|229264472|gb|ACQ46109.1| 16S rRNA processing protein RimM [Bacillus anthracis str. A0248]
          Length = 171

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 35/173 (20%), Positives = 67/173 (38%), Gaps = 9/173 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-------VLYSNDNRELRILKMYRK 56
           + K   +  I  THG+ GE+ + S  + P +  +             +   ++I    + 
Sbjct: 1   MTKWFNVGKIVNTHGVKGEIRVVSRTDFPEERYKVGNTLYISNEKGGEPFPVKITSHRQH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
               + TF G  N++   + +   L          EL E E++  ++        +G+  
Sbjct: 61  KTFDLLTFEGYGNVNEVEQFKGSLLKVPEDQL--GELAEGEYYYHEIIGCNVVTEEGEAL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           G +  V + GA  +  IK    +  LIP+    VL+VN++   + I      L
Sbjct: 119 GTIKEVLSPGANDVWVIKRPKGQDLLIPYIDDVVLQVNIENKLVTIHVTEGLL 171


>gi|262401734|ref|ZP_06078300.1| 16S rRNA processing protein RimM [Vibrio sp. RC586]
 gi|262352151|gb|EEZ01281.1| 16S rRNA processing protein RimM [Vibrio sp. RC586]
          Length = 184

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 40/173 (23%), Positives = 78/173 (45%), Gaps = 12/173 (6%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRK 56
           M K ++ +++  +G+++G+ G + + SY +NP  +  Y  +      +  E ++    R 
Sbjct: 9   MGKQNERLVVGKLGSSYGIRGWLKVFSYTDNPESIFDYSPWFIDQKGEWVEYKVEGWKRH 68

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           NK ++    G+D    A  L + ++        +  L EDEF+  +L  M+     G   
Sbjct: 69  NKGWVVKLQGLDVREDAHLLTNFEIAIDPASLPE--LSEDEFYWRELFGMQVVTTNGYDL 126

Query: 117 GQVCGVYNFGAGSILEIKNT-----MEKTFLIPFTKF-AVLEVNLQENKILID 163
           G V  +   G+  +L +K        +K  LIPF +   +  V+ Q  +I +D
Sbjct: 127 GVVTDMMETGSNDVLVVKANLKDAFGQKERLIPFLEEQVIKVVDRQAQRIEVD 179


>gi|189425509|ref|YP_001952686.1| 16S rRNA processing protein RimM [Geobacter lovleyi SZ]
 gi|209573557|sp|B3E5S5|RIMM_GEOLS RecName: Full=Ribosome maturation factor rimM
 gi|189421768|gb|ACD96166.1| 16S rRNA processing protein RimM [Geobacter lovleyi SZ]
          Length = 176

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 38/172 (22%), Positives = 77/172 (44%), Gaps = 8/172 (4%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-----YVLYSNDNRELRILKMYRKNKR 59
           D L+ +  I  THG+ G++ + SY+ N   L           +   R++++ K    + +
Sbjct: 6   DNLIAVGRISGTHGIRGQLRLHSYSGNLESLQAAKNVLIRFPAGGTRQIQLKKAAYHSGK 65

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
           F+ T  G D I  A EL   +L  +R+     + +E  ++  DL  +     +G+  G +
Sbjct: 66  FLLTLEGFDTIEKAQELAGAELLLQREQLPPPDADE--YYWHDLLGLSVVTNEGQALGII 123

Query: 120 CGVYNFGAGSILEIKNTM-EKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
             +   GA  +  +++   ++ +LIP     +  VN+    + I P+   L+
Sbjct: 124 KDILETGANDVYLVRDDATKREYLIPAIASVISSVNIHTGTMTITPLEGLLD 175


>gi|163941580|ref|YP_001646464.1| 16S rRNA-processing protein [Bacillus weihenstephanensis KBAB4]
 gi|229013025|ref|ZP_04170190.1| Ribosome maturation factor rimM [Bacillus mycoides DSM 2048]
 gi|229061445|ref|ZP_04198790.1| Ribosome maturation factor rimM [Bacillus cereus AH603]
 gi|229134650|ref|ZP_04263459.1| Ribosome maturation factor rimM [Bacillus cereus BDRD-ST196]
 gi|229168581|ref|ZP_04296304.1| Ribosome maturation factor rimM [Bacillus cereus AH621]
 gi|229485581|sp|A9VT80|RIMM_BACWK RecName: Full=Ribosome maturation factor rimM
 gi|163863777|gb|ABY44836.1| 16S rRNA processing protein RimM [Bacillus weihenstephanensis
           KBAB4]
 gi|228614987|gb|EEK72089.1| Ribosome maturation factor rimM [Bacillus cereus AH621]
 gi|228648696|gb|EEL04722.1| Ribosome maturation factor rimM [Bacillus cereus BDRD-ST196]
 gi|228717868|gb|EEL69516.1| Ribosome maturation factor rimM [Bacillus cereus AH603]
 gi|228748279|gb|EEL98139.1| Ribosome maturation factor rimM [Bacillus mycoides DSM 2048]
          Length = 171

 Score =  142 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 33/173 (19%), Positives = 70/173 (40%), Gaps = 9/173 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-------YVLYSNDNRELRILKMYRK 56
           + K   +  I  THG+ GE+ + S  + P +  +       +     D   +++    + 
Sbjct: 1   MTKWFNVGKIVNTHGVKGEIRVISRTDFPEERYKVGNTLYIWDEKGTDYLTVKVTSHRQH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
               + T  G +N+    +L+   +    +     EL E E++  ++        +G+  
Sbjct: 61  KTFDLLTLEGYNNVDEVEKLKGSLIKVPEEQL--GELAEGEYYYHEIIGCNVVTEEGEAL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           G +  + + GA  +  IK    +  LIP+    VL+VN++   + I  +   L
Sbjct: 119 GTIKEILSPGANDVWVIKRPKGQDLLIPYIDDVVLQVNIENKLVTIHVMEGLL 171


>gi|229019037|ref|ZP_04175878.1| Ribosome maturation factor rimM [Bacillus cereus AH1273]
 gi|229025283|ref|ZP_04181703.1| Ribosome maturation factor rimM [Bacillus cereus AH1272]
 gi|228736036|gb|EEL86611.1| Ribosome maturation factor rimM [Bacillus cereus AH1272]
 gi|228742277|gb|EEL92436.1| Ribosome maturation factor rimM [Bacillus cereus AH1273]
          Length = 171

 Score =  142 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 33/173 (19%), Positives = 69/173 (39%), Gaps = 9/173 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-------YVLYSNDNRELRILKMYRK 56
           + K   +  I  THG+ GE+ + S  + P +  +             D   +++    + 
Sbjct: 1   MTKWFNVGKIVNTHGVRGEIRVISRTDFPEERYKVGNTLYICNEKGTDYLPVKVTSHRQH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
               + T  G +N+    +L+   +    +     EL E E++  ++        +G+  
Sbjct: 61  KTFDLLTLEGYNNVDEVEKLKGSLIKVPEEQL--GELAEGEYYYHEIIGCSVVTEEGEAL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           G +  + + GA  +  IK    +  LIP+    VL+VN++   + I  +   L
Sbjct: 119 GTIKEILSPGANDVWVIKRPKGQDLLIPYIDDVVLQVNIENKLVTIHVMEGLL 171


>gi|56460826|ref|YP_156107.1| 16S rRNA-processing protein RimM [Idiomarina loihiensis L2TR]
 gi|67461320|sp|Q5QUU9|RIMM_IDILO RecName: Full=Ribosome maturation factor rimM
 gi|56179836|gb|AAV82558.1| RimM [Idiomarina loihiensis L2TR]
          Length = 174

 Score =  142 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 36/173 (20%), Positives = 74/173 (42%), Gaps = 11/173 (6%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY---SNDNRELRILKMYRKNK 58
           ++  + +++  IG  +G+ G + + S+ ++P  +  Y  +       RE+++++  R N 
Sbjct: 1   MQQSEQIVVGRIGAVYGVKGWLKVQSFTDDPESIFEYSPWLLSQKTEREMKVVEWRRHNN 60

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
             IA   GI +   A+ L    +     +     L +DEF+  DL  M   +  G   G 
Sbjct: 61  GLIARLEGISDRDEAARLTGADICITADELPA--LADDEFYWRDLIGMRVVNTNGYDMGV 118

Query: 119 VCGVYNFGAGSILEIKNT-----MEKTFLIPFTK-FAVLEVNLQENKILIDPI 165
           V  +    +  +L +K        +   LIPF +   V  V+ +  +I ++  
Sbjct: 119 VEQIMPTASNDVLVVKANSNDGFGKSERLIPFIQSEYVTAVDKEAKQIQVEWP 171


>gi|146308419|ref|YP_001188884.1| 16S rRNA-processing protein [Pseudomonas mendocina ymp]
 gi|166226467|sp|A4XXT6|RIMM_PSEMY RecName: Full=Ribosome maturation factor rimM
 gi|145576620|gb|ABP86152.1| 16S rRNA processing protein RimM [Pseudomonas mendocina ymp]
          Length = 178

 Score =  142 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 36/167 (21%), Positives = 80/167 (47%), Gaps = 10/167 (5%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRKNKRF 60
           + L+++  I + HG+ GEV + S+ +   ++  Y  +      + +++ +     + K  
Sbjct: 9   EDLIVLGKIVSVHGVRGEVKVYSFTDPIDNVLDYRHWTLRRDGEVKKVELASGRLQGKVL 68

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +A   G+D+   A      ++   R +  D  LEE EF+   L+ ++  D+ G+  G V 
Sbjct: 69  VAKLKGLDDREIARTYAGFEICVPRSELPD--LEEGEFYWYQLQGLKVIDQAGQLLGVVD 126

Query: 121 GVYNFGAGSILEIKNT----MEKTFLIPFTKFAVLEVNLQENKILID 163
            ++  GA  ++ +K       ++  L+P+T   VL ++L   ++ +D
Sbjct: 127 HLFETGANDVMVVKACAGSLDDRERLLPYTDQCVLSIDLAAGEMRVD 173


>gi|261210131|ref|ZP_05924429.1| 16S rRNA processing protein RimM [Vibrio sp. RC341]
 gi|260840896|gb|EEX67438.1| 16S rRNA processing protein RimM [Vibrio sp. RC341]
          Length = 176

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 40/173 (23%), Positives = 78/173 (45%), Gaps = 12/173 (6%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRK 56
           M K ++ +++  +G+++G+ G + + SY +NP  +  Y  +      +  E ++    R 
Sbjct: 1   MGKQNERLVVGKLGSSYGIRGWLKVFSYTDNPESIFDYSPWFIDQKGEWVEHKVEGWKRH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           NK ++    G+D    A  L + ++        +  L EDEF+  +L  M+     G   
Sbjct: 61  NKGWVVKLQGLDVREDAHLLTNFEIAIDPASLPE--LSEDEFYWRELFGMQVVTSSGYDL 118

Query: 117 GQVCGVYNFGAGSILEIKNT-----MEKTFLIPFTKF-AVLEVNLQENKILID 163
           G V  +   G+  +L +K        +K  LIPF +   +  V+ Q  +I +D
Sbjct: 119 GVVTDMMETGSNDVLVVKANLKDAFGQKERLIPFLEEQVIKVVDRQAQRIEVD 171


>gi|229162778|ref|ZP_04290735.1| Ribosome maturation factor rimM [Bacillus cereus R309803]
 gi|228620660|gb|EEK77529.1| Ribosome maturation factor rimM [Bacillus cereus R309803]
          Length = 171

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 33/173 (19%), Positives = 69/173 (39%), Gaps = 9/173 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-------VLYSNDNRELRILKMYRK 56
           + K   +  I  THG+ GE+ + S  + P +  +             D   +++    + 
Sbjct: 1   MTKWFNVGKIVNTHGVRGEIRVISRTDFPEERYKVGNTLYISNEKDTDYLPVKVTSHRQH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
               + T  G +N+    +L+   +    +     EL E E++  ++        +G+  
Sbjct: 61  KTFDLLTLEGYNNVDEVEKLKGSLIKVPEEQL--GELAEGEYYYHEIIGCSVVTEEGEAL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           G +  + + GA  +  IK    +  LIP+    VL+VN++   + I  +   L
Sbjct: 119 GTIKEILSPGANDVWVIKRPKGQDLLIPYIDDVVLQVNIENKLVTIHVMEGLL 171


>gi|327479754|gb|AEA83064.1| 16S rRNA-processing protein RimM [Pseudomonas stutzeri DSM 4166]
          Length = 175

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 36/167 (21%), Positives = 85/167 (50%), Gaps = 10/167 (5%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRF 60
           D+LV++  I + HG+ G+V + S+ +   +L  Y  ++    ++ +++ ++K   +    
Sbjct: 6   DELVVIGKIVSVHGVRGDVKVYSFTDPIDNLLDYRRWTLRRGDEVKQVELVKGRLQGNIL 65

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +A+  G+ +   A    D ++   R +     L++ E++   L+ ++  ++ G+  GQV 
Sbjct: 66  VASLKGLTDREVARTYADFEICVPRSELPA--LDDGEYYWYQLQGLKVLNQAGQLLGQVD 123

Query: 121 GVYNFGAGSILEIKNT----MEKTFLIPFTKFAVLEVNLQENKILID 163
            +   GA  +L +K       ++  L+P+T   VL+V+L   ++ +D
Sbjct: 124 HLLETGANDVLVVKPCAGSLDDRERLLPYTDHCVLKVDLDSGEMQVD 170


>gi|111225150|ref|YP_715944.1| 16S rRNA-processing protein RimM [Frankia alni ACN14a]
 gi|122953795|sp|Q0RDP3|RIMM_FRAAA RecName: Full=Ribosome maturation factor rimM
 gi|111152682|emb|CAJ64423.1| 16S rRNA processing protein rimM [Frankia alni ACN14a]
          Length = 180

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 36/180 (20%), Positives = 74/180 (41%), Gaps = 11/180 (6%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVL---YSNDNRELRILKMYRKNKRF 60
           + + +++  IG  HG+ G+V I+   + P                  L + +    + R 
Sbjct: 1   MTEPIVVGRIGRPHGVRGDVTIEVRTDLPQRRFALGAVLGREGGGAPLTVAEARWHSGRL 60

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDE--------FFNTDLEEMETFDRQ 112
           +  F G+++  +A  LRD+ L     +      ++++        +++ DL  +E     
Sbjct: 61  LLRFQGVEDRGAAEALRDVLLTIDSAEAGPPVDDDEDAEGEGGDIWWDRDLVGLEAVTTA 120

Query: 113 GKYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNT 172
           G   G+V  V +  AG +L +        L+PF +  V  V+    +I++DP    L+  
Sbjct: 121 GATLGRVTDVIHAPAGDLLAVGRPGGGEHLVPFVREIVPTVDPAAGRIVVDPPPGLLDLD 180


>gi|52785581|ref|YP_091410.1| 16S rRNA-processing protein RimM [Bacillus licheniformis ATCC
           14580]
 gi|163119432|ref|YP_078995.2| 16S rRNA-processing protein RimM [Bacillus licheniformis ATCC
           14580]
 gi|319646017|ref|ZP_08000247.1| 16S rRNA-processing protein rimM [Bacillus sp. BT1B_CT2]
 gi|81385584|sp|Q65JP7|RIMM_BACLD RecName: Full=Ribosome maturation factor rimM
 gi|52348083|gb|AAU40717.1| RimM [Bacillus licheniformis ATCC 14580]
 gi|145902939|gb|AAU23357.2| 16S rRNA processing protein [Bacillus licheniformis ATCC 14580]
 gi|317391767|gb|EFV72564.1| 16S rRNA-processing protein rimM [Bacillus sp. BT1B_CT2]
          Length = 174

 Score =  142 bits (358), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 34/178 (19%), Positives = 75/178 (42%), Gaps = 11/178 (6%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-------YVLYSNDNRELRILKM 53
           M+K  +   +  I  THG+ GEV + S  + P +  +       ++   ++  ++ +   
Sbjct: 1   MLK--QWFNVGKIVNTHGVKGEVRVISRTDFPEERYKPGNALYLFLEGKDEPVQVTVSAH 58

Query: 54  YRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQG 113
               +  +  F  ++ +  A +L++  +          +L EDE++  ++   + F   G
Sbjct: 59  RLHKQFHLLQFKEVETLTEAEKLKNALIKVPEDQL--SQLAEDEYYFHEIIGCDVFSEDG 116

Query: 114 KYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN 171
              G+V  +   GA  +  +    +K  LIP+    V E+N+ +  I I  +   L+ 
Sbjct: 117 DLIGKVKEILTPGANDVWVVARPGKKDALIPYIDAVVKEINVADKTIKIHIMEGLLDE 174


>gi|297584016|ref|YP_003699796.1| 16S rRNA processing protein RimM [Bacillus selenitireducens MLS10]
 gi|297142473|gb|ADH99230.1| 16S rRNA processing protein RimM [Bacillus selenitireducens MLS10]
          Length = 174

 Score =  141 bits (357), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 40/175 (22%), Positives = 76/175 (43%), Gaps = 8/175 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPID-------LNRYVLYSNDNRELRILKMYRK 56
           + K + +  I  THG++GEV + S  +   +       L  Y    +    + ++   + 
Sbjct: 1   MSKWLNVGKIVNTHGIHGEVRVISRTDFKEERYAKGRELFLYNPEKDHRTSVTVVSWRQH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
            +  + TF G  N++     RD  L     D  D   EEDEF+  ++  +   D QG   
Sbjct: 61  KQFDLLTFEGYTNVNDVEGFRDHLLQVDGDDLDDPM-EEDEFYYHEIIGLSVVDEQGIEI 119

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN 171
           G+V  + + GA  +  ++   +K  LIP+    VL V+L++  + +      ++ 
Sbjct: 120 GRVKEILSPGANDVWVVQRQGKKDALIPYIDDVVLSVDLEDGVVHVRIPEGLIDE 174


>gi|163803445|ref|ZP_02197318.1| 16S rRNA-processing protein [Vibrio sp. AND4]
 gi|159172746|gb|EDP57594.1| 16S rRNA-processing protein [Vibrio sp. AND4]
          Length = 184

 Score =  141 bits (357), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 37/177 (20%), Positives = 74/177 (41%), Gaps = 12/177 (6%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRK 56
           M K ++ ++M   G T+G+ G + + SY +N   +  Y  +         E ++    R 
Sbjct: 9   MSKQNEKIVMGKFGATYGIRGWLKVFSYTDNAESIFDYSPWYVNQKGKWVEYKVDSWKRH 68

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           NK  +    G +    A  L + ++        +  L E+EF+  +L  M+    +G   
Sbjct: 69  NKGMVCKLEGFEVREDAHLLTNFEIAIDPASLPE--LSEEEFYWRELFGMQVVTTKGYDL 126

Query: 117 GQVCGVYNFGAGSILEIKNT-----MEKTFLIPFTKF-AVLEVNLQENKILIDPIAA 167
           G V  +   G+  +L IK        +K  L+P+ +   + +V+ +  +I +D    
Sbjct: 127 GVVTDMLETGSNDVLVIKANLKDAFGQKERLVPYLEEQVIKKVDREAQRIEVDWDPG 183


>gi|91974988|ref|YP_567647.1| 16S rRNA-processing protein RimM [Rhodopseudomonas palustris BisB5]
 gi|123749437|sp|Q13DU3|RIMM_RHOPS RecName: Full=Ribosome maturation factor rimM
 gi|91681444|gb|ABE37746.1| 16S rRNA processing protein RimM [Rhodopseudomonas palustris BisB5]
          Length = 176

 Score =  141 bits (357), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 46/175 (26%), Positives = 76/175 (43%), Gaps = 5/175 (2%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY--SNDNRELRILKMYRKNKRFIATF 64
           L+ +A IG  HG+ G + + S+   P+ +  Y      +  R   I          + T 
Sbjct: 5   LICIARIGAPHGVRGAMRLWSFTAEPLAVMDYGPLATKDGARSFEIATARPAKDHLVVTL 64

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
            G+     A  L  L+LY  R        E+ E+++ DL  +      G+  G+V  ++N
Sbjct: 65  KGVATREEAERLNGLELYVPRDRLPPT--EDGEYYHADLIGLPAITPAGEPLGRVLAIHN 122

Query: 125 FGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQY 179
           FGAG I+EI      T L+PFT   V  V+L    ++I+     +   T  +P+ 
Sbjct: 123 FGAGDIIEIAPPQGATLLLPFTNAVVPTVDLTAGHVVIELPTE-IEGDTPNHPEA 176


>gi|302386487|ref|YP_003822309.1| 16S rRNA processing protein RimM [Clostridium saccharolyticum WM1]
 gi|302197115|gb|ADL04686.1| 16S rRNA processing protein RimM [Clostridium saccharolyticum WM1]
          Length = 169

 Score =  141 bits (357), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 44/171 (25%), Positives = 70/171 (40%), Gaps = 6/171 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND----NRELRILKMYRKNKR 59
           ++ L+ +  I +THG+ GEV +    ++    N       D     REL I  +      
Sbjct: 1   MENLLRVGVISSTHGVRGEVKVYPTTDDVNRFNELKKVILDAGQERRELEIQGVKFFKNM 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F G D+I+   + +   L   R      EL  DE F  DL  +     +G+  G +
Sbjct: 61  VILKFKGYDSINDIEKYKGKDLLITRDQ--AVELGPDENFIVDLIGLRVVTEEGEELGIL 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
             V   GA  + E+K    K  L+P  K  V  V+L E  + +  +   L+
Sbjct: 119 TDVIKTGANDVYEVKTAEGKEVLLPAIKECVRNVDLTEGLVTVHIMDGLLD 169


>gi|260574844|ref|ZP_05842846.1| 16S rRNA processing protein RimM [Rhodobacter sp. SW2]
 gi|259022849|gb|EEW26143.1| 16S rRNA processing protein RimM [Rhodobacter sp. SW2]
          Length = 167

 Score =  141 bits (357), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 47/166 (28%), Positives = 75/166 (45%), Gaps = 5/166 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDN--RELRILKMYRKNKRFI 61
           +   + +  I  + G+ GEV + S+ ++P  +  Y     ++  R+  +           
Sbjct: 1   MTDRICVGAIAGSFGVKGEVRLKSFCSDPEAIAGYGPLFTEDGTRQFSVKLTRPVAGGLG 60

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
           A  SG+     A  LR   LY  +      +L +DEF++ DL  ME  D  G   G+V  
Sbjct: 61  ARLSGVATKEEADALRGTSLYVDKTRLP--KLPDDEFYHADLIGMEVRDTGGVLLGRVQA 118

Query: 122 VYNFGAGSILEIKNTMEKT-FLIPFTKFAVLEVNLQENKILIDPIA 166
           V+N GAG +LEI     K   L+PFT   V  V+L   +I++D   
Sbjct: 119 VHNHGAGDLLEIAGAGLKEPILLPFTLAVVPTVDLVAGRIVVDLPE 164


>gi|225419754|ref|ZP_03762057.1| hypothetical protein CLOSTASPAR_06092 [Clostridium asparagiforme
           DSM 15981]
 gi|225041591|gb|EEG51837.1| hypothetical protein CLOSTASPAR_06092 [Clostridium asparagiforme
           DSM 15981]
          Length = 193

 Score =  141 bits (357), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 40/171 (23%), Positives = 72/171 (42%), Gaps = 6/171 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRE----LRILKMYRKNKR 59
           ++ ++ +  I + HG+ GEV +    ++            D  +    L I  +      
Sbjct: 24  MEDMLRVGVITSPHGVRGEVKVFPTTDDAARFKTLKQVVLDTGKETISLEIEHVKFFKNM 83

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F G DNI+   + R   L  +R+     ELEEDE+F  DL  +      G+  G V
Sbjct: 84  VILKFKGYDNINDIEKYRSKDLLIRREQ--AVELEEDEYFIADLIGLAVVTDAGEALGTV 141

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
             V   GA  +  ++    +  L+P     +L+VNL E ++ +  +   ++
Sbjct: 142 KDVMETGANDVYIVEMKDGRELLLPAIGDCILDVNLDEGRMTVHVLDGLMD 192


>gi|107103259|ref|ZP_01367177.1| hypothetical protein PaerPA_01004328 [Pseudomonas aeruginosa PACS2]
 gi|116051742|ref|YP_789419.1| 16S rRNA-processing protein RimM [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|218889978|ref|YP_002438842.1| 16S rRNA-processing protein RimM [Pseudomonas aeruginosa LESB58]
 gi|254236653|ref|ZP_04929976.1| 16S rRNA processing protein [Pseudomonas aeruginosa C3719]
 gi|254242435|ref|ZP_04935757.1| 16S rRNA processing protein [Pseudomonas aeruginosa 2192]
 gi|296387747|ref|ZP_06877222.1| 16S rRNA-processing protein RimM [Pseudomonas aeruginosa PAb1]
 gi|313109151|ref|ZP_07795122.1| 16S rRNA processing protein [Pseudomonas aeruginosa 39016]
 gi|122260885|sp|Q02RL7|RIMM_PSEAB RecName: Full=Ribosome maturation factor rimM
 gi|226734091|sp|B7UYK7|RIMM_PSEA8 RecName: Full=Ribosome maturation factor rimM
 gi|115586963|gb|ABJ12978.1| 16S rRNA processing protein RimM [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126168584|gb|EAZ54095.1| 16S rRNA processing protein [Pseudomonas aeruginosa C3719]
 gi|126195813|gb|EAZ59876.1| 16S rRNA processing protein [Pseudomonas aeruginosa 2192]
 gi|218770201|emb|CAW25963.1| 16S rRNA processing protein [Pseudomonas aeruginosa LESB58]
 gi|310881624|gb|EFQ40218.1| 16S rRNA processing protein [Pseudomonas aeruginosa 39016]
          Length = 175

 Score =  141 bits (357), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 37/167 (22%), Positives = 77/167 (46%), Gaps = 10/167 (5%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRKNKRF 60
           D LV++  I + +G+ GEV + S+ +   +L  Y  +      + R+  +++     K  
Sbjct: 6   DDLVVIGKIVSVYGIRGEVKVYSFTDPLDNLLDYRRWTLRRDGEIRQAELVRGRLHGKVL 65

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
            A   G+D+   A      ++   R +     LEE E++   LE ++  D+ G+  G + 
Sbjct: 66  AAKLKGLDDREEARTFTGYEICIPRSELPS--LEEGEYYWHQLEGLKVIDQGGQLLGVID 123

Query: 121 GVYNFGAGSILEIKNT----MEKTFLIPFTKFAVLEVNLQENKILID 163
            +   GA  ++ +K       ++  L+P+T   VL ++L   ++ +D
Sbjct: 124 HLLETGANDVMVVKPCAGSLDDRERLLPYTGQCVLSIDLAAGEMRVD 170


>gi|330504638|ref|YP_004381507.1| 16S rRNA-processing protein RimM [Pseudomonas mendocina NK-01]
 gi|328918924|gb|AEB59755.1| 16S rRNA-processing protein RimM [Pseudomonas mendocina NK-01]
          Length = 178

 Score =  141 bits (357), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 35/167 (20%), Positives = 79/167 (47%), Gaps = 10/167 (5%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRKNKRF 60
           + L+++  I + HG+ GEV + S+ +   ++  Y  +      + +++ +     + K  
Sbjct: 9   EDLIVLGKIVSVHGVRGEVKVYSFTDPIDNVLDYQNWTLKRDGEVKKVELASGRLQGKVL 68

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +    G+D+   A      ++   R +  D  LEE EF+   L+ ++  D+ G+  G V 
Sbjct: 69  VVKLKGLDDREIARTYAGFEICVPRSELPD--LEEGEFYWYQLQGLKVIDQAGQLLGVVD 126

Query: 121 GVYNFGAGSILEIKNT----MEKTFLIPFTKFAVLEVNLQENKILID 163
            ++  GA  ++ +K       ++  L+P+T   VL ++L   ++ +D
Sbjct: 127 HLFETGANDVMVVKACAGSLDDRERLLPYTDQCVLSIDLAAGEMRVD 173


>gi|302522159|ref|ZP_07274501.1| 16S rRNA processing protein RimM [Streptomyces sp. SPB78]
 gi|302431054|gb|EFL02870.1| 16S rRNA processing protein RimM [Streptomyces sp. SPB78]
          Length = 236

 Score =  141 bits (357), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 35/187 (18%), Positives = 78/187 (41%), Gaps = 6/187 (3%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNR----YVLYSNDNRELRILKMYRKNKRFIAT 63
           +++A IG  HG+ GEV ++   + P                   L I +    + R +  
Sbjct: 3   LVVARIGRAHGIKGEVTVEVRTDEPELRLPPGAVLATDPPGAGPLTIEQGRVHSGRLLLR 62

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F+G+ +  +A  LR+  L     D ++   + +EF++  L +++     G+  G++  + 
Sbjct: 63  FAGVKDRTAAEALRN-TLLIAETDPEEVPEDPEEFYDYQLMDLDVVTEDGQEIGRITEIS 121

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMK-NPQYDCP 182
           +  +  +  ++       +IPF +  V E++L E + +I+P    L+        + +  
Sbjct: 122 HLPSQDLFIVERPDGSEVMIPFVEEIVTEIDLDEQRAVINPPPGLLDLDEADVASERETS 181

Query: 183 LDSAGKK 189
               G  
Sbjct: 182 RTETGAA 188


>gi|291563272|emb|CBL42088.1| 16S rRNA processing protein RimM [butyrate-producing bacterium
           SS3/4]
          Length = 171

 Score =  141 bits (356), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 43/172 (25%), Positives = 78/172 (45%), Gaps = 7/172 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYV-----LYSNDNRELRILKMYRKNK 58
           ++K + +  I + HG+ GEV +    ++ +   +       L   + REL+I ++     
Sbjct: 1   MEKYLRVGVITSPHGVRGEVKVYPTTDDVMRFKKLDKVILDLGRGETRELKIRQVKFFKN 60

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
             I  F G+D ++     R   L   R       LEEDEFF TDL  +     +G+  G 
Sbjct: 61  MVILKFDGVDTMNEVEGWRQKDLLITRDQ--AIPLEEDEFFITDLIGLNVVTDEGETLGT 118

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           +  V   GA  +  +K    K  L+P  +  +L+V+L + ++L+  +   L+
Sbjct: 119 LTDVMETGANDVYCVKTPEGKELLLPAIRDCILDVDLDKEEMLVHVLPGLLD 170


>gi|84683441|ref|ZP_01011344.1| 16S rRNA processing protein RimM [Maritimibacter alkaliphilus
           HTCC2654]
 gi|84668184|gb|EAQ14651.1| 16S rRNA processing protein RimM [Rhodobacterales bacterium
           HTCC2654]
          Length = 170

 Score =  141 bits (356), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 48/170 (28%), Positives = 76/170 (44%), Gaps = 5/170 (2%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDN--RELRILKMYRKNKRFIA 62
           +  + +     + G+ GEV + S+   P D+  Y     ++  R   +         F A
Sbjct: 3   EDRICVGAFAGSFGVGGEVRVKSFCAEPEDIETYGTLWTEDGTRSFTLSLTRAVKTGFAA 62

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
              GI     A  L+ ++LYA R       L +DEF++ DL  +   D  G   G+V  V
Sbjct: 63  DVDGITTKEQADALKGVRLYADRDALPS--LPDDEFYHADLIGLTVLDTGGAEVGRVSAV 120

Query: 123 YNFGAGSILEIKNTMEKT-FLIPFTKFAVLEVNLQENKILIDPIAAGLNN 171
           +N GAG ++E+     KT  L+PFT+  V  V+L   +I+IDP       
Sbjct: 121 HNHGAGDLIEVAGPGLKTPALVPFTRANVPTVDLTAGRIVIDPPEGTFPE 170


>gi|239623997|ref|ZP_04667028.1| 16S rRNA processing protein RimM [Clostridiales bacterium
           1_7_47_FAA]
 gi|239522028|gb|EEQ61894.1| 16S rRNA processing protein RimM [Clostridiales bacterium
           1_7_47FAA]
          Length = 170

 Score =  141 bits (356), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 40/171 (23%), Positives = 73/171 (42%), Gaps = 6/171 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNR----ELRILKMYRKNKR 59
           ++ ++ +  I +THG+ GEV +    ++P    +      D       L I ++      
Sbjct: 1   MEDMLRVGVIASTHGVRGEVKVFPTTDDPSRFKQLKEVILDTGKEHLPLEIQQVKFFKNM 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F G DNI+   + +   L   R      ELE DE+F TDL  +E     G+  G +
Sbjct: 61  VILKFKGYDNINDIEKYKSKDLLIPRDQ--AVELEPDEYFITDLIGLEVRTEDGEILGTM 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
             V   GA  +  ++    K  L+P     +L V+L++  + +  +   ++
Sbjct: 119 KDVLETGANDVYVVQMKDGKELLLPAIGDCILNVDLEQGVMTVHILDGLMD 169


>gi|59711157|ref|YP_203933.1| 16S rRNA-processing protein [Vibrio fischeri ES114]
 gi|75354502|sp|Q5E7F1|RIMM_VIBF1 RecName: Full=Ribosome maturation factor rimM
 gi|59479258|gb|AAW85045.1| 16S rRNA processing protein [Vibrio fischeri ES114]
          Length = 175

 Score =  141 bits (356), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 38/177 (21%), Positives = 76/177 (42%), Gaps = 13/177 (7%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRK 56
           M K D+++++   G ++G+ G + + S+ + P  +  Y  +      +  E  +    R 
Sbjct: 1   MSKQDEVIVVGKFGASYGIRGWLKVVSFTDQPESIFDYKPWLIQVKGEWVEFSVESWKRH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
               +    G+D    A    +L++  K     +  L EDEF+  +L  ME    +G   
Sbjct: 61  KG-LVCKLKGLDVREEAQTYTNLEIAVKADALPE--LSEDEFYWRELFGMEVVTTKGYAL 117

Query: 117 GQVCGVYNFGAGSILEIKNT-----MEKTFLIPFTKFAVLE-VNLQENKILIDPIAA 167
           G V  ++  G+  +L +K        +K  LIPF    V++ ++ +  +I +D    
Sbjct: 118 GVVDDIFETGSNDVLVVKANLKDAFGKKERLIPFIDEQVIKLIDREAQRIEVDWDPG 174


>gi|296133546|ref|YP_003640793.1| 16S rRNA processing protein RimM [Thermincola sp. JR]
 gi|296032124|gb|ADG82892.1| 16S rRNA processing protein RimM [Thermincola potens JR]
          Length = 174

 Score =  141 bits (356), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 40/171 (23%), Positives = 81/171 (47%), Gaps = 7/171 (4%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR----YVLYSNDNRELRILKMYRKNKRF 60
            KL+ +  I  THG  GEV +    ++P  +      Y +     REL I ++       
Sbjct: 6   KKLIAIGKIINTHGHKGEVKVFPLTDDPRRMEELEKVYFILGESTRELTIKQVRYHKNFV 65

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           I +F  I ++++A  L++ ++   + +     L E  ++  D+  +  F  +G+Y G++ 
Sbjct: 66  ILSFEEIKDMNAAELLKNGEICITKDEL--RSLPEGSYYIFDIIGLNVFTNEGRYLGEIT 123

Query: 121 GVYNFGAGSILEIKN-TMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
            V   GA  + E+++    K +LIP  K  V  ++ ++ +++I P+   L 
Sbjct: 124 DVIQTGANDVYEVRDSKSGKHYLIPALKQIVKSIDTEKKEMIICPMEGLLE 174


>gi|290957098|ref|YP_003488280.1| 16S rRNA processing protein [Streptomyces scabiei 87.22]
 gi|260646624|emb|CBG69721.1| putative 16S rRNA processing protein [Streptomyces scabiei 87.22]
          Length = 195

 Score =  141 bits (355), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 43/188 (22%), Positives = 86/188 (45%), Gaps = 9/188 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPI-DLNRYVLYSNDN---RELRILKMYRKNKRFIAT 63
           +++A IG  HG+ GEV ++   + P   L    +   D      L I      + R +  
Sbjct: 3   LVVARIGRAHGIKGEVTVEVRTDEPELRLGPGAVLLTDPASTGPLTIETGRVHSGRLLLR 62

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F G+ + + A  LR+  L A+     +   EEDE+++  L +++   R G   G++  + 
Sbjct: 63  FEGVRDRNGAEALRNTLLIAEVDPE-ELPEEEDEYYDHQLMDLDVVTRDGLEVGRITEIS 121

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN----TTMKNPQY 179
           +  +  +  ++       +IPF +  V E++L E + +IDP    +++     + ++   
Sbjct: 122 HLPSQDLFIVERPDGSEVMIPFVESIVTEIDLTEQRAVIDPPPGLIDDRAEIASARDAAE 181

Query: 180 DCPLDSAG 187
           +   DSAG
Sbjct: 182 ESTTDSAG 189


>gi|311030152|ref|ZP_07708242.1| 16S rRNA-processing protein RimM [Bacillus sp. m3-13]
          Length = 172

 Score =  141 bits (355), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 36/174 (20%), Positives = 71/174 (40%), Gaps = 10/174 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-------YVLYSNDNRELRILKMYRK 56
           + K   +  +  THG+ GEV + S  + P +  +       ++    +  E+++      
Sbjct: 1   MSKWFNVGKLVNTHGIKGEVRVVSRTDFPDERYKKGNLLYLFLPNDKEPVEVKVASRRVH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETF-DRQGKY 115
               + TF G  N++   + +   +          ELEE E++  ++   +       + 
Sbjct: 61  KSFDLLTFEGFHNVNEVEKFKGAIIKVPEDQL--GELEEGEYYFHEIVGCKVILQETMEE 118

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
            G V  V   GA  +  I+    K  LIP+    V +V++QE  I+I+P+    
Sbjct: 119 IGTVKEVLTPGANDVWVIQAKKGKDILIPYIDQVVKKVDVQEKTIIIEPLEGLF 172


>gi|330446981|ref|ZP_08310632.1| 16S rRNA processing protein RimM [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328491172|dbj|GAA05129.1| 16S rRNA processing protein RimM [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 177

 Score =  141 bits (355), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 33/174 (18%), Positives = 71/174 (40%), Gaps = 13/174 (7%)

Query: 1   MVKLD-KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYR 55
           M   +   +++  +G T+G+ G + + SY      +  Y  +      + +E  +    R
Sbjct: 1   MSNKNQDHIIVGKLGATYGIKGWLKVFSYTEQSESIFSYTPWLIKVKGEWKEFHVESWKR 60

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
             +  +A   G+D    A    + ++    +      L ++EF+  +L  M     +G  
Sbjct: 61  HGQGLVAKLEGMDIREEAQVFTNAEVAVLAEQLPA--LSDEEFYWRELFGMSVVTTEGYD 118

Query: 116 WGQVCGVYNFGAGSILEIKNT-----MEKTFLIPFTKFAVLE-VNLQENKILID 163
            G+V  +   G+  +L +K        +K  LIPF    V++ ++    +I +D
Sbjct: 119 LGKVTDILETGSNDVLVVKANLKDAFGQKERLIPFLDEQVIKLIDRTAQRIEVD 172


>gi|266625654|ref|ZP_06118589.1| 16S rRNA processing protein RimM [Clostridium hathewayi DSM 13479]
 gi|288862441|gb|EFC94739.1| 16S rRNA processing protein RimM [Clostridium hathewayi DSM 13479]
          Length = 170

 Score =  141 bits (355), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 36/171 (21%), Positives = 68/171 (39%), Gaps = 6/171 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRE----LRILKMYRKNKR 59
           +++L+ +  I +THG+ GEV +    ++     +      D  +    L I  +      
Sbjct: 1   MEQLLRVGVISSTHGVKGEVKVFPTTDDAARFKKLKQVILDTGKEQLKLEIEGVKFFKNM 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F G D I    + +   +   R      +L  DE F  DL  ++     G+ +G +
Sbjct: 61  VILKFKGYDTIEDIEKYKGKDILVTRDQ--AVKLGPDENFIVDLIGLKVVTEDGEPFGTL 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
             V   GA  + E+K    K  L P  +  +  V+L+   + +  +   L+
Sbjct: 119 TDVIKTGANDVYEVKTAEGKEVLFPAIRECIRNVDLEAGVVTVHIMDGLLD 169


>gi|302537191|ref|ZP_07289533.1| 16S rRNA processing protein RimM [Streptomyces sp. C]
 gi|302446086|gb|EFL17902.1| 16S rRNA processing protein RimM [Streptomyces sp. C]
          Length = 208

 Score =  141 bits (355), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 38/187 (20%), Positives = 79/187 (42%), Gaps = 5/187 (2%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNR----YVLYSNDNRELRILKMYRKNKRFIAT 63
           +++A IG  HG+ GEV ++   + P                   L I      + R +  
Sbjct: 3   LVVARIGRAHGIKGEVTVEVRTDEPELRLSPGAVLRTEPASAGPLTIETGRVHSSRLLLR 62

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F G+ +  +A  LR+  L A   D  +   EEDE+++  L +++     G   G++  + 
Sbjct: 63  FEGVKDRTAAEALRNTLLIADV-DPAELPEEEDEYYDHQLMDLDVVLEDGTEIGRITEIS 121

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQYDCPL 183
           +  +  +  ++       +IPF +  V E++L+E + +I P    +++        D   
Sbjct: 122 HLPSQDLFIVERPDGTEVMIPFVEEIVAEIDLEEQRCVITPPPGLIDDRAEIASARDAET 181

Query: 184 DSAGKKS 190
            +  +K+
Sbjct: 182 SAEAEKA 188


>gi|256390712|ref|YP_003112276.1| 16S rRNA-processing protein RimM [Catenulispora acidiphila DSM
           44928]
 gi|256356938|gb|ACU70435.1| 16S rRNA processing protein RimM [Catenulispora acidiphila DSM
           44928]
          Length = 187

 Score =  141 bits (355), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 33/172 (19%), Positives = 74/172 (43%), Gaps = 5/172 (2%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLN----RYVLYSNDNRELRILKMYRKNKRFIAT 63
           +++  IG  HG+ G+  ++   ++P        R +    +   L +  M   +   +  
Sbjct: 17  LVVGRIGRAHGIRGQATVEVRTDDPELRFAPGSRLLTEPAERGPLVVTDMRFHSGILLLA 76

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F G+ + ++   LR+  +     D  +   + +EF++  L  +      G   G++  + 
Sbjct: 77  FEGVADRNAVEALRN-TILVVEADPDETPEDPEEFYDHQLVGLPVELADGTVLGEIADLL 135

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMK 175
           +     +L +K       LIPF K  V  V++   +I++DP A  L+  +++
Sbjct: 136 HLPGQDVLAVKRPDRPEVLIPFIKQFVPVVDVANKRIVVDPPAGLLDLDSVE 187


>gi|90580368|ref|ZP_01236175.1| 16S rRNA-processing protein [Vibrio angustum S14]
 gi|90438670|gb|EAS63854.1| 16S rRNA-processing protein [Vibrio angustum S14]
          Length = 177

 Score =  141 bits (355), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 34/174 (19%), Positives = 73/174 (41%), Gaps = 13/174 (7%)

Query: 1   MVKLD-KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYR 55
           M   +   +++  +G T+G+ G + + SY      +  Y  +      + +E+ +    R
Sbjct: 1   MSNKNQDHIIVGKLGATYGIKGWLKVFSYTEQSESIFSYTPWLIKVKGEWKEIHVESWKR 60

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
             +  +A   G+D    A    + ++    +      L ++EF+  +L  M  F  +G  
Sbjct: 61  HGQGLVAKLEGMDIREDAQVFTNAEVAVLAEQLPA--LSDEEFYWRELFGMSVFTTEGYD 118

Query: 116 WGQVCGVYNFGAGSILEIKNT-----MEKTFLIPFTKFAVLE-VNLQENKILID 163
            G+V  +   G+  +L +K        +K  LIPF    V++ ++    +I +D
Sbjct: 119 LGKVTDILETGSNDVLVVKANLKDAFGQKERLIPFLDEQVIKLIDRTAQRIEVD 172


>gi|49081574|gb|AAT50187.1| PA3744 [synthetic construct]
          Length = 176

 Score =  140 bits (354), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 36/167 (21%), Positives = 76/167 (45%), Gaps = 10/167 (5%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRKNKRF 60
           D LV++  I + +G+ GEV + S+ +   +L  Y  +      + R+  +++     K  
Sbjct: 6   DDLVVIGKIVSVYGIRGEVKVYSFTDPLDNLLDYRRWTLRRDGEIRQAELVRGRLHGKVL 65

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
            A   G+D+   A      ++   R +     LEE E++   LE ++  D+  +  G + 
Sbjct: 66  AAKLKGLDDREEARTFTGYEICIPRSELPS--LEEGEYYWHQLEGLKVIDQGRQLLGVID 123

Query: 121 GVYNFGAGSILEIKNT----MEKTFLIPFTKFAVLEVNLQENKILID 163
            +   GA  ++ +K       ++  L+P+T   VL ++L   ++ +D
Sbjct: 124 HLLETGANDVMVVKPCAGSLDDRERLLPYTGQCVLSIDLAAGEMRVD 170


>gi|15598939|ref|NP_252433.1| 16S rRNA-processing protein RimM [Pseudomonas aeruginosa PAO1]
 gi|14423891|sp|Q9HXQ0|RIMM_PSEAE RecName: Full=Ribosome maturation factor rimM
 gi|9949912|gb|AAG07131.1|AE004793_8 16S rRNA processing protein [Pseudomonas aeruginosa PAO1]
          Length = 175

 Score =  140 bits (354), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 36/167 (21%), Positives = 76/167 (45%), Gaps = 10/167 (5%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRKNKRF 60
           D LV++  I + +G+ GEV + S+ +   +L  Y  +      + R+  +++     K  
Sbjct: 6   DDLVVIGKIVSVYGIRGEVKVYSFTDPLDNLLDYRRWTLRRDGEIRQAELVRGRLHGKVL 65

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
            A   G+D+   A      ++   R +     LEE E++   LE ++  D+  +  G + 
Sbjct: 66  AAKLKGLDDREEARTFTGYEICIPRSELPS--LEEGEYYWHQLEGLKVIDQGRQLLGVID 123

Query: 121 GVYNFGAGSILEIKNT----MEKTFLIPFTKFAVLEVNLQENKILID 163
            +   GA  ++ +K       ++  L+P+T   VL ++L   ++ +D
Sbjct: 124 HLLETGANDVMVVKPCAGSLDDRERLLPYTGQCVLSIDLAAGEMRVD 170


>gi|238063307|ref|ZP_04608016.1| ribosome maturation factor rimM [Micromonospora sp. ATCC 39149]
 gi|237885118|gb|EEP73946.1| ribosome maturation factor rimM [Micromonospora sp. ATCC 39149]
          Length = 185

 Score =  140 bits (354), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 42/183 (22%), Positives = 71/183 (38%), Gaps = 21/183 (11%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYV--------------------LYSNDNRE 47
           +++  IG  HG+ GEV ++   + P                           +      E
Sbjct: 3   LIVGRIGKPHGIRGEVTVEVRTDEPEARFAPGSVLATEPGAVPPANPASGPGVPFRVPAE 62

Query: 48  LRILKMYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEME 107
           L +        R +  F GI     A  LR   L     D    E + +EF +  L  + 
Sbjct: 63  LTVESARWHQGRLLVVFDGILERDVAEALRGTLLGVDSADVAPPE-DPEEFHDHQLVGLA 121

Query: 108 TFDRQGKYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAA 167
                G++ G+V  + +  A  +L ++    +T LIPF K  V EV+L   +I++DP + 
Sbjct: 122 VVTPAGEHLGEVVKIDHAPASDLLVLRRPEGRTALIPFVKAIVPEVDLAGGRIVVDPPSG 181

Query: 168 GLN 170
            L+
Sbjct: 182 LLD 184


>gi|331081975|ref|ZP_08331103.1| ribosome maturation factor rimM [Lachnospiraceae bacterium
           6_1_63FAA]
 gi|330405570|gb|EGG85100.1| ribosome maturation factor rimM [Lachnospiraceae bacterium
           6_1_63FAA]
          Length = 168

 Score =  140 bits (354), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 41/169 (24%), Positives = 76/169 (44%), Gaps = 6/169 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNR----ELRILKMYRKNKR 59
           ++ L+ +  I TTHG+ GEV +    ++    +       D      EL I ++    + 
Sbjct: 1   MEDLLQVGVITTTHGIRGEVKVFPTTDDAHRFDYLKSVLLDTGKELCELDIERVKYFKQY 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F  +D+I+     +   LY  R+      L+E+E++  DL  ME +   GK++G +
Sbjct: 61  VILKFKDVDDINDIEPYKGKSLYVTREF--AVPLKENEYYTADLIGMEVYLEDGKHFGTL 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAG 168
             V   GA  +  +     K  LIP  K  + EV+++  K+++  +   
Sbjct: 119 MDVMETGANDVYVVHLEAGKEVLIPAIKDCIKEVDVENGKMVVHLLKGL 167


>gi|323135866|ref|ZP_08070949.1| 16S rRNA processing protein RimM [Methylocystis sp. ATCC 49242]
 gi|322398957|gb|EFY01476.1| 16S rRNA processing protein RimM [Methylocystis sp. ATCC 49242]
          Length = 177

 Score =  140 bits (354), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 46/179 (25%), Positives = 81/179 (45%), Gaps = 6/179 (3%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSN--DNRELRILKMYRK-N 57
           M     LVL+   G  HG+ GE+ + SY  +P+ +  Y   ++    +  ++  +  +  
Sbjct: 1   MAAEKNLVLLGRFGAPHGVRGEIRLQSYTADPLAIASYGPLTDKSGTKSFKLASVRPQGK 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              +A   G+ +   A  L  ++LY  R+       +EDEF+  DL  +    R+G   G
Sbjct: 61  DMLVARVEGVSDRTGAEALTGVELYLPREKLPPP--DEDEFYLADLVGLRAQTREGVEIG 118

Query: 118 QVCGVYNFGAGSILEIKNTMEKT-FLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMK 175
           +V  V NFGAG ILE+         + PFT+     V++ E +++I+P     +     
Sbjct: 119 RVVAVRNFGAGDILEVTPPDGGETLMFPFTRAVAPVVSIAEGRVIIEPPMEIGDEDAPD 177


>gi|260437021|ref|ZP_05790837.1| 16S rRNA processing protein RimM [Butyrivibrio crossotus DSM 2876]
 gi|292810330|gb|EFF69535.1| 16S rRNA processing protein RimM [Butyrivibrio crossotus DSM 2876]
          Length = 170

 Score =  140 bits (354), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 41/171 (23%), Positives = 76/171 (44%), Gaps = 6/171 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRE----LRILKMYRKNKR 59
           ++ L+ +  I + HG+ GEV +    ++P+           +      L +  +  +   
Sbjct: 1   MEDLLRVGVITSPHGIAGEVKVYPTTDDPMRFKNLKECILKSSREMLNLHVAGVKFQKNL 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F   +NI+   + R  +LY  R++    +LEE E+F  DL  ++  D  GK  G++
Sbjct: 61  VILKFKEFNNINEVEKYRQAELYVTREN--AVKLEEGEYFICDLIGLKVIDEFGKTIGEL 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
             V   GA  + E+     K +L P  K  +L V+L E  + +  +   L+
Sbjct: 119 TDVIQTGANDVYEVTTPERKKYLFPVIKECILNVDLDEGIVTVHIMKGLLD 169


>gi|282850090|ref|ZP_06259472.1| 16S rRNA processing protein RimM [Veillonella parvula ATCC 17745]
 gi|282580279|gb|EFB85680.1| 16S rRNA processing protein RimM [Veillonella parvula ATCC 17745]
          Length = 165

 Score =  140 bits (354), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 33/165 (20%), Positives = 68/165 (41%), Gaps = 2/165 (1%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFI 61
           +K + L+ +  I   HG+ G++ I    + P           D +E  +       +  +
Sbjct: 1   MKHNDLITIGVIIAPHGVRGDLRIMPQTDFPERFMHMDACYIDGKEYHVASARFHKQFVL 60

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
           A+F  I + ++A      ++  +R+D    EL E  ++  D+  +E  D  G   G V  
Sbjct: 61  ASFKEIPDRNTAELFGKKEIQVRREDL--VELPEGRYYIFDIIGLEVQDTNGNVLGTVTD 118

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIA 166
           V   GA  +  +    E   L    +  V +++++   +++DP  
Sbjct: 119 VLQPGANDVYVVSKDGEPDQLFAAIEEVVKDIDVENKLMIVDPPE 163


>gi|269797643|ref|YP_003311543.1| 16S rRNA processing protein RimM [Veillonella parvula DSM 2008]
 gi|269094272|gb|ACZ24263.1| 16S rRNA processing protein RimM [Veillonella parvula DSM 2008]
          Length = 165

 Score =  140 bits (354), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 34/165 (20%), Positives = 66/165 (40%), Gaps = 2/165 (1%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFI 61
           +K +  + +  I   HG+ G++ I    + P           D +E  +       +  +
Sbjct: 1   MKHNDFITIGVIIAPHGVRGDLRIMPQTDFPERFMHMDACYIDGKEYHVASARFHKQFVL 60

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
           A+F  I N ++A       +  +R+D    EL E  ++  D+  +E  D  G   G V  
Sbjct: 61  ASFKEIPNRNTAELFTKKAIQVRREDL--VELPEGRYYIFDIIGLEVQDTMGNVLGTVTD 118

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIA 166
           V   GA  +  +    E   L    +  V ++N++   +++DP  
Sbjct: 119 VLQPGANDVYVVSKDGEPDQLFAAIEEVVKDINVKNKLMIVDPPE 163


>gi|295109863|emb|CBL23816.1| 16S rRNA processing protein RimM [Ruminococcus obeum A2-162]
          Length = 168

 Score =  140 bits (354), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 43/170 (25%), Positives = 76/170 (44%), Gaps = 6/170 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDN----RELRILKMYRKNKR 59
           ++ L+ +  I TTHG+ GEV +    ++            D     R L I  +      
Sbjct: 1   MEDLLKVGVITTTHGVRGEVKVFPTTDDAERFLELEYVLLDTGRELRRLDIKNVRFFKNL 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F GIDNI+   + +   L+  R++   +EL EDE++  DL+ +      G  +G +
Sbjct: 61  VILKFDGIDNINDIEKYKGKDLWIPREE--AQELGEDEYYIADLQGLNVVLEDGTEFGTL 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
             V   GA  +  I +      L+P  K  +L+V+L++N + +  +   L
Sbjct: 119 RDVMETGANDVYIIDSNEHGEVLLPAIKECILDVDLEKNTMTVHLMKGLL 168


>gi|308068629|ref|YP_003870234.1| 16S rRNA processing protein rimM [Paenibacillus polymyxa E681]
 gi|305857908|gb|ADM69696.1| Probable 16S rRNA processing protein rimM [Paenibacillus polymyxa
           E681]
          Length = 171

 Score =  140 bits (354), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 37/173 (21%), Positives = 70/173 (40%), Gaps = 9/173 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-------YVLYSNDNRELRILKMYRK 56
           + +L  +  I  THG+ GE+ I +  + P D                    + +     +
Sbjct: 1   MQQLFNVGKIVNTHGIRGELKILTTTDFPEDRFAKGSELLIVPAEGKAPIPVTVETARFQ 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
               +A F    NI+   + +   L    +     ELEE+EF+  ++  ME     G   
Sbjct: 61  KNMVVAKFKEYHNINEVEKYKGTLLKVSAERL--GELEENEFYFHEVVGMEVVTEDGNEL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           G V  +   GA  +  +K    K  L+P+ +  +L+VN++E ++ +  +   L
Sbjct: 119 GVVKEILTPGANDVWVVKMPKGKELLLPYIEDVILDVNVREKRVTVRLMEGLL 171


>gi|238916981|ref|YP_002930498.1| 16S rRNA processing protein RimM [Eubacterium eligens ATCC 27750]
 gi|238872341|gb|ACR72051.1| 16S rRNA processing protein RimM [Eubacterium eligens ATCC 27750]
          Length = 172

 Score =  140 bits (354), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 36/171 (21%), Positives = 78/171 (45%), Gaps = 6/171 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRE----LRILKMYRKNKR 59
           ++ ++ +  I +THG+ GEV +    ++P+   +      D +     + +  +    + 
Sbjct: 1   MEDMLRVGVITSTHGIRGEVKVFPTTDDPLRFKKLKKCVIDGKREQVAVTVSSVKFFKQF 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F   D+I+   +     L   R+D    +LE  E+F  DL  ++    +GK+ G +
Sbjct: 61  VILKFKEFDDINDIEKYTKCDLLVSRED--AVKLEPGEYFICDLIGLDVITDEGKHLGVL 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
             V   GA ++ E++    +++LIP     +L+ +L +  I +  +   L+
Sbjct: 119 KDVLETGANNVYEVEADNGESYLIPVIDQCILDHDLDKKTITVHILPGLLD 169


>gi|332993913|gb|AEF03968.1| 16S rRNA-processing protein RimM [Alteromonas sp. SN2]
          Length = 173

 Score =  140 bits (354), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 45/174 (25%), Positives = 75/174 (43%), Gaps = 9/174 (5%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS-NDNRELRILKMYRKNKR 59
           M     +V++  IG  +G+ G V I+SY   P  +  Y+ +   +  E +I +     K 
Sbjct: 1   MSLASDIVVVGKIGAPYGVKGWVKINSYTQTPEGIFEYLPWFLGEENEYQIDQWRTHGKG 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +A   G+DN   A  +++L +        D  L +D  +  +L  M+    QG   G V
Sbjct: 61  LVAKIVGVDNRDDAERIKNLDINISASQLPD--LGDDGIYWRELTGMKVVTTQGYDLGVV 118

Query: 120 CGVYNFGAGSILEIKNTME-----KTFLIPFT-KFAVLEVNLQENKILIDPIAA 167
             V+N GA  ++ +K  +      K  LIPF     V EV+ +   I +D    
Sbjct: 119 KEVFNTGANDVVHVKANVGDAFGQKERLIPFVFDDVVQEVDREAKVIKVDWDPG 172


>gi|172057908|ref|YP_001814368.1| 16S rRNA processing protein RimM [Exiguobacterium sibiricum 255-15]
 gi|229564322|sp|B1YIM5|RIMM_EXIS2 RecName: Full=Ribosome maturation factor rimM
 gi|171990429|gb|ACB61351.1| 16S rRNA processing protein RimM [Exiguobacterium sibiricum 255-15]
          Length = 169

 Score =  140 bits (354), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 38/170 (22%), Positives = 77/170 (45%), Gaps = 8/170 (4%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-----YVLYSNDNRELRILKMYRKNKRF 60
           + + +A I  THGL GE+ + +  + P    +     ++  +       I    +  +  
Sbjct: 2   EWLEVAKIANTHGLKGELKLLASTDFPEQRFKVGNEVFLESNGIYTPFMISSYRKHKQFI 61

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           + TF G+ +I+   + + LKLY   +  ++  L E EF+  ++     FD + +  G V 
Sbjct: 62  MVTFKGMQHINDVEKYKGLKLYVHPEALQE--LGEHEFYYHEIIGCTVFDGEDE-IGVVS 118

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
            +   GA  +  IK   +K  LIP+ +  V  ++++  +I I P+   + 
Sbjct: 119 EILETGANDVWTIKRPGKKDVLIPYIEQVVASIDVEAKRIQITPLPGLIE 168


>gi|238019721|ref|ZP_04600147.1| hypothetical protein VEIDISOL_01596 [Veillonella dispar ATCC 17748]
 gi|313894616|ref|ZP_07828179.1| 16S rRNA processing protein RimM [Veillonella sp. oral taxon 158
           str. F0412]
 gi|237863762|gb|EEP65052.1| hypothetical protein VEIDISOL_01596 [Veillonella dispar ATCC 17748]
 gi|313440806|gb|EFR59235.1| 16S rRNA processing protein RimM [Veillonella sp. oral taxon 158
           str. F0412]
          Length = 165

 Score =  140 bits (353), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 32/165 (19%), Positives = 67/165 (40%), Gaps = 2/165 (1%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFI 61
           +K +  + +  I   HG+ G++ I    + P           D +E  +       +  +
Sbjct: 1   MKHNDFITIGVIIAPHGVRGDLRIMPQTDFPERFMHMDACYIDGKEYHVASARFHKQFVL 60

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
           A+F  I + ++A       +  +R+D    EL E  ++  D+  +E  D +G   G V  
Sbjct: 61  ASFKEIPDRNTAELFSKKAIQVRREDL--VELPEGRYYIFDIIGLEVQDTKGNVLGTVTD 118

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIA 166
           V   GA  +  +    E   L    +  V +++++   +++DP  
Sbjct: 119 VLQPGANDVYVVSKDGEPDQLFAAIEEVVKDIDVENKLMIVDPPE 163


>gi|169630308|ref|YP_001703957.1| 16S rRNA-processing protein RimM [Mycobacterium abscessus ATCC
           19977]
 gi|238688780|sp|B1MDI4|RIMM_MYCA9 RecName: Full=Ribosome maturation factor rimM
 gi|169242275|emb|CAM63303.1| Probable 16S rRNA processing protein RimM [Mycobacterium abscessus]
          Length = 173

 Score =  140 bits (353), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 34/170 (20%), Positives = 69/170 (40%), Gaps = 8/170 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYV-------LYSNDNRELRILKMYRKNKRF 60
           +++  I   HG+ GE+ ++   ++P +                 +R   +  +   + R 
Sbjct: 3   LVVGRIARAHGVTGELSVEVRTDDPDERFAVGSVLTGRLPRGGGSRRFTVESVREHSGRL 62

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +  F+G+ +  +A  LR         D    E  ++ F++  LE +      G   G V 
Sbjct: 63  LIRFAGVSDRDAADALRGTLFMVDTTDLPPIEDPDE-FYDHQLEGLAVRTLDGAAVGTVS 121

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
            V +   G +L ++ +  +  L+PF    V  ++L +  I IDP    L+
Sbjct: 122 EVLHTPGGELLSVRGSERREILVPFVSAIVTSISLADKVIEIDPPEGLLD 171


>gi|212639587|ref|YP_002316107.1| 16S rRNA-processing protein RimM [Anoxybacillus flavithermus WK1]
 gi|212561067|gb|ACJ34122.1| RimM protein, required for 16S rRNA processing [Anoxybacillus
           flavithermus WK1]
          Length = 174

 Score =  140 bits (353), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 32/172 (18%), Positives = 65/172 (37%), Gaps = 8/172 (4%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY------VLYSNDNRELRILKMYRKNKR 59
           K   +  I  THG+ GEV + S  +   +  +        + +    E+++         
Sbjct: 5   KWFHVGKIVNTHGIRGEVRVISRTDFAEERYKIGNVLYIFMENKPPVEVKVASHRVHKSF 64

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            + TF G DNI+     +   +       +   L E E++  ++         G+  G++
Sbjct: 65  DLLTFEGYDNINLVEPFKGAIIKIPETQLQP--LNEGEYYFHEIIGCTVVTEDGEPIGEI 122

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN 171
             +   GA  +  +K       LIP+    V +V+++   I I  +   L+ 
Sbjct: 123 KEILTPGANDVWVVKRKKGGDVLIPYIDDVVKQVDVENKTITIHVMEGLLDE 174


>gi|70726676|ref|YP_253590.1| 16S rRNA-processing protein RimM [Staphylococcus haemolyticus
           JCSC1435]
 gi|109893054|sp|Q4L5U1|RIMM_STAHJ RecName: Full=Ribosome maturation factor rimM
 gi|68447400|dbj|BAE04984.1| probable 16S rRNA processing protein [Staphylococcus haemolyticus
           JCSC1435]
          Length = 167

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 45/168 (26%), Positives = 80/168 (47%), Gaps = 8/168 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY-----VLYSNDNRELRILKMYRKNKRFIA 62
           V +  I  THG+ GEV + S ++      +      V + N   +L +L         + 
Sbjct: 3   VEVGQIVNTHGIKGEVKVKSNSDFTDTRFQPGEVLTVNHQNHEEQLTVLSYRVHKGFHML 62

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F GI+NI+   + +   LY +R   +D EL E+E++ +D+     FD   +  G+V  +
Sbjct: 63  KFEGINNINDVEQYKGDYLYQERDH-EDIELAENEYYYSDIIGSTVFDNDNQPIGRVINI 121

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           +  GA  +  +K   EK +LIP+    V E++++   I I P+   L+
Sbjct: 122 FETGANDVWVVK--GEKEYLIPYIADVVKEIDIENKTIRITPMEGLLD 167


>gi|89075048|ref|ZP_01161489.1| 16S rRNA-processing protein [Photobacterium sp. SKA34]
 gi|89049135|gb|EAR54700.1| 16S rRNA-processing protein [Photobacterium sp. SKA34]
          Length = 177

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 34/174 (19%), Positives = 73/174 (41%), Gaps = 13/174 (7%)

Query: 1   MVKLD-KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYR 55
           M   +   +++  +G T+G+ G + + SY      +  Y  +      + +E+ +    R
Sbjct: 1   MSSKNQDHIIVGKLGATYGIKGWLKVFSYTEQSESIFSYTPWLIKVKGEWKEIHVESWKR 60

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
             +  +A   G+D    A    + ++    +      L ++EF+  +L  M  F  +G  
Sbjct: 61  HGQGLVAKLEGMDIREDAQVFTNAEVAVLAEQLPA--LSDEEFYWRELFGMSVFTTEGYD 118

Query: 116 WGQVCGVYNFGAGSILEIKNT-----MEKTFLIPFTKFAVLE-VNLQENKILID 163
            G+V  +   G+  +L +K        +K  LIPF    V++ ++    +I +D
Sbjct: 119 LGKVTDILETGSNDVLVVKANLKDAFGQKERLIPFLDEQVIKLIDRTAQRIEVD 172


>gi|260588676|ref|ZP_05854589.1| 16S rRNA processing protein RimM [Blautia hansenii DSM 20583]
 gi|260541151|gb|EEX21720.1| 16S rRNA processing protein RimM [Blautia hansenii DSM 20583]
          Length = 168

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 41/169 (24%), Positives = 76/169 (44%), Gaps = 6/169 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNR----ELRILKMYRKNKR 59
           ++ L+ +  I TTHG+ GEV +    ++    +       D      EL I ++    + 
Sbjct: 1   MEDLLQVGVITTTHGIRGEVKVFPTTDDAHRFDYLKSVLLDTGKELCELDIERVKYFKQY 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F  +D+I+     +   LY  R+      L+E+E++  DL  ME +   GK++G +
Sbjct: 61  VILKFKDVDDINDIEPYKGKSLYVTREF--AVPLKENEYYIADLIGMEVYLEDGKHFGTL 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAG 168
             V   GA  +  +     K  LIP  K  + EV+++  K+++  +   
Sbjct: 119 MDVMETGANDVYVVHLEAGKEVLIPAIKDCIKEVDVENGKMVVHLLKGL 167


>gi|313891424|ref|ZP_07825040.1| 16S rRNA processing protein RimM [Dialister microaerophilus UPII
           345-E]
 gi|313120199|gb|EFR43375.1| 16S rRNA processing protein RimM [Dialister microaerophilus UPII
           345-E]
          Length = 168

 Score =  140 bits (352), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 22/165 (13%), Positives = 70/165 (42%), Gaps = 2/165 (1%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFI 61
           +K D+++++  I   HG+ G++ +    + P             +  +++        +I
Sbjct: 4   MKTDEMIVVGRIVAPHGVRGDLRVLPEIDKPEIFKNIKHIYFGEKSYKVISSRPHKNIYI 63

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               G+ + +++  +  L     + +      +E E++  +L +ME + ++G + G +  
Sbjct: 64  MKIEGVTDRNTSESMVGLSASLAKDEIPPC--KEGEYYCFELLDMEVYTQEGTFVGTLKE 121

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIA 166
           +   GA  +  +    ++   +P     + +V+++  K+ ++   
Sbjct: 122 IIETGANDVYTVIGPDKEEIYLPAIPSCIKKVDVESRKMTVELPE 166


>gi|262273653|ref|ZP_06051466.1| 16S rRNA processing protein RimM [Grimontia hollisae CIP 101886]
 gi|262222068|gb|EEY73380.1| 16S rRNA processing protein RimM [Grimontia hollisae CIP 101886]
          Length = 183

 Score =  140 bits (352), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 35/177 (19%), Positives = 77/177 (43%), Gaps = 13/177 (7%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRK 56
           M + +K V++  +G ++G+ G + + SY  N  ++  Y  +      + +E  +    R 
Sbjct: 9   MSEQEK-VVVGKLGASYGIRGWLKVFSYTENAENIFSYSPWFIKVRGEWQEFSLEDWKRH 67

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           N+ ++    G+D    A  L + ++    +   +  L ++EF+  +L  ME    +G   
Sbjct: 68  NQGYVGKLKGLDQREDAQALTNAEIAINAEVLPE--LSDEEFYWRELYGMEVATTKGYNL 125

Query: 117 GQVCGVYNFGAGSILEIKNT-----MEKTFLIPFTK-FAVLEVNLQENKILIDPIAA 167
           G+V  +   G+  +L ++        +K  LIPF     +  ++    +I +D    
Sbjct: 126 GKVTDILETGSNDVLVVQANPKDAFGQKERLIPFLDGQVIKSIDRSAQRIEVDWDPG 182


>gi|209694241|ref|YP_002262169.1| 16S rRNA-processing protein RimM [Aliivibrio salmonicida LFI1238]
 gi|238058947|sp|B6EGC0|RIMM_ALISL RecName: Full=Ribosome maturation factor rimM
 gi|208008192|emb|CAQ78335.1| 16S rRNA processing protein RimM [Aliivibrio salmonicida LFI1238]
          Length = 175

 Score =  140 bits (352), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 37/177 (20%), Positives = 74/177 (41%), Gaps = 13/177 (7%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRK 56
           M K D+++++   G ++G+ G + + S+ + P  +  Y        ++  E  +    R 
Sbjct: 1   MSKQDEVIVVGKFGASYGIRGWLKVVSFTDQPESIFDYKPLLIKVKDEWVEFSVESWKRH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
               +    G++    A    +L++  K     +  L EDEF+  +L  ME    QG   
Sbjct: 61  KG-LVCKLEGLEVREEAQAYTNLEIAVKADALPE--LSEDEFYWRELFGMEVVTSQGYGL 117

Query: 117 GQVCGVYNFGAGSILEIKNT-----MEKTFLIPFTKF-AVLEVNLQENKILIDPIAA 167
           G V  ++  G+  +L +K        +K  LIPF     +  ++ +  +I +D    
Sbjct: 118 GIVDDIFETGSNDVLVVKANLKDAFGKKERLIPFIDEQVIKVIDREAQRIEVDWDPG 174


>gi|226313201|ref|YP_002773095.1| 16S rRNA processing protein [Brevibacillus brevis NBRC 100599]
 gi|226096149|dbj|BAH44591.1| probable 16S rRNA processing protein [Brevibacillus brevis NBRC
           100599]
          Length = 175

 Score =  140 bits (352), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 35/173 (20%), Positives = 69/173 (39%), Gaps = 10/173 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-------YVLYSNDNRELRILKMYRK 56
            +    +  +  THGL GEV +    + P    R       +    ++  +L+I      
Sbjct: 6   QNSFYGVGKLVNTHGLRGEVRVTPTTDFPDQRFRKGNELYLFHPTLSEPLKLKIASRRPH 65

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
               I +F G ++I+   + +  +L    +     ELEEDEF+   L        +G+  
Sbjct: 66  KNFEIVSFHGFEHINDIEKYKGGELKIPAEAL--MELEEDEFYIHQLVGCVVVTDEGEEL 123

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           G++  V   GA  +  +K       L+P+    + EV++   +++   +   L
Sbjct: 124 GKIVDVMQPGANDVWVVKGKRG-EILLPYIDECIKEVDITNKRVVCHLMEGLL 175


>gi|257870307|ref|ZP_05649960.1| ribosome maturation factor rimM [Enterococcus gallinarum EG2]
 gi|257804471|gb|EEV33293.1| ribosome maturation factor rimM [Enterococcus gallinarum EG2]
          Length = 174

 Score =  140 bits (352), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 37/176 (21%), Positives = 78/176 (44%), Gaps = 8/176 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR------YVLYSNDNRELRILKMYRKN 57
           + + + +  I  THG+ GEV + S  + P +  R          +    EL +    +  
Sbjct: 1   MTEFLNVGKIVNTHGIRGEVRVISQTDFPEERYRKGQRLTLFRENKAPLELTVAGHRKHK 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              + TF G   I+    LRD  L   + +    EL E+E++  ++  +   D Q +  G
Sbjct: 61  NFDLLTFEGYPTINDVEPLRDGILKVSKDEL--SELTENEYYYHEIIGLTVIDEQARELG 118

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTT 173
           ++  + + GA  +  ++   +K  LIP+ +  V +++L + ++ I+     L++  
Sbjct: 119 KIKEILSPGANDVWVVQRKGKKDALIPYIESVVKQIDLDKGEVHIEIPEGLLDDED 174


>gi|197335041|ref|YP_002155308.1| 16S rRNA processing protein RimM [Vibrio fischeri MJ11]
 gi|238690257|sp|B5FAE6|RIMM_VIBFM RecName: Full=Ribosome maturation factor rimM
 gi|197316531|gb|ACH65978.1| 16S rRNA processing protein RimM [Vibrio fischeri MJ11]
          Length = 175

 Score =  140 bits (352), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 38/177 (21%), Positives = 76/177 (42%), Gaps = 13/177 (7%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRK 56
           M K D+++++   G ++G+ G + + S+ + P  +  Y  +      +  E  +    R 
Sbjct: 1   MSKQDEVIVVGKFGASYGIRGWLKVVSFTDQPESIFDYKPWLIQVKGEWVEFSVESWKRH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
               +    G+D    A    +L++  K     +  L EDEF+  +L  ME    +G   
Sbjct: 61  KG-LVCKLKGLDVREEAQTYTNLEIAVKADVLPE--LSEDEFYWRELFGMEVVTTKGYAL 117

Query: 117 GQVCGVYNFGAGSILEIKNT-----MEKTFLIPFTKFAVLE-VNLQENKILIDPIAA 167
           G V  ++  G+  +L +K        +K  LIPF    V++ ++ +  +I +D    
Sbjct: 118 GVVDDIFETGSNDVLVVKANLKDAFGKKERLIPFIDEQVIKLIDREAQRIEVDWDPG 174


>gi|294631646|ref|ZP_06710206.1| 16S rRNA processing protein RimM [Streptomyces sp. e14]
 gi|292834979|gb|EFF93328.1| 16S rRNA processing protein RimM [Streptomyces sp. e14]
          Length = 202

 Score =  140 bits (352), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 38/188 (20%), Positives = 82/188 (43%), Gaps = 7/188 (3%)

Query: 9   LMATIGTTHGLNGEVYIDSYANNPIDLNR----YVLYSNDNRELRILKMYRKNKRFIATF 64
           ++A IG  HG+ GEV ++   + P                   L I      + R +  F
Sbjct: 2   VVARIGRAHGIKGEVTVEVRTDEPELRLAPGAVLATDPASTGPLTIETGRVHSGRLLLRF 61

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
            G+ +  +A  LR+  L A+    ++   +EDE+++  L +++     G   G++  + +
Sbjct: 62  EGVGDRTAAEALRNTLLIAEVDP-EELPEDEDEYYDHQLIDLDVVTEDGTEVGRITEISH 120

Query: 125 FGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQYDCPLD 184
             +  +  ++       +IPF +  V E++L+E + +I P    +++        D   +
Sbjct: 121 LPSQDLFIVERPDGSEVMIPFVQEIVTEIDLEEQRAVITPPPGLIDDRAEIASARDAGQE 180

Query: 185 S--AGKKS 190
           +  AG++S
Sbjct: 181 AHEAGRES 188


>gi|323700098|ref|ZP_08112010.1| 16S rRNA processing protein RimM [Desulfovibrio sp. ND132]
 gi|323460030|gb|EGB15895.1| 16S rRNA processing protein RimM [Desulfovibrio desulfuricans
           ND132]
          Length = 195

 Score =  140 bits (352), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 39/174 (22%), Positives = 69/174 (39%), Gaps = 6/174 (3%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDN----RELRILKMYRK 56
           M K    + +  +   HG+ GE  I SYA++P   +R  L+ +D     R + +      
Sbjct: 1   MKKEPGFIPVGGVVKAHGIRGEFGIKSYADSPALFDRTPLFLSDGKGRPRPIEVTSWREH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
               + T   + +   A  LR  +L  +  D  +   +E E +   +         G   
Sbjct: 61  KGLVLMTSPQVTDRDQAEALRGRELLVREADLPEP--DEGEHYLYQMIGCRVVLTDGTEV 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           G++ G Y  G      I+N      L+P     VL+V+L    I+++P    L+
Sbjct: 119 GELVGFYETGEQDTWVIENGEGTEILLPAVPEFVLDVDLDTETIVVEPPEGLLD 172


>gi|159185334|ref|NP_355635.2| 16S rRNA-processing protein [Agrobacterium tumefaciens str. C58]
 gi|159140589|gb|AAK88420.2| 16S rRNA processing protein [Agrobacterium tumefaciens str. C58]
          Length = 179

 Score =  140 bits (352), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 68/175 (38%), Positives = 106/175 (60%), Gaps = 2/175 (1%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKRFIATFSGID 68
           MA IG   GL GEV + +Y ++P+ L  Y  L + D R   IL++       +  F GI+
Sbjct: 1   MAKIGGAQGLRGEVRVSTYTDDPMALGDYGNLVTADGRVFEILEVREGKNVVVVRFRGIN 60

Query: 69  NIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFGAG 128
           + ++A  L  L+L+ +R +  D+EL++DEF+  DLE +E  D +GK +G V  VY+FGAG
Sbjct: 61  DRNAAESLNGLELFIERDNLPDDELDDDEFYYADLEGLEAVDAEGKSYGAVSAVYDFGAG 120

Query: 129 SILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPI-AAGLNNTTMKNPQYDCP 182
            +LE+K    +  LIPF++ AVLE++L+  +ILIDP+ A  ++N   K+     P
Sbjct: 121 DLLELKGAGRRPALIPFSEAAVLEIDLEAGRILIDPMAAGLIDNPDDKDQNGMSP 175


>gi|282861373|ref|ZP_06270438.1| 16S rRNA processing protein RimM [Streptomyces sp. ACTE]
 gi|282564031|gb|EFB69568.1| 16S rRNA processing protein RimM [Streptomyces sp. ACTE]
          Length = 207

 Score =  139 bits (351), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 34/189 (17%), Positives = 78/189 (41%), Gaps = 9/189 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNR----YVLYSNDNRELRILKMYRKNKRFIAT 63
           +++A IG  HG+ GEV ++   + P               +   L I      + R +  
Sbjct: 3   LVVARIGRAHGIKGEVTVEVRTDEPELRLGPGAVLATDPAEKGPLTIESGRVHSGRLLLR 62

Query: 64  FSGIDNIHSASELRDLKLYAKRQ--DFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
           F  + +   A  LR++ L A+       +   +E+EF++  L +++     G   G++  
Sbjct: 63  FENVRDRTGAEALRNILLIAEVDPAQLPE---DEEEFYDHQLIDLDVVLADGTEIGRITE 119

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQYDC 181
           + +  +  +  ++       +IPF +  V E++L+E + +I P    ++ +         
Sbjct: 120 ISHLPSQDLFIVERPDGSEVMIPFVEEIVTEIDLEEQRAVITPPPGLIDESEAVVASARD 179

Query: 182 PLDSAGKKS 190
              + G+ +
Sbjct: 180 AEHAEGQDA 188


>gi|294500957|ref|YP_003564657.1| 16S rRNA processing protein RimM [Bacillus megaterium QM B1551]
 gi|295706303|ref|YP_003599378.1| 16S rRNA processing protein RimM [Bacillus megaterium DSM 319]
 gi|294350894|gb|ADE71223.1| 16S rRNA processing protein RimM [Bacillus megaterium QM B1551]
 gi|294803962|gb|ADF41028.1| 16S rRNA processing protein RimM [Bacillus megaterium DSM 319]
          Length = 170

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 35/172 (20%), Positives = 69/172 (40%), Gaps = 10/172 (5%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-------YVLYSNDNRELRILKMYRKNK 58
           K   +  I  THG+ GEV I S  +   +          +    ++  E+ +    R   
Sbjct: 2   KWFKVGKIVNTHGVKGEVRIVSTTDFADERYEKGNKLYIFKEKQSEPVEVTVASHRRHKN 61

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
             + TF G  N++   + ++ ++    +     +LE+ EF+  ++         G   G 
Sbjct: 62  FDLLTFEGYQNVNDVEQYKNCEVKIPEEQL--TDLEDGEFYFHEIIGCTVKTEDGVEVGT 119

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           V  +   GA  +  +K    K  LIP+    V  +++ E +I+I  +   L+
Sbjct: 120 VKEILTPGANDVWVVK-KGGKEVLIPYIDDVVQSIDIDEKEIVITVMEGLLD 170


>gi|330685679|gb|EGG97320.1| 16S rRNA processing protein RimM [Staphylococcus epidermidis
           VCU121]
          Length = 167

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 45/168 (26%), Positives = 80/168 (47%), Gaps = 8/168 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDN-----RELRILKMYRKNKRFIA 62
           V +  I  THG+ GEV + S ++      +             +EL +          + 
Sbjct: 3   VEVGQIVNTHGIKGEVKVKSNSDFTDTRFQPGEVLTAKLNQIEKELTVTSYRTHKGFHML 62

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F GIDNI+    L+   LY +R   +D ELEE+EF+ +D+     FD + +  G++  +
Sbjct: 63  KFEGIDNINDIEYLKGALLYQERDH-EDIELEENEFYYSDIIGCTVFDDEQQPIGRITSI 121

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           +  GA  +  +K   +K +LIP+    V EV+++   ++I P+   L+
Sbjct: 122 FETGANDVWVVK--GDKEYLIPYIADVVKEVDVENKTVIITPMEGLLD 167


>gi|300361926|ref|ZP_07058103.1| 16S rRNA processing protein RimM [Lactobacillus gasseri JV-V03]
 gi|300354545|gb|EFJ70416.1| 16S rRNA processing protein RimM [Lactobacillus gasseri JV-V03]
          Length = 173

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 43/175 (24%), Positives = 80/175 (45%), Gaps = 8/175 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-----YVLYSNDNRELRILKMYRKNK 58
           + +   +  I + HGL GEV +++  + P +        ++  S+  +EL +    R  +
Sbjct: 1   MTEYFEVGKILSPHGLTGEVKVNATTDFPEERLANGSRLFIKNSDQYQELIVEATRRHKQ 60

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFD-RQGKYWG 117
            ++  F GID+I  A ++R  +LY    D   +EL E  ++  D+     +D + G+  G
Sbjct: 61  FYLVKFEGIDDIDQAEKVRGKELYVAETD--QQELPEGSYYFKDILNCPVYDAKTGEKLG 118

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNT 172
            +  +   GA  I EIK    K+F IP  +  V  V+L   +I +  +    +  
Sbjct: 119 VLANIETPGANDIWEIKPEHGKSFWIPNIESVVNNVDLANKRIEVTLLEGLRDEN 173


>gi|238852594|ref|ZP_04643004.1| 16S rRNA processing protein RimM [Lactobacillus gasseri 202-4]
 gi|238834740|gb|EEQ26967.1| 16S rRNA processing protein RimM [Lactobacillus gasseri 202-4]
          Length = 173

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 41/175 (23%), Positives = 78/175 (44%), Gaps = 8/175 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-----YVLYSNDNRELRILKMYRKNK 58
           + +   +  I + HGL GEV +++  + P +        ++  S+  +EL +    R  +
Sbjct: 1   MTEYFEVGKILSPHGLKGEVKVNATTDFPEERLANGSRLFIKNSDQYQELIVDGARRHKQ 60

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFD-RQGKYWG 117
            ++  F  ID+I  A ++   +LY    D   +EL E  ++  D+     +D   G+  G
Sbjct: 61  FYLVKFEEIDDIDQAEKVCGKELYVAETD--QQELPEGSYYFKDILNCPVYDAETGEKLG 118

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNT 172
            +  +   GA  I EIK    K+F IP  +  V +V+L   +I +  +    +  
Sbjct: 119 VLANIETPGANDIWEIKPERGKSFWIPNIESVVNKVDLANKRIEVTLLEGLRDEN 173


>gi|256379918|ref|YP_003103578.1| 16S rRNA processing protein RimM [Actinosynnema mirum DSM 43827]
 gi|255924221|gb|ACU39732.1| 16S rRNA processing protein RimM [Actinosynnema mirum DSM 43827]
          Length = 172

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 32/171 (18%), Positives = 65/171 (38%), Gaps = 7/171 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY------VLYSNDNRELRILKMYRKNKRFI 61
           V++  +   HG+ GE+ +D   ++P             L    +R+L +      + R +
Sbjct: 3   VVVGRVAKAHGIRGELAVDVRTDSPEARFALGSVLAAKLRDGTSRDLTVAAARYHSGRLL 62

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
             F  +     A  LR   L          +  ++ F++  LE +      G   G V  
Sbjct: 63  VRFEEVLTRDVAELLRGTLLLGSTDALPPTDDPDE-FYDHQLEGLAAELADGTRIGTVKE 121

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNT 172
           + +   G +L +        L+PF +  V  V++   ++++DP    L+  
Sbjct: 122 IVHGPGGELLVLVREDGSEALVPFVRQIVPTVDVAGGRVVVDPPEGLLDAD 172


>gi|27364980|ref|NP_760508.1| 16S rRNA-processing protein RimM [Vibrio vulnificus CMCP6]
 gi|37680971|ref|NP_935580.1| 16S rRNA-processing protein [Vibrio vulnificus YJ016]
 gi|320155364|ref|YP_004187743.1| 16S rRNA processing protein RimM [Vibrio vulnificus MO6-24/O]
 gi|29611849|sp|Q8DC32|RIMM_VIBVU RecName: Full=Ribosome maturation factor rimM
 gi|46397679|sp|Q7MHT2|RIMM_VIBVY RecName: Full=Ribosome maturation factor rimM
 gi|27361126|gb|AAO10035.1| 16S rRNA processing protein RimM [Vibrio vulnificus CMCP6]
 gi|37199721|dbj|BAC95551.1| RimM protein [Vibrio vulnificus YJ016]
 gi|319930676|gb|ADV85540.1| 16S rRNA processing protein RimM [Vibrio vulnificus MO6-24/O]
          Length = 182

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 41/173 (23%), Positives = 77/173 (44%), Gaps = 12/173 (6%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRF 60
           D+ +++   G+T+G+ G + + SY +N   L  Y  +      +  E ++    R NK  
Sbjct: 11  DERIVVGKFGSTYGIRGWLKVFSYTDNAESLFDYSPWYVNQKGEWVEFKVESWKRHNKGM 70

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +A   G+D    A  L +L++        +  L EDEF+  +L  M+     G   G V 
Sbjct: 71  VAKLEGLDVREDAHLLTNLEIAIDPAVLPE--LSEDEFYWRELFGMQVVTTNGYDLGVVT 128

Query: 121 GVYNFGAGSILEIKNT-----MEKTFLIPFTKF-AVLEVNLQENKILIDPIAA 167
            +   G+  +L +K        +K  LIPF +   +++V+ +  +I +D    
Sbjct: 129 DMLETGSNDVLVVKANLKDAFGQKERLIPFLEEQVIIKVDREAQRIEVDWDPG 181


>gi|217979018|ref|YP_002363165.1| 16S rRNA-processing protein RimM [Methylocella silvestris BL2]
 gi|217504394|gb|ACK51803.1| 16S rRNA processing protein RimM [Methylocella silvestris BL2]
          Length = 199

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 51/180 (28%), Positives = 84/180 (46%), Gaps = 11/180 (6%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSN--DNRELRILKMYRKN-KRFI 61
           D+LVL+   G  HG+ GE+ + S+  NP  ++ Y   ++    +   IL         F+
Sbjct: 12  DRLVLIGRFGAPHGVRGELRLQSFTENPAAISSYGPLTDRLGAKAFSILTARAVKPDLFV 71

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               G+D+  +A  L +++++  R+       +E  F+  DL  +E  D     +G+V  
Sbjct: 72  VKLKGVDDRTAAEALTNVEVFVAREKLPAAAEDE--FYLADLIGLEALDASRAPFGRVKN 129

Query: 122 VYNFGAGSILEIKNTMEKT-FLIPFTKFAVLEVNLQENKILIDPI-----AAGLNNTTMK 175
           V +FGAG ILEI+        L+PFT+    E++L    I+IDP       A L N    
Sbjct: 130 VLDFGAGDILEIEPAGGGETLLLPFTRQVAPEIDLAAGFIVIDPPVERAAPAFLQNDETD 189


>gi|292670613|ref|ZP_06604039.1| 16S rRNA processing protein RimM [Selenomonas noxia ATCC 43541]
 gi|292647779|gb|EFF65751.1| 16S rRNA processing protein RimM [Selenomonas noxia ATCC 43541]
          Length = 162

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 31/162 (19%), Positives = 60/162 (37%), Gaps = 2/162 (1%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIATF 64
           D+ +++  +G  HG+ G + I    + P            +  L I  M  + K  +  F
Sbjct: 3   DERIVIGRVGAPHGVRGALRIIPLTDFPERFASLHEVMAGDELLHIEHMKPQGKNILMRF 62

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
                   A  L    L   R       L E E++  D+  +  +D  G   G V  V  
Sbjct: 63  REYAAREDAQRLTGRLLTVPRAQ--AAPLGEGEYYVFDIVGLAVYDEAGNELGIVENVLR 120

Query: 125 FGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIA 166
            G+  +  ++    +  L+P  +  VL+++L   ++ +    
Sbjct: 121 TGSNDVYAVRTEDGRELLVPALRAVVLQIDLNAGRMTVRLPE 162


>gi|290967719|ref|ZP_06559274.1| 16S rRNA processing protein RimM [Megasphaera genomosp. type_1 str.
           28L]
 gi|290782235|gb|EFD94808.1| 16S rRNA processing protein RimM [Megasphaera genomosp. type_1 str.
           28L]
          Length = 167

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 34/161 (21%), Positives = 66/161 (40%), Gaps = 2/161 (1%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIATFS 65
           +L  +  I   HG+ G+V I    + P    +        +   I          +  F+
Sbjct: 5   ELFTIGKIVAPHGVRGDVRIYPDTDFPERFLQMKYGYIAGKRYEITAARFHKHVILMKFA 64

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNF 125
           G+ + ++A  L + +L   R+D     L+   ++  DL  +  +D Q  Y G +  V   
Sbjct: 65  GVQDRNAAEALVNHELQVPREDL--MPLKPGRYYIFDLIGIPVYDLQNTYLGILTEVLKT 122

Query: 126 GAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIA 166
           G+  +  ++    +  L       V E+NL E+KI+++P  
Sbjct: 123 GSNDVYVVRTDNGEEQLFAAIPSVVKEINLDEHKIILNPPE 163


>gi|269140192|ref|YP_003296893.1| 16S rRNA-processing protein [Edwardsiella tarda EIB202]
 gi|267985853|gb|ACY85682.1| 16S rRNA-processing protein [Edwardsiella tarda EIB202]
 gi|304560023|gb|ADM42687.1| 16S rRNA processing protein RimM [Edwardsiella tarda FL6-60]
          Length = 181

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 30/173 (17%), Positives = 69/173 (39%), Gaps = 12/173 (6%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRF 60
              V++  +G+ +G+ G + + S   +   +  Y  +          + +      N+ +
Sbjct: 10  SNAVVLGKLGSAYGIRGWLRVFSSTEDAESIFDYQPWFIQQAGKWVAIELESWRSHNQDW 69

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +    GID+  +A+ + + ++           L+E +++  DL   +     G   G+V 
Sbjct: 70  VVKIKGIDDRDAANAMVNREIIVDESQMPS--LDEGDYYWKDLMGCQVVTVSGYALGKVT 127

Query: 121 GVYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILIDPIAA 167
            +   G+  +L +K  ++     K  LIPF     + +V+L    I +D    
Sbjct: 128 AMMETGSNDVLVVKANLKDAFGMKERLIPFLDGQVIKKVDLTAKSIEVDWDPG 180


>gi|238923880|ref|YP_002937396.1| 16S rRNA-processing protein [Eubacterium rectale ATCC 33656]
 gi|238875555|gb|ACR75262.1| 16S rRNA-processing protein [Eubacterium rectale ATCC 33656]
          Length = 178

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 41/170 (24%), Positives = 78/170 (45%), Gaps = 6/170 (3%)

Query: 3   KLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDN----RELRILKMYRKNK 58
           +++ L+ +  I +THG+ GEV +    ++     +      DN    R+L I  +     
Sbjct: 10  RMEDLLQVGVITSTHGIRGEVKVFPTTDDAARFKKLKNVILDNGKERRDLEITSVKFFKN 69

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
           + I  F GID+I+   + +   L+  R++     LEE+E+F  DL  +     +G+  G 
Sbjct: 70  QVILKFKGIDDINDVEKYKKAPLFVTREN--AVPLEENEYFIADLIGLSVTSDEGEELGV 127

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAG 168
           +  V   GA  +  +K       LIP  K  +L+V+++   + +  +A  
Sbjct: 128 IDDVLQTGANDVYVVKKAGANDLLIPAIKDCILDVDVENGTMKVHLLAGL 177


>gi|72161068|ref|YP_288725.1| 16S rRNA-processing protein RimM [Thermobifida fusca YX]
 gi|109893064|sp|Q47S65|RIMM_THEFY RecName: Full=Ribosome maturation factor rimM
 gi|71914800|gb|AAZ54702.1| 16S rRNA processing protein RimM [Thermobifida fusca YX]
          Length = 170

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 34/167 (20%), Positives = 68/167 (40%), Gaps = 6/167 (3%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLN----RYVLYSNDNRELRILKMYRKNKRFIAT 63
           +++  IG  HG+ GEV ++   ++P +             D   L I        R +  
Sbjct: 3   LVVGRIGRPHGVKGEVTVEVRTDSPEERFVVGKALETDPADVGPLTITAQRWHKDRLLVR 62

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F  + +  +A +LR + L     +    +  ++ F + +L  +      G+  G+V  V 
Sbjct: 63  FEEVPDRTAAEQLRGVFLVVDSAELPPLDDPDE-FHDHELIGLRVETVDGEAVGEVVDVL 121

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           +  A  +L +        L+PF +  V +V+    +++IDP    L 
Sbjct: 122 HH-AQDMLVVSGEKGSEVLVPFVRELVPDVDTAAGRVVIDPPPGLLE 167


>gi|88860522|ref|ZP_01135160.1| 16S rRNA processing protein [Pseudoalteromonas tunicata D2]
 gi|88817720|gb|EAR27537.1| 16S rRNA processing protein [Pseudoalteromonas tunicata D2]
          Length = 176

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 36/173 (20%), Positives = 77/173 (44%), Gaps = 12/173 (6%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRK 56
           M   +  +++  +G  +G+ G + + S+ ++P+ +  +  +        +  +++   R 
Sbjct: 1   MSLENTSIVVGKLGAPYGIKGWLKVHSFTDDPVGIFDFSPWLIGQQGKWQSFKVVDWRRH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           +K FIA F+ ID+   A    + +++ +     +  L + EF+  DL  M     +G   
Sbjct: 61  SKGFIAKFANIDDRDQALVYTNAEIFVELSQLPE--LPQGEFYWRDLIGMSVTTDKGYSL 118

Query: 117 GQVCGVYNFGAGSILEIKNTME-----KTFLIPF-TKFAVLEVNLQENKILID 163
           G V  +   G+  +L +K            LIPF T   +L V+ +  +I +D
Sbjct: 119 GIVDDLMETGSNDVLVVKANNNDGFGQAERLIPFLTDTVILNVDAEARQITVD 171


>gi|312869889|ref|ZP_07730028.1| 16S rRNA processing protein RimM [Lactobacillus oris PB013-T2-3]
 gi|311094474|gb|EFQ52779.1| 16S rRNA processing protein RimM [Lactobacillus oris PB013-T2-3]
          Length = 168

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 32/168 (19%), Positives = 68/168 (40%), Gaps = 7/168 (4%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-----YVLYSNDNRELRILKMYRKNKRF 60
           +   +  I  THG+ GEV +    +   +        Y+  +    EL I +  +     
Sbjct: 2   QFYNVGKIVNTHGIRGEVRVLPTTDFVDERFAPQQKLYLQGTGAPVELTIERSRQHKGFI 61

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +  F G DNI+     R+ +L     D   + LE+ +++   +  +      G+  G+V 
Sbjct: 62  LVKFVGYDNINDVESFRNHELMVSAAD--QQPLEDGQYYYHQIIGLTVKTVAGEELGKVK 119

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAG 168
            +   GA  +  ++   +   L+P     V +V+L   ++L++ +   
Sbjct: 120 EILAPGANDVWVVERPGKADLLLPVIDDVVKQVDLDNGQVLVELMEGL 167


>gi|238921087|ref|YP_002934602.1| 16S rRNA-processing protein RimM [Edwardsiella ictaluri 93-146]
 gi|238870656|gb|ACR70367.1| 16S rRNA processing protein RimM, putative [Edwardsiella ictaluri
           93-146]
          Length = 184

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 29/173 (16%), Positives = 69/173 (39%), Gaps = 12/173 (6%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRF 60
              V++  +G+ +G+ G + + S   +   +  Y  +          + +      N+ +
Sbjct: 13  SNAVVLGKLGSAYGIRGWLRVFSSTEDAESIFDYQPWFIQQAGKWVAIELESWRSHNQDW 72

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +    GID+  +A+ + + ++           L++ +++  DL   +     G   G+V 
Sbjct: 73  VVKIKGIDDRDAANTMVNREIVVDESQLPS--LDDGDYYWKDLMGCQVVTVSGYALGKVT 130

Query: 121 GVYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILIDPIAA 167
            +   G+  +L +K  ++     K  LIPF     + +V+L    I +D    
Sbjct: 131 AMMETGSNDVLVVKANLKDAFGMKERLIPFLDGQVIKKVDLTAKSIEVDWDPG 183


>gi|332307107|ref|YP_004434958.1| 16S rRNA processing protein RimM [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332174436|gb|AEE23690.1| 16S rRNA processing protein RimM [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 176

 Score =  138 bits (349), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 39/173 (22%), Positives = 76/173 (43%), Gaps = 12/173 (6%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRK 56
           M      +++  IG  +G+ G V I SY +    +  Y  +      + +E+ + +    
Sbjct: 1   MSHASDTLVIGKIGAPYGVKGWVKITSYTDELDGIFSYTPWLVGQEGNTKEIVVDQWRTH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           NK  +A   G++    A  +++L +  K Q     +L+ DEF+  +L  M+    QG   
Sbjct: 61  NKGLVAKLVGVETRDDAESIKNLDISIKAQQLP--QLDGDEFYWRELVGMQVVTEQGYNL 118

Query: 117 GQVCGVYNFGAGSILEIKNT-----MEKTFLIPF-TKFAVLEVNLQENKILID 163
           G V  ++  GA  ++ IK        +K  ++P+     V +V+ +   I +D
Sbjct: 119 GVVKELFETGANDVMLIKANLKDAFGQKERMVPYLIDQVVKQVDREAKTIQVD 171


>gi|318056566|ref|ZP_07975289.1| 16S rRNA-processing protein RimM [Streptomyces sp. SA3_actG]
 gi|318077468|ref|ZP_07984800.1| 16S rRNA-processing protein RimM [Streptomyces sp. SA3_actF]
          Length = 235

 Score =  138 bits (349), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 35/187 (18%), Positives = 78/187 (41%), Gaps = 6/187 (3%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNR----YVLYSNDNRELRILKMYRKNKRFIAT 63
           +++A IG  HG+ GEV ++   + P                   L I +    + R +  
Sbjct: 3   LVVARIGRAHGIKGEVTVEVRTDEPELRLPPGAVLATDPPGAGPLTIEQGRVHSGRLLLR 62

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F+G+ +  +A  LR+  L     D ++   + +EF++  L +++     G+  G++  + 
Sbjct: 63  FAGVKDRTAAEALRN-TLLIAEIDPEEVPEDPEEFYDYQLMDLDVVTEDGQEIGRITEIS 121

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMK-NPQYDCP 182
           +  +  +  ++       +IPF +  V E++L E + +I+P    L+        + +  
Sbjct: 122 HLPSQDLFIVERPDGSEVMIPFVEEIVTEIDLDEQRAVINPPRGLLDLDEADVASERETS 181

Query: 183 LDSAGKK 189
               G  
Sbjct: 182 RTETGAA 188


>gi|333024168|ref|ZP_08452232.1| putative 16S rRNA-processing protein RimM [Streptomyces sp. Tu6071]
 gi|332744020|gb|EGJ74461.1| putative 16S rRNA-processing protein RimM [Streptomyces sp. Tu6071]
          Length = 236

 Score =  138 bits (349), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 35/187 (18%), Positives = 78/187 (41%), Gaps = 6/187 (3%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNR----YVLYSNDNRELRILKMYRKNKRFIAT 63
           +++A IG  HG+ GEV ++   + P                   L I +    + R +  
Sbjct: 3   LVVARIGRAHGIKGEVTVEVRTDEPELRLPPGAVLATDPPGAGPLTIEQGRVHSGRLLLR 62

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F+G+ +  +A  LR+  L     D ++   + +EF++  L +++     G+  G++  + 
Sbjct: 63  FAGVKDRTAAEALRN-TLLIAEIDPEEVPEDPEEFYDYQLMDLDVVTEDGQEVGRITEIS 121

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMK-NPQYDCP 182
           +  +  +  ++       +IPF +  V E++L E + +I+P    L+        + +  
Sbjct: 122 HLPSQDLFIVERPDGSEVMIPFVEEIVTEIDLDEQRAVINPPRGLLDLDEADVASERETS 181

Query: 183 LDSAGKK 189
               G  
Sbjct: 182 RTETGAA 188


>gi|260773520|ref|ZP_05882436.1| 16S rRNA processing protein RimM [Vibrio metschnikovii CIP 69.14]
 gi|260612659|gb|EEX37862.1| 16S rRNA processing protein RimM [Vibrio metschnikovii CIP 69.14]
          Length = 176

 Score =  138 bits (349), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 38/173 (21%), Positives = 76/173 (43%), Gaps = 12/173 (6%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRK 56
           M +  + +++   G ++G+ G + + SY +N   +  Y  +    + +  E ++    R 
Sbjct: 1   MSEQGEKIVVGKFGASYGIRGWLKVLSYTDNAESIFDYSPWLVNQNGEWVEYKVESWKRH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           NK  +A   G+D    A  L + ++        +  L EDEF+  +L  M     QG   
Sbjct: 61  NKGLVAKLEGLDVREDAHLLTNFEISIDPASLPE--LSEDEFYWRELFGMRVVTTQGYDL 118

Query: 117 GQVCGVYNFGAGSILEIKNT-----MEKTFLIPFTKF-AVLEVNLQENKILID 163
           G+V  +   G+  +L +K        +K  LIPF +   + +++    +I +D
Sbjct: 119 GEVVDMLETGSNDVLVVKANLKDAFGQKERLIPFLEEQVIKQIDRTAQRIEVD 171


>gi|153810633|ref|ZP_01963301.1| hypothetical protein RUMOBE_01017 [Ruminococcus obeum ATCC 29174]
 gi|149833029|gb|EDM88111.1| hypothetical protein RUMOBE_01017 [Ruminococcus obeum ATCC 29174]
          Length = 168

 Score =  138 bits (349), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 43/170 (25%), Positives = 76/170 (44%), Gaps = 6/170 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDN----RELRILKMYRKNKR 59
           ++ L+ +  I TTHG+ GEV +    + P           D     R L I  +      
Sbjct: 1   MEDLLKVGVITTTHGVRGEVKVYPTTDEPERFLDLEYVLLDTGKELRRLDIKNVRFFKNL 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F GIDNI+   + +   L+  R++   +EL+EDE++  DL  M+     G  +G +
Sbjct: 61  VILKFDGIDNINDIEKYKGRDLWIPREE--AQELDEDEYYIADLLGMKVLLEDGSEFGTL 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
             V   GA  +  + +      L+P  K  +L+V+++ N + +  +   L
Sbjct: 119 KNVMETGANDVYIVDSVEHGEVLLPAIKECILDVDIETNTMTVHLMKGLL 168


>gi|329733641|gb|EGG69969.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus 21193]
          Length = 167

 Score =  138 bits (349), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 48/168 (28%), Positives = 84/168 (50%), Gaps = 8/168 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY-----VLYSNDNRELRILKMYRKNKRFIA 62
           V +  I  THG+ GE+ + S ++      +      V+++N++ E  +          + 
Sbjct: 3   VEVGQIVNTHGIKGEIKVKSNSDFTDVRFQPGQVLTVVHNNNDLEYTVKSHRVHKGLHML 62

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
           TF GI+NI+    L+   +Y +R   +D  LEE+EF+ +D+     FD Q    G+V  +
Sbjct: 63  TFEGINNINDIEHLKGSSIYQERDH-EDIVLEENEFYYSDIIGCTVFDDQETPIGRVTNI 121

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           +  GA  +  IK    K +LIP+    V EV+++  KI+I P+   L+
Sbjct: 122 FETGANDVWVIK--GSKEYLIPYIADVVKEVDVENKKIIITPMEGLLD 167


>gi|227551891|ref|ZP_03981940.1| 16S rRNA processing protein RimM [Enterococcus faecium TX1330]
 gi|257895518|ref|ZP_05675171.1| ribosome maturation factor rimM [Enterococcus faecium Com12]
 gi|293378383|ref|ZP_06624552.1| 16S rRNA processing protein RimM [Enterococcus faecium PC4.1]
 gi|293570324|ref|ZP_06681384.1| 16S rRNA processing protein RimM [Enterococcus faecium E980]
 gi|227178963|gb|EEI59935.1| 16S rRNA processing protein RimM [Enterococcus faecium TX1330]
 gi|257832083|gb|EEV58504.1| ribosome maturation factor rimM [Enterococcus faecium Com12]
 gi|291609603|gb|EFF38865.1| 16S rRNA processing protein RimM [Enterococcus faecium E980]
 gi|292643247|gb|EFF61388.1| 16S rRNA processing protein RimM [Enterococcus faecium PC4.1]
          Length = 174

 Score =  138 bits (349), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 32/176 (18%), Positives = 74/176 (42%), Gaps = 8/176 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR------YVLYSNDNRELRILKMYRKN 57
           + + + +  I  T G+ GEV + S  + P +  +               EL +    +  
Sbjct: 1   MTEYLNVGKIVNTQGIKGEVRVISTTDFPEERYKKGTVLTLFQDGKAPIELTVKSHRKHK 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              + +F G  +I+   + RD  L   + +    +L+E+EF+  ++  +   +  G   G
Sbjct: 61  NFDLLSFEGHPSINDVEKYRDGILKVSKDN--SVDLDENEFYYHEIIGLRVVEEDGTELG 118

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTT 173
           +V  + + GA  +  ++   +   L+P+    V EV+L+   I ++     +++  
Sbjct: 119 KVKEILSPGANDVWVVQRPKKADILLPYIASVVKEVDLEAGVIRVEIPEGLIDDED 174


>gi|226939294|ref|YP_002794365.1| 16S rRNA-processing protein RimM [Laribacter hongkongensis HLHK9]
 gi|226714218|gb|ACO73356.1| RimM [Laribacter hongkongensis HLHK9]
          Length = 168

 Score =  138 bits (349), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 42/166 (25%), Positives = 78/166 (46%), Gaps = 7/166 (4%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKN 57
           +K   LV+M  +    G+ G V I +       L  Y  +     +  +E R+++   + 
Sbjct: 1   MKTQDLVVMGYVSGAFGVRGWVRIQADTEYADGLFDYPTWWIGREDSWQEYRVVEGKAQP 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
           K  +A   G+D+   A  LR  ++   R    +    ++EF+  DL  M   +  G  +G
Sbjct: 61  KGVVAQLEGVDDRDVACALRGCEVAIPRSALPET--GDNEFYWADLIGMAVSNPAGTAFG 118

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
            V  +   GA  +L +++  ++T LIPF K  +L+V+LQ  ++ +D
Sbjct: 119 VVDSLMQTGANDVLVVRDGKQQT-LIPFVKAFILDVDLQARRLTVD 163


>gi|119946971|ref|YP_944651.1| 16S rRNA processing protein RimM [Psychromonas ingrahamii 37]
 gi|166226470|sp|A1SZY7|RIMM_PSYIN RecName: Full=Ribosome maturation factor rimM
 gi|119865575|gb|ABM05052.1| 16S rRNA processing protein RimM [Psychromonas ingrahamii 37]
          Length = 175

 Score =  138 bits (349), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 39/173 (22%), Positives = 68/173 (39%), Gaps = 13/173 (7%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRK 56
           M K  + +++   G  HG+ G + + SY ++P  +  Y           +E+ I    R 
Sbjct: 1   MSKKAEPIVIGKFGAVHGIKGWLKVHSYTDDPESIFEYKPLLMKSKGQFQEVNIADWKRH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           +  F+A   G D    A  L  L+L        + E +   F+  DL   +     G   
Sbjct: 61  SNGFVAKIVGFDVREEAQALVGLELLVDSDKLPNLEED---FYWRDLIGCQVKTDNGYDL 117

Query: 117 GQVCGVYNFGAGSILEIKNT-----MEKTFLIPFT-KFAVLEVNLQENKILID 163
           G V  +   G+  +L +K        +K  LIPF  K  +  V++    I ++
Sbjct: 118 GVVTEIMETGSNDVLVVKANSNDAFGQKERLIPFIDKQVISNVDITSKLIQVN 170


>gi|315126109|ref|YP_004068112.1| 16S rRNA processing protein [Pseudoalteromonas sp. SM9913]
 gi|315014623|gb|ADT67961.1| 16S rRNA processing protein [Pseudoalteromonas sp. SM9913]
          Length = 178

 Score =  138 bits (349), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 35/171 (20%), Positives = 73/171 (42%), Gaps = 12/171 (7%)

Query: 3   KLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRKNK 58
               ++++  +G  +G+ G + + S+ ++P  +  +  +        + L ++   R NK
Sbjct: 5   NTSSIIVVGKLGAPYGIKGWLKVHSFTDDPQGIFDFSPWLIGQQGKWQSLEVVDWRRHNK 64

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
            FIA F+ +++   A    ++++        +  L + EF+  DL  M     +G   G 
Sbjct: 65  GFIAKFAQVNDRDQAMAYTNVEISVDSAQLPE--LPQGEFYWRDLIGMSVVTDKGYNLGI 122

Query: 119 VCGVYNFGAGSILEIKNTME-----KTFLIPF-TKFAVLEVNLQENKILID 163
           V  +   G+  +L +K   +        LIPF T   + EV     +I +D
Sbjct: 123 VDDLMETGSNDVLVVKANSKDAFGQAERLIPFLTDSVIQEVKYDAKEITVD 173


>gi|291527946|emb|CBK93532.1| 16S rRNA processing protein RimM [Eubacterium rectale M104/1]
          Length = 168

 Score =  138 bits (349), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 41/169 (24%), Positives = 77/169 (45%), Gaps = 6/169 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDN----RELRILKMYRKNKR 59
           ++ L+ +  I +THG+ GEV +    ++     +      DN    R+L I  +     +
Sbjct: 1   MEDLLQVGVITSTHGIRGEVKVFPTTDDAARFKKLKNVILDNGKERRDLEITSVKFFKNQ 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F GID+I+   + +   L+  R++     LEE+E+F  DL  +     +G+  G +
Sbjct: 61  VILKFKGIDDINDVEKYKKAPLFVTREN--AVPLEENEYFIADLIGLSVTSDEGEELGVI 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAG 168
             V   GA  +  +K       LIP  K  +L+V+++   + +  +A  
Sbjct: 119 ADVLQTGANDVYVVKKAGANDLLIPAIKDCILDVDVENGTMKVHLLAGL 167


>gi|229549757|ref|ZP_04438482.1| 16S rRNA processing protein RimM [Enterococcus faecalis ATCC 29200]
 gi|255972453|ref|ZP_05423039.1| 16S rRNA processing protein RimM [Enterococcus faecalis T1]
 gi|257087114|ref|ZP_05581475.1| 16S rRNA processing protein RimM [Enterococcus faecalis D6]
 gi|312950936|ref|ZP_07769846.1| 16S rRNA processing protein RimM [Enterococcus faecalis TX0102]
 gi|229305026|gb|EEN71022.1| 16S rRNA processing protein RimM [Enterococcus faecalis ATCC 29200]
 gi|255963471|gb|EET95947.1| 16S rRNA processing protein RimM [Enterococcus faecalis T1]
 gi|256995144|gb|EEU82446.1| 16S rRNA processing protein RimM [Enterococcus faecalis D6]
 gi|310631085|gb|EFQ14368.1| 16S rRNA processing protein RimM [Enterococcus faecalis TX0102]
 gi|315025913|gb|EFT37845.1| 16S rRNA processing protein RimM [Enterococcus faecalis TX2137]
 gi|315147568|gb|EFT91584.1| 16S rRNA processing protein RimM [Enterococcus faecalis TX4244]
 gi|315152221|gb|EFT96237.1| 16S rRNA processing protein RimM [Enterococcus faecalis TX0031]
 gi|315159820|gb|EFU03837.1| 16S rRNA processing protein RimM [Enterococcus faecalis TX0312]
          Length = 174

 Score =  138 bits (349), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 35/176 (19%), Positives = 74/176 (42%), Gaps = 8/176 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR------YVLYSNDNRELRILKMYRKN 57
           +   + +  I  T G+ GEV + S  + P +  +               EL +    +  
Sbjct: 1   MTDYLNVGKIVNTQGIKGEVRVISKTDFPEERYQKGATLLLFQEKKAPIELVVESHRKHK 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              I +F G  NI+   + RD  L   + +  +  L EDEF+   +     +D  G   G
Sbjct: 61  NFDILSFEGHPNINDVEKYRDGILKVAKDNLAE--LGEDEFYYHQIIGATVYDETGSELG 118

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTT 173
           ++  + + GA  +  ++   +K  L+P+ +  V +V+++  +I +D     +++  
Sbjct: 119 KIKEILSPGANDVWVVQRPKKKDLLLPYIEGVVTKVDVENQRIDVDIPEGLIDDEN 174


>gi|29829184|ref|NP_823818.1| 16S rRNA-processing protein RimM [Streptomyces avermitilis MA-4680]
 gi|48474815|sp|Q82JW2|RIMM_STRAW RecName: Full=Ribosome maturation factor rimM
 gi|29606290|dbj|BAC70353.1| putative 16S rRNA processing protein [Streptomyces avermitilis
           MA-4680]
          Length = 186

 Score =  138 bits (349), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 36/183 (19%), Positives = 84/183 (45%), Gaps = 6/183 (3%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPI-DLNRYVLYSNDN---RELRILKMYRKNKRFIAT 63
           +++A IG  HG+ GEV ++   + P   L    + + D      L I      + R +  
Sbjct: 3   LVVARIGRAHGIKGEVTVEVRTDEPELRLGPGAVLATDPASVGPLTIETGRVHSGRLLLR 62

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F G+ + + A  LR+  L     D  +   + DE+++  L +++   + G   G++  + 
Sbjct: 63  FEGVRDRNGAEALRN-TLLIAEVDPDEVPEDPDEYYDHQLMDLDVVTKDGTEVGRITEIS 121

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN-TTMKNPQYDCP 182
           +  +  +  ++ +      IPF +  V+E++L+E + +IDP    +++   + +   +  
Sbjct: 122 HLPSQDLFVVERSDGSEVYIPFVEEIVVEIDLEEQRAVIDPPPGLIDDRAEVDSSDTEAA 181

Query: 183 LDS 185
            ++
Sbjct: 182 TEA 184


>gi|239636282|ref|ZP_04677284.1| 16S rRNA processing protein RimM [Staphylococcus warneri L37603]
 gi|239597637|gb|EEQ80132.1| 16S rRNA processing protein RimM [Staphylococcus warneri L37603]
          Length = 167

 Score =  138 bits (349), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 44/168 (26%), Positives = 80/168 (47%), Gaps = 8/168 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDN-----RELRILKMYRKNKRFIA 62
           V +  I  THG+ GEV + S ++      +             +EL +          + 
Sbjct: 3   VEVGQIVNTHGIKGEVKVKSNSDFTDTRFQPGEVLTAKLNQIEKELTVTSYRTHKGFHML 62

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F GIDNI+    L+   LY +R   +D ELEE+EF+ +D+     FD + +  G++  +
Sbjct: 63  KFEGIDNINDIEYLKGAVLYQERDH-EDIELEENEFYYSDIIGCTVFDDEQQPIGRITSI 121

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           +  GA  +  +K   +K +LIP+    V +V+++   ++I P+   L+
Sbjct: 122 FETGANDVWVVK--GDKEYLIPYIADVVKDVDVENKTVIITPMEGLLD 167


>gi|291522196|emb|CBK80489.1| 16S rRNA processing protein RimM [Coprococcus catus GD/7]
          Length = 169

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 35/171 (20%), Positives = 73/171 (42%), Gaps = 6/171 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDN----RELRILKMYRKNKR 59
           ++K + +  I ++HG+ GE  +    ++     +      D     +EL I  +    + 
Sbjct: 1   MEKYLRVGVISSSHGVRGEAKVFPTTDDVQRFKKLKTCILDTGREYKELHIESVKFFKQM 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F  I +I    + +   L   R      +LEE+E+F  DL  ++    +G+ +G +
Sbjct: 61  VILKFKEIASIDEVMQYKGKDLLVTRDQ--AVKLEENEYFICDLIGLKVVTDEGEDFGVL 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
             V   GA  +  +K    K  L+P     +L+V+L+  ++    +   ++
Sbjct: 119 TDVIQTGANDVYAVKCPNGKEVLLPVIDECILDVDLERQQVTAHIMPGLVD 169


>gi|298694532|gb|ADI97754.1| 16S rRNA processing protein [Staphylococcus aureus subsp. aureus
           ED133]
          Length = 167

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 48/168 (28%), Positives = 84/168 (50%), Gaps = 8/168 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY-----VLYSNDNRELRILKMYRKNKRFIA 62
           V +  I  THG+ GE+ + S ++      +      V+++N++ E  +          + 
Sbjct: 3   VEVGQIVNTHGIKGEIKVKSNSDFTDVRFQPGQVLTVVHNNNDLEYTVKSHRVHKGLHML 62

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
           TF GI+NI+    L+   +Y +R   +D  LEE+EF+ +D+     FD Q    G+V  +
Sbjct: 63  TFEGINNINDIEHLKGSSIYQERDH-EDIVLEENEFYYSDIIGCTVFDDQETPIGRVINI 121

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           +  GA  +  IK    K +LIP+    V EV+++  KI+I P+   L+
Sbjct: 122 FETGANDVWVIK--GSKEYLIPYIADVVKEVDIENKKIIITPMEGLLD 167


>gi|116629444|ref|YP_814616.1| RimM protein, required for 16S rRNA processing [Lactobacillus
           gasseri ATCC 33323]
 gi|282850845|ref|ZP_06260219.1| 16S rRNA processing protein RimM [Lactobacillus gasseri 224-1]
 gi|311110908|ref|ZP_07712305.1| 16S rRNA processing protein RimM [Lactobacillus gasseri MV-22]
 gi|122273618|sp|Q044E4|RIMM_LACGA RecName: Full=Ribosome maturation factor rimM
 gi|116095026|gb|ABJ60178.1| 16S rRNA processing protein RimM [Lactobacillus gasseri ATCC 33323]
 gi|282557797|gb|EFB63385.1| 16S rRNA processing protein RimM [Lactobacillus gasseri 224-1]
 gi|311066062|gb|EFQ46402.1| 16S rRNA processing protein RimM [Lactobacillus gasseri MV-22]
          Length = 173

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 41/175 (23%), Positives = 77/175 (44%), Gaps = 8/175 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-----YVLYSNDNRELRILKMYRKNK 58
           + +   +  I + HGL GEV +++  + P +        ++  S+  +EL +    R  +
Sbjct: 1   MTEYFEVGKILSPHGLKGEVKVNATTDFPEERLANGSRLFIKNSDQYQELIVDGARRHKQ 60

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFD-RQGKYWG 117
            ++  F  ID I  A ++   +LY    D   +EL E  ++  D+     +D   G+  G
Sbjct: 61  FYLVKFEEIDGIDQAEKVCGKELYVAETD--QQELPEGSYYFKDILNCPVYDAETGEKLG 118

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNT 172
            +  +   GA  I EIK    K+F IP  +  V +V+L   +I +  +    +  
Sbjct: 119 VLANIETPGANDIWEIKPEHGKSFWIPNIESVVNKVDLANKRIEVTLLEGLRDEN 173


>gi|82750843|ref|YP_416584.1| 16S rRNA-processing protein RimM [Staphylococcus aureus RF122]
 gi|282916489|ref|ZP_06324251.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus D139]
 gi|283770301|ref|ZP_06343193.1| ribosome maturation factor rimM [Staphylococcus aureus subsp.
           aureus H19]
 gi|109893053|sp|Q2YXK2|RIMM_STAAB RecName: Full=Ribosome maturation factor rimM
 gi|82656374|emb|CAI80792.1| 16S rRNA processing protein [Staphylococcus aureus RF122]
 gi|282319929|gb|EFB50277.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus D139]
 gi|283460448|gb|EFC07538.1| ribosome maturation factor rimM [Staphylococcus aureus subsp.
           aureus H19]
          Length = 167

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 47/168 (27%), Positives = 84/168 (50%), Gaps = 8/168 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY-----VLYSNDNRELRILKMYRKNKRFIA 62
           V +  I  THG+ GE+ + S ++      +      V+++N++ E  +          + 
Sbjct: 3   VEVGQIVNTHGIKGEIKVKSNSDFTDVRFQPGQVLTVVHNNNDLEYTVKSHRVHKGLHML 62

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
           TF GI+NI+    L+   +Y +R   +D  LEE+E++ +D+     FD Q    G+V  +
Sbjct: 63  TFEGINNINDIEHLKGSSIYQERDH-EDIVLEENEYYYSDIIGCTVFDDQETPIGRVINI 121

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           +  GA  +  IK    K +LIP+    V EV+++  KI+I P+   L+
Sbjct: 122 FETGANDVWVIK--GSKEYLIPYIADVVKEVDVENKKIIITPMEGLLD 167


>gi|34499129|ref|NP_903344.1| 16S rRNA-processing protein RimM [Chromobacterium violaceum ATCC
           12472]
 gi|48474349|sp|Q7NRV6|RIMM_CHRVO RecName: Full=Ribosome maturation factor rimM
 gi|34104980|gb|AAQ61336.1| 16S rRNA processing protein [Chromobacterium violaceum ATCC 12472]
          Length = 169

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 40/166 (24%), Positives = 72/166 (43%), Gaps = 6/166 (3%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRKN 57
           ++ + LV+M  +    G+ G V I +       L  Y  +    +   +         + 
Sbjct: 1   MRDEDLVVMGFVRGAFGIKGWVKIHADTEYADGLFDYPTWWLGKNGSWKPYAFENGAVQP 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
           K   A   G+D+  +A  LR  ++   R +  +    + E++  DL  +   ++QG+  G
Sbjct: 61  KALAAKLEGVDDRDAAEALRGTQIAIPRSELPEA--GDGEYYWADLIGLSVVNQQGETLG 118

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
           +V  +   GA  +L +K    +  LIPF    VLEV   E +IL+D
Sbjct: 119 KVDSLLETGANDVLVVKGGDGQQRLIPFVDQYVLEVVPAEGRILVD 164


>gi|90421130|ref|ZP_01229032.1| 16S rRNA processing protein rimM [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90334622|gb|EAS48402.1| 16S rRNA processing protein rimM [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 194

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 46/188 (24%), Positives = 80/188 (42%), Gaps = 6/188 (3%)

Query: 3   KLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKRFI 61
           KL+  VL+  +G   G+ GE  + S+  +P DL  Y  L         +L         +
Sbjct: 6   KLENPVLLGVVGGAQGIKGECRVRSFTADPTDLGAYGPLVDASGNRYTVLSARVAKNVVV 65

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
             F  + + + A  L   KL+  R    +   ++DEF+  DL         G   G V  
Sbjct: 66  VRFKEVADRNHAERLNGRKLFVDRSVLPEPA-DDDEFYLEDLVGYAVETVAGDAVGTVIA 124

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP-IAAGLNNTTMKNPQYD 180
            ++F AG I+EI+ T  +T +IPF++ A+  ++ +   ++++P  A      T  +   D
Sbjct: 125 FHDFNAGDIVEIRPTKGQTLMIPFSEAAIPVIDAERRLMVVEPGPAGL---ATPDDAPED 181

Query: 181 CPLDSAGK 188
                 G 
Sbjct: 182 GGEAEGGA 189


>gi|299821782|ref|ZP_07053670.1| 16S rRNA processing protein RimM [Listeria grayi DSM 20601]
 gi|299817447|gb|EFI84683.1| 16S rRNA processing protein RimM [Listeria grayi DSM 20601]
          Length = 171

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 36/173 (20%), Positives = 73/173 (42%), Gaps = 9/173 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANN------PIDLNRYVLYSNDN-RELRILKMYRK 56
           ++K+  +  I  THGL GEV + S  +       P ++  YV  +  + + L I    + 
Sbjct: 1   MEKMYKVGKIVNTHGLMGEVRVISTTDFAAERYVPGNILYYVPKTGGSAQPLTIKSHRQH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
               + TF G   I+    L++  L       +   LEE+ ++  ++        +G+  
Sbjct: 61  KTFDLLTFEGYTGINQVEHLKEGVLKVTESQLQP--LEENAYYFHEIIGCTVVTTEGETL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           G++  +   GA  +  ++   +K  LIP+    V  +++    I I+ +   L
Sbjct: 119 GEIKEILTPGANDVWVVETAAKKEILIPYIADVVKTIDIPTKTITIEVMEGLL 171


>gi|56751848|ref|YP_172549.1| 16S rRNA-processing protein RimM [Synechococcus elongatus PCC 6301]
 gi|81301068|ref|YP_401276.1| 16S rRNA-processing protein RimM [Synechococcus elongatus PCC 7942]
 gi|67461291|sp|Q5N0Z1|RIMM_SYNP6 RecName: Full=Ribosome maturation factor rimM
 gi|109893061|sp|Q31KY0|RIMM_SYNE7 RecName: Full=Ribosome maturation factor rimM
 gi|56686807|dbj|BAD80029.1| 16S rRNA processing protein RimM [Synechococcus elongatus PCC 6301]
 gi|81169949|gb|ABB58289.1| 16S rRNA processing protein RimM [Synechococcus elongatus PCC 7942]
          Length = 182

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 40/173 (23%), Positives = 67/173 (38%), Gaps = 12/173 (6%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLN--------RYVLYSNDNRELRILKMYRKNK 58
            + +  I    GL GE+ ++  ++ P            R      +  EL   +      
Sbjct: 12  WLAIGQIVAPQGLRGEMRVNPSSDFPERFLIPGPRWLRRPRQTEPEVVELERGRAIAGKN 71

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDR-QGKYWG 117
            +I   +GI +   A  LR  +L     D  +  L+E EF   DL ++   D+      G
Sbjct: 72  LYIVQLAGITSREQAEALRGCELLVPASDRPE--LDEGEFHVLDLIDLSVIDQASSTPLG 129

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
            V  V + G   +L ++ T  +   IPF +  V  V+L + +I I P    L 
Sbjct: 130 IVRDVVSAG-NDLLVVELTDGREVYIPFVEAIVPVVDLAQGRIEITPPPGLLE 181


>gi|294634742|ref|ZP_06713272.1| 16S rRNA processing protein RimM [Edwardsiella tarda ATCC 23685]
 gi|291091841|gb|EFE24402.1| 16S rRNA processing protein RimM [Edwardsiella tarda ATCC 23685]
          Length = 181

 Score =  138 bits (348), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 33/174 (18%), Positives = 71/174 (40%), Gaps = 12/174 (6%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKR 59
           +DK V++  +G+ +G+ G + + S   +   +  Y  +          + +      ++ 
Sbjct: 9   MDKAVILGKLGSAYGIRGWLRVFSSTEDAESIFDYQPWFIQQGGKWVAIELESWRNHSQD 68

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +    GID+  +A+ L + ++           LEE +++  DL   +     G   G+V
Sbjct: 69  LVIKIKGIDDRDAANALVNREIAVDESQLPA--LEEGDYYWKDLMGCQVVTVAGYELGKV 126

Query: 120 CGVYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILIDPIAA 167
             +   G+  +L +K  ++     K  LIPF     + +V+L    I +D    
Sbjct: 127 TAMMETGSNDVLVVKANLKDAFGIKERLIPFLDGQVIKKVDLTAKSIEVDWDPG 180


>gi|283470452|emb|CAQ49663.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus ST398]
          Length = 167

 Score =  138 bits (348), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 47/168 (27%), Positives = 84/168 (50%), Gaps = 8/168 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY-----VLYSNDNRELRILKMYRKNKRFIA 62
           V +  I  THG+ GE+ + S ++      +      V+++N++ E  +          + 
Sbjct: 3   VEVGQIVNTHGIKGEIKVKSNSDFTDVRFQPGQVLTVVHNNNDLEYTVKSHRVHKGLHML 62

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
           TF GI+NI+    L+   +Y +R   +D  L+E+EF+ +D+     FD Q    G+V  +
Sbjct: 63  TFEGINNINDIEHLKGSSIYQERDH-EDIVLDENEFYYSDIIGCTVFDDQETPIGRVINI 121

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           +  GA  +  IK    K +LIP+    V EV+++  KI+I P+   L+
Sbjct: 122 FETGANDVWVIK--GSKEYLIPYIADVVKEVDVENKKIIITPMEGLLD 167


>gi|167747200|ref|ZP_02419327.1| hypothetical protein ANACAC_01914 [Anaerostipes caccae DSM 14662]
 gi|317473599|ref|ZP_07932888.1| 16S rRNA processing protein RimM [Anaerostipes sp. 3_2_56FAA]
 gi|167654160|gb|EDR98289.1| hypothetical protein ANACAC_01914 [Anaerostipes caccae DSM 14662]
 gi|316898889|gb|EFV20914.1| 16S rRNA processing protein RimM [Anaerostipes sp. 3_2_56FAA]
          Length = 170

 Score =  138 bits (348), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 38/172 (22%), Positives = 75/172 (43%), Gaps = 6/172 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND----NRELRILKMYRKNKR 59
           ++ ++ +  I +THG+ GEV +    ++            D     + L +        +
Sbjct: 1   MEDILQVGAIASTHGVRGEVKVYPMTDDVERFKDLKEVLLDTGREMKLLHVKSCKFFKNQ 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F   DNI+   + +   L+  R++    +LEE+EFF  D+   + +   GK  G +
Sbjct: 61  PILKFEEFDNINDIEQYKRCGLFVTREN--AVKLEENEFFIADIIGFDVYRETGKKLGIL 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN 171
             V   GA  +  +K    K  L+P  +  + +V+L+E +I +  +   L+ 
Sbjct: 119 DDVLQTGANDVYVVKMDDGKEVLLPAIRDCIKKVSLEEKRIDVFVMKGLLDE 170


>gi|159036842|ref|YP_001536095.1| 16S rRNA-processing protein RimM [Salinispora arenicola CNS-205]
 gi|209573593|sp|A8M679|RIMM_SALAI RecName: Full=Ribosome maturation factor rimM
 gi|157915677|gb|ABV97104.1| 16S rRNA processing protein RimM [Salinispora arenicola CNS-205]
          Length = 180

 Score =  138 bits (348), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 36/180 (20%), Positives = 73/180 (40%), Gaps = 17/180 (9%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPI-DLNRYVLYSNDNR--------------ELRIL 51
           ++++  IG  HG+ GEV ++   + P        +   +                EL + 
Sbjct: 1   MLVVGRIGKPHGIRGEVTVEVRTDEPETRFAPGSVLRTEPGANVPASPGAYRVPSELTVE 60

Query: 52  KMYRKNKRFI-ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFD 110
                  R +   F G+ + + A  LR   +   R D      + +EF +  L  +    
Sbjct: 61  TARWHQGRLLLVAFEGVLDRNVAEALRGTFVGVDRADVTAPT-DPEEFHDHQLVGLAVVT 119

Query: 111 RQGKYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
             G+  G++  + +  A  +L ++   ++  LIPF +  V EV+L   ++++DP    L+
Sbjct: 120 SAGERLGEIVRIDHAPAADLLVLRRPGDRDVLIPFVRAIVPEVDLAGGRVVVDPPGGLLD 179


>gi|297156874|gb|ADI06586.1| 16S rRNA-processing protein RimM [Streptomyces bingchenggensis
           BCW-1]
          Length = 182

 Score =  138 bits (348), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 37/170 (21%), Positives = 70/170 (41%), Gaps = 5/170 (2%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNR----YVLYSNDNRELRILKMYRKNKRFIATFS 65
           MA IG  HG+ GEV ++   + P                   L I      + R +  F+
Sbjct: 1   MARIGRAHGIKGEVTVEVRTDEPELRLAPGAVLATEPASAGPLTIETGRVHSGRLLLRFA 60

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNF 125
           G  +  +A  LR   L     D +D   + +E+++  L +++     G   G++  + + 
Sbjct: 61  GFADRTAAETLRG-TLLIAEVDPEDTPEDPEEYYDHQLIDLDVVTVDGTEVGRISEISHL 119

Query: 126 GAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMK 175
               +L ++       +IPF    V E++L+  + +IDP    L+ T  +
Sbjct: 120 PYQDLLIVRRPDGSEVMIPFVSEVVPEIDLEAQRAVIDPPPGLLDETQAE 169


>gi|163869251|ref|YP_001610507.1| 16S rRNA-processing protein RimM [Bartonella tribocorum CIP 105476]
 gi|189040126|sp|A9IZB5|RIMM_BART1 RecName: Full=Ribosome maturation factor rimM
 gi|161018954|emb|CAK02512.1| 16S rRNA processing protein [Bartonella tribocorum CIP 105476]
          Length = 181

 Score =  138 bits (348), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 61/175 (34%), Positives = 94/175 (53%), Gaps = 2/175 (1%)

Query: 3   KLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND-NRELRILKMYRKNKRFI 61
           KL   V +A IG  HG+ G+V++   + +P     Y    +D  R   I+ +  +    I
Sbjct: 7   KLKNKVYLAIIGMPHGIRGDVFVKILSADPQRFKSYGTLYDDMGRSYEIVTLRTQKNNAI 66

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
             F G++N ++A  L+ + LY  R    D+ L EDEF+  DL  +   +  GK  G+VCG
Sbjct: 67  VRFKGVENRNAAESLKGIHLYVMRDQLIDD-LREDEFYQVDLIGLRVQEYGGKILGEVCG 125

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKN 176
             NFGAG +LEI+    K  LIPF+K AV E+ +    +++DP+AAGL +    +
Sbjct: 126 FCNFGAGDLLEIRLNTGKRMLIPFSKVAVPEICMDSGFLIVDPMAAGLRDGEEND 180


>gi|226945996|ref|YP_002801069.1| 16S rRNA-processing protein RimM [Azotobacter vinelandii DJ]
 gi|259585642|sp|C1DDY6|RIMM_AZOVD RecName: Full=Ribosome maturation factor rimM
 gi|226720923|gb|ACO80094.1| 16S rRNA processing protein RimM [Azotobacter vinelandii DJ]
          Length = 178

 Score =  138 bits (348), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 41/175 (23%), Positives = 86/175 (49%), Gaps = 15/175 (8%)

Query: 2   VKL-----DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILK 52
           + +     D L+++  I + HG+ GEV + S+ +   +L  Y  ++    ++ R++ +++
Sbjct: 1   MDMTPASADGLIVLGKITSVHGVRGEVKVYSFTDPIDNLLDYRFWTLRRGDERRQIELVR 60

Query: 53  MYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQ 112
              + +  +A   GI++   A  L D ++           L+E EF+   LE +   DR+
Sbjct: 61  GRPQGRLLVARLKGIEDRDGARALADFEVCVPIAQLPR--LDEGEFYWHQLEGLRVVDRE 118

Query: 113 GKYWGQVCGVYNFGAGSILEIKNT----MEKTFLIPFTKFAVLEVNLQENKILID 163
           G+ +G+V  +   GA  +L ++       ++  L+P+T   VL V+L   +I +D
Sbjct: 119 GRLFGKVDHLLETGANDVLVVRPCTGSLDDRERLLPYTDQCVLRVDLAAGEIRVD 173


>gi|88194946|ref|YP_499746.1| 16S rRNA-processing protein RimM [Staphylococcus aureus subsp.
           aureus NCTC 8325]
 gi|122539706|sp|Q2FZ44|RIMM_STAA8 RecName: Full=Ribosome maturation factor rimM
 gi|87202504|gb|ABD30314.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           NCTC 8325]
          Length = 167

 Score =  138 bits (348), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 48/168 (28%), Positives = 84/168 (50%), Gaps = 8/168 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY-----VLYSNDNRELRILKMYRKNKRFIA 62
           V +  I  THG+ GE+ + S ++      +      V+++N++ E  +          + 
Sbjct: 3   VEVGQIVNTHGIKGEIKVKSNSDFTDVRFQPGQVLTVVHNNNDLEYTVKSHRVHKGLHML 62

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
           TF GI+NI+    L+   +Y +R   +D  LEE+EF+ +D+     FD Q    G+V  +
Sbjct: 63  TFEGINNINDIEHLKGSSIYQERDH-EDIVLEENEFYYSDIIGCAVFDDQKTPIGRVINI 121

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           +  GA  +  IK    K +LIP+    V EV+++  KI+I P+   L+
Sbjct: 122 FETGANDVWVIK--GSKEYLIPYIADVVKEVDVENKKIIITPMEGLLD 167


>gi|291524520|emb|CBK90107.1| 16S rRNA processing protein RimM [Eubacterium rectale DSM 17629]
          Length = 168

 Score =  138 bits (348), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 41/169 (24%), Positives = 77/169 (45%), Gaps = 6/169 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDN----RELRILKMYRKNKR 59
           ++ L+ +  I +THG+ GEV +    ++     +      DN    R+L I  +     +
Sbjct: 1   MEDLLQVGVITSTHGIRGEVKVFPTTDDAARFKKLKNVILDNGKERRDLEITSVKFFKNQ 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F GID+I+   + +   L+  R++     LEE+E+F  DL  +     +G+  G +
Sbjct: 61  VILKFKGIDDINDVEKYKKAPLFVTREN--AVPLEENEYFIADLIGLSVTSDEGEELGVI 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAG 168
             V   GA  +  +K       LIP  K  +L+V+++   + +  +A  
Sbjct: 119 DDVLQTGANDVYVVKKAGANDLLIPAIKDCILDVDVENGTMKVHLLAGL 167


>gi|300783879|ref|YP_003764170.1| 16S rRNA processing protein RimM [Amycolatopsis mediterranei U32]
 gi|299793393|gb|ADJ43768.1| 16S rRNA processing protein RimM [Amycolatopsis mediterranei U32]
          Length = 170

 Score =  138 bits (347), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 38/170 (22%), Positives = 70/170 (41%), Gaps = 8/170 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY------VLYSNDNRELRILKMYRKNKRFI 61
           V++  I   HG+ GE+ +D   ++P    +        L     REL I      + R +
Sbjct: 3   VVVGRIAKAHGIRGELAVDVRTDSPEQRFKIGAAVTTKLRDGSKRELTIAAAREHSGRLL 62

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
             F  +     A  LR   L A        E  ++ F++ +L  +      G   G+V  
Sbjct: 63  VRFEEVLTRDVAETLRGALLLADTATLPPTEDPDE-FYDHELAGLRAELTDGTVVGKVVE 121

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN 171
           + +  AG +LE+ +   +  L+PF    V  V++   ++++DP    L+ 
Sbjct: 122 IVHSPAGELLEL-DVEGREVLVPFVHAIVPTVDIAGGRVVLDPPEGLLDE 170


>gi|42519386|ref|NP_965316.1| 16S rRNA processing protein RimM [Lactobacillus johnsonii NCC 533]
 gi|227890251|ref|ZP_04008056.1| 16S rRNA processing protein [Lactobacillus johnsonii ATCC 33200]
 gi|59798804|sp|Q74IQ5|RIMM_LACJO RecName: Full=Ribosome maturation factor rimM
 gi|41583674|gb|AAS09282.1| 16S rRNA processing protein RimM [Lactobacillus johnsonii NCC 533]
 gi|227849065|gb|EEJ59151.1| 16S rRNA processing protein [Lactobacillus johnsonii ATCC 33200]
 gi|329667091|gb|AEB93039.1| 16S rRNA processing protein [Lactobacillus johnsonii DPC 6026]
          Length = 173

 Score =  138 bits (347), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 40/175 (22%), Positives = 76/175 (43%), Gaps = 8/175 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-----YVLYSNDNRELRILKMYRKNK 58
           + +   +  I + HGL GEV +++  + P +        ++  +    EL +    R  +
Sbjct: 1   MTEYFEVGKILSPHGLKGEVKVNATTDFPEERLATGSRLFIKNNKQYEELIVENTRRHKQ 60

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFD-RQGKYWG 117
            ++  F  ID+I  A ++   +LY    D   +EL E  ++  D+     +D   G+  G
Sbjct: 61  FYLVKFEKIDDIDQAEKICSKELYVAETD--QQELPEGSYYFKDILNCPVYDAETGEKLG 118

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNT 172
            +  +   GA  I EIK    K+F IP  +  V +V+L   +I +  +    +  
Sbjct: 119 VLENIETPGANDIWEIKPEKGKSFWIPNIESVVKKVDLANKRIEVTLLEGLRDEN 173


>gi|15924229|ref|NP_371763.1| 16S rRNA-processing protein RimM [Staphylococcus aureus subsp.
           aureus Mu50]
 gi|15926822|ref|NP_374355.1| 16S rRNA-processing protein RimM [Staphylococcus aureus subsp.
           aureus N315]
 gi|21282851|ref|NP_645939.1| 16S rRNA-processing protein RimM [Staphylococcus aureus subsp.
           aureus MW2]
 gi|49486078|ref|YP_043299.1| 16S rRNA-processing protein RimM [Staphylococcus aureus subsp.
           aureus MSSA476]
 gi|57651808|ref|YP_186114.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus COL]
 gi|87162204|ref|YP_493829.1| 16S rRNA-processing protein RimM [Staphylococcus aureus subsp.
           aureus USA300_FPR3757]
 gi|148267730|ref|YP_001246673.1| 16S rRNA-processing protein RimM [Staphylococcus aureus subsp.
           aureus JH9]
 gi|150393788|ref|YP_001316463.1| 16S rRNA-processing protein RimM [Staphylococcus aureus subsp.
           aureus JH1]
 gi|151221361|ref|YP_001332183.1| 16S rRNA-processing protein RimM [Staphylococcus aureus subsp.
           aureus str. Newman]
 gi|156979560|ref|YP_001441819.1| 16S rRNA-processing protein RimM [Staphylococcus aureus subsp.
           aureus Mu3]
 gi|221142029|ref|ZP_03566522.1| 16S rRNA-processing protein [Staphylococcus aureus subsp. aureus
           str. JKD6009]
 gi|253315597|ref|ZP_04838810.1| 16S rRNA-processing protein RimM [Staphylococcus aureus subsp.
           aureus str. CF-Marseille]
 gi|253731857|ref|ZP_04866022.1| 16S rRNA processing protein [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253733523|ref|ZP_04867688.1| 16S rRNA processing protein [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|255006026|ref|ZP_05144627.2| 16S rRNA-processing protein RimM [Staphylococcus aureus subsp.
           aureus Mu50-omega]
 gi|257425293|ref|ZP_05601718.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus 55/2053]
 gi|257427953|ref|ZP_05604351.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus 65-1322]
 gi|257430586|ref|ZP_05606968.1| ribosome maturation factor rimM [Staphylococcus aureus subsp.
           aureus 68-397]
 gi|257433347|ref|ZP_05609705.1| ribosome maturation factor rimM [Staphylococcus aureus subsp.
           aureus E1410]
 gi|257436189|ref|ZP_05612236.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus M876]
 gi|257795705|ref|ZP_05644684.1| 16S rRNA processing protein RimM [Staphylococcus aureus A9781]
 gi|258415929|ref|ZP_05682199.1| ribosome maturation factor rimM [Staphylococcus aureus A9763]
 gi|258421691|ref|ZP_05684615.1| 16S rRNA processing protein RimM [Staphylococcus aureus A9719]
 gi|258434847|ref|ZP_05688921.1| ribosome maturation factor rimM [Staphylococcus aureus A9299]
 gi|258444577|ref|ZP_05692906.1| ribosome maturation factor rimM [Staphylococcus aureus A8115]
 gi|258447590|ref|ZP_05695734.1| ribosome maturation factor rimM [Staphylococcus aureus A6300]
 gi|258449432|ref|ZP_05697535.1| ribosome maturation factor rimM [Staphylococcus aureus A6224]
 gi|258452537|ref|ZP_05700543.1| ribosome maturation factor rimM [Staphylococcus aureus A5948]
 gi|258454811|ref|ZP_05702775.1| 16S rRNA processing protein RimM [Staphylococcus aureus A5937]
 gi|262048137|ref|ZP_06021024.1| probable 16S rRNA processing protein [Staphylococcus aureus D30]
 gi|262051868|ref|ZP_06024084.1| probable 16S rRNA processing protein [Staphylococcus aureus
           930918-3]
 gi|269202855|ref|YP_003282124.1| 16S rRNA-processing protein RimM [Staphylococcus aureus subsp.
           aureus ED98]
 gi|282892726|ref|ZP_06300961.1| 16S rRNA processing protein RimM [Staphylococcus aureus A8117]
 gi|282903793|ref|ZP_06311681.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus C160]
 gi|282905557|ref|ZP_06313412.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus Btn1260]
 gi|282908532|ref|ZP_06316362.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus WW2703/97]
 gi|282910811|ref|ZP_06318614.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus WBG10049]
 gi|282914015|ref|ZP_06321802.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus M899]
 gi|282918937|ref|ZP_06326672.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus C427]
 gi|282920022|ref|ZP_06327751.1| 16S rRNA processing protein RimM [Staphylococcus aureus A9765]
 gi|282924060|ref|ZP_06331736.1| 16S rRNA processing protein [Staphylococcus aureus subsp. aureus
           C101]
 gi|282927580|ref|ZP_06335196.1| 16S rRNA processing protein RimM [Staphylococcus aureus A10102]
 gi|283957981|ref|ZP_06375432.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus A017934/97]
 gi|293501047|ref|ZP_06666898.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus 58-424]
 gi|293510008|ref|ZP_06668716.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus M809]
 gi|293526595|ref|ZP_06671280.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus M1015]
 gi|294848233|ref|ZP_06788980.1| 16S rRNA processing protein RimM [Staphylococcus aureus A9754]
 gi|295406174|ref|ZP_06815981.1| 16S rRNA processing protein RimM [Staphylococcus aureus A8819]
 gi|295427725|ref|ZP_06820357.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus EMRSA16]
 gi|296274796|ref|ZP_06857303.1| 16S rRNA-processing protein RimM [Staphylococcus aureus subsp.
           aureus MR1]
 gi|297208117|ref|ZP_06924548.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus ATCC 51811]
 gi|297244402|ref|ZP_06928285.1| 16S rRNA processing protein RimM [Staphylococcus aureus A8796]
 gi|297591316|ref|ZP_06949954.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus MN8]
 gi|300912197|ref|ZP_07129640.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus TCH70]
 gi|304381197|ref|ZP_07363850.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus ATCC BAA-39]
 gi|54039059|sp|P66656|RIMM_STAAN RecName: Full=Ribosome maturation factor rimM
 gi|54039060|sp|P66657|RIMM_STAAW RecName: Full=Ribosome maturation factor rimM
 gi|54041929|sp|P66655|RIMM_STAAM RecName: Full=Ribosome maturation factor rimM
 gi|56749523|sp|Q6G9X4|RIMM_STAAS RecName: Full=Ribosome maturation factor rimM
 gi|67461252|sp|Q5HGJ3|RIMM_STAAC RecName: Full=Ribosome maturation factor rimM
 gi|109893052|sp|Q2FHJ9|RIMM_STAA3 RecName: Full=Ribosome maturation factor rimM
 gi|166226477|sp|A7X1K9|RIMM_STAA1 RecName: Full=Ribosome maturation factor rimM
 gi|172048857|sp|A6QGD9|RIMM_STAAE RecName: Full=Ribosome maturation factor rimM
 gi|189040856|sp|A6U158|RIMM_STAA2 RecName: Full=Ribosome maturation factor rimM
 gi|189040857|sp|A5ISC4|RIMM_STAA9 RecName: Full=Ribosome maturation factor rimM
 gi|13701039|dbj|BAB42334.1| probable 16S rRNA processing protein [Staphylococcus aureus subsp.
           aureus N315]
 gi|14247009|dbj|BAB57401.1| probable 16S rRNA processing protein [Staphylococcus aureus subsp.
           aureus Mu50]
 gi|21204290|dbj|BAB94987.1| probable 16S rRNA processing protein [Staphylococcus aureus subsp.
           aureus MW2]
 gi|49244521|emb|CAG42950.1| 16S rRNA processing protein [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|57285994|gb|AAW38088.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus COL]
 gi|87128178|gb|ABD22692.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus USA300_FPR3757]
 gi|147740799|gb|ABQ49097.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus JH9]
 gi|149946240|gb|ABR52176.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus JH1]
 gi|150374161|dbj|BAF67421.1| 16S rRNA processing protein [Staphylococcus aureus subsp. aureus
           str. Newman]
 gi|156721695|dbj|BAF78112.1| probable 16S rRNA processing protein [Staphylococcus aureus subsp.
           aureus Mu3]
 gi|253724409|gb|EES93138.1| 16S rRNA processing protein [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253728577|gb|EES97306.1| 16S rRNA processing protein [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|257271750|gb|EEV03888.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus 55/2053]
 gi|257274794|gb|EEV06281.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus 65-1322]
 gi|257278714|gb|EEV09333.1| ribosome maturation factor rimM [Staphylococcus aureus subsp.
           aureus 68-397]
 gi|257281440|gb|EEV11577.1| ribosome maturation factor rimM [Staphylococcus aureus subsp.
           aureus E1410]
 gi|257284471|gb|EEV14591.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus M876]
 gi|257789677|gb|EEV28017.1| 16S rRNA processing protein RimM [Staphylococcus aureus A9781]
 gi|257839265|gb|EEV63739.1| ribosome maturation factor rimM [Staphylococcus aureus A9763]
 gi|257842377|gb|EEV66802.1| 16S rRNA processing protein RimM [Staphylococcus aureus A9719]
 gi|257849208|gb|EEV73190.1| ribosome maturation factor rimM [Staphylococcus aureus A9299]
 gi|257850070|gb|EEV74023.1| ribosome maturation factor rimM [Staphylococcus aureus A8115]
 gi|257853781|gb|EEV76740.1| ribosome maturation factor rimM [Staphylococcus aureus A6300]
 gi|257857420|gb|EEV80318.1| ribosome maturation factor rimM [Staphylococcus aureus A6224]
 gi|257859755|gb|EEV82597.1| ribosome maturation factor rimM [Staphylococcus aureus A5948]
 gi|257863194|gb|EEV85958.1| 16S rRNA processing protein RimM [Staphylococcus aureus A5937]
 gi|259160269|gb|EEW45297.1| probable 16S rRNA processing protein [Staphylococcus aureus
           930918-3]
 gi|259163703|gb|EEW48258.1| probable 16S rRNA processing protein [Staphylococcus aureus D30]
 gi|262075145|gb|ACY11118.1| 16S rRNA-processing protein RimM [Staphylococcus aureus subsp.
           aureus ED98]
 gi|269940731|emb|CBI49112.1| 16S rRNA processing protein [Staphylococcus aureus subsp. aureus
           TW20]
 gi|282314032|gb|EFB44424.1| 16S rRNA processing protein [Staphylococcus aureus subsp. aureus
           C101]
 gi|282316747|gb|EFB47121.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus C427]
 gi|282322083|gb|EFB52407.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus M899]
 gi|282325416|gb|EFB55725.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus WBG10049]
 gi|282327594|gb|EFB57877.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus WW2703/97]
 gi|282330849|gb|EFB60363.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus Btn1260]
 gi|282590583|gb|EFB95660.1| 16S rRNA processing protein RimM [Staphylococcus aureus A10102]
 gi|282594738|gb|EFB99722.1| 16S rRNA processing protein RimM [Staphylococcus aureus A9765]
 gi|282595411|gb|EFC00375.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus C160]
 gi|282764723|gb|EFC04848.1| 16S rRNA processing protein RimM [Staphylococcus aureus A8117]
 gi|283790130|gb|EFC28947.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus A017934/97]
 gi|285816921|gb|ADC37408.1| 16S rRNA processing protein RimM [Staphylococcus aureus 04-02981]
 gi|290920667|gb|EFD97730.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus M1015]
 gi|291096052|gb|EFE26313.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus 58-424]
 gi|291466952|gb|EFF09470.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus M809]
 gi|294825033|gb|EFG41455.1| 16S rRNA processing protein RimM [Staphylococcus aureus A9754]
 gi|294968762|gb|EFG44784.1| 16S rRNA processing protein RimM [Staphylococcus aureus A8819]
 gi|295128083|gb|EFG57717.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus EMRSA16]
 gi|296887360|gb|EFH26262.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus ATCC 51811]
 gi|297178432|gb|EFH37678.1| 16S rRNA processing protein RimM [Staphylococcus aureus A8796]
 gi|297576202|gb|EFH94918.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus MN8]
 gi|300886443|gb|EFK81645.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus TCH70]
 gi|302751062|gb|ADL65239.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus str. JKD6008]
 gi|304340180|gb|EFM06121.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus ATCC BAA-39]
 gi|312438383|gb|ADQ77454.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus TCH60]
 gi|312829633|emb|CBX34475.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus ECT-R 2]
 gi|315131032|gb|EFT87016.1| probable 16S rRNA processing protein [Staphylococcus aureus subsp.
           aureus CGS03]
 gi|315194127|gb|EFU24520.1| probable 16S rRNA processing protein [Staphylococcus aureus subsp.
           aureus CGS00]
 gi|315198478|gb|EFU28807.1| probable 16S rRNA processing protein [Staphylococcus aureus subsp.
           aureus CGS01]
 gi|320140945|gb|EFW32792.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus MRSA131]
 gi|320144340|gb|EFW36106.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus MRSA177]
 gi|329313908|gb|AEB88321.1| Ribosome maturation factor rimM [Staphylococcus aureus subsp.
           aureus T0131]
 gi|329724775|gb|EGG61280.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus 21189]
 gi|329727338|gb|EGG63794.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus 21172]
          Length = 167

 Score =  138 bits (347), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 48/168 (28%), Positives = 84/168 (50%), Gaps = 8/168 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY-----VLYSNDNRELRILKMYRKNKRFIA 62
           V +  I  THG+ GE+ + S ++      +      V+++N++ E  +          + 
Sbjct: 3   VEVGQIVNTHGIKGEIKVKSNSDFTDVRFQPGQVLTVVHNNNDLEYTVKSHRVHKGLHML 62

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
           TF GI+NI+    L+   +Y +R   +D  LEE+EF+ +D+     FD Q    G+V  +
Sbjct: 63  TFEGINNINDIEHLKGSSIYQERDH-EDIVLEENEFYYSDIIGCTVFDDQETPIGRVINI 121

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           +  GA  +  IK    K +LIP+    V EV+++  KI+I P+   L+
Sbjct: 122 FETGANDVWVIK--GSKEYLIPYIADVVKEVDVENKKIIITPMEGLLD 167


>gi|229545511|ref|ZP_04434236.1| 16S rRNA processing protein RimM [Enterococcus faecalis TX1322]
 gi|255975553|ref|ZP_05426139.1| 16S rRNA processing protein RimM [Enterococcus faecalis T2]
 gi|256619383|ref|ZP_05476229.1| 16S rRNA processing protein RimM [Enterococcus faecalis ATCC 4200]
 gi|256853423|ref|ZP_05558793.1| ribosome maturation factor rimM [Enterococcus faecalis T8]
 gi|256959221|ref|ZP_05563392.1| 16S rRNA processing protein RimM [Enterococcus faecalis DS5]
 gi|257079289|ref|ZP_05573650.1| ribosome maturation factor rimM [Enterococcus faecalis JH1]
 gi|257084889|ref|ZP_05579250.1| 16S rRNA processing protein RimM [Enterococcus faecalis Fly1]
 gi|257090191|ref|ZP_05584552.1| 16S rRNA processing protein rimM [Enterococcus faecalis CH188]
 gi|257416344|ref|ZP_05593338.1| 16S rRNA processing protein RimM [Enterococcus faecalis AR01/DG]
 gi|294779809|ref|ZP_06745196.1| 16S rRNA processing protein RimM [Enterococcus faecalis PC1.1]
 gi|300861299|ref|ZP_07107386.1| 16S rRNA processing protein RimM [Enterococcus faecalis TUSoD Ef11]
 gi|307268249|ref|ZP_07549633.1| 16S rRNA processing protein RimM [Enterococcus faecalis TX4248]
 gi|307275653|ref|ZP_07556794.1| 16S rRNA processing protein RimM [Enterococcus faecalis TX2134]
 gi|307280517|ref|ZP_07561566.1| 16S rRNA processing protein RimM [Enterococcus faecalis TX0860]
 gi|307295976|ref|ZP_07575808.1| 16S rRNA processing protein RimM [Enterococcus faecalis TX0411]
 gi|312900945|ref|ZP_07760239.1| 16S rRNA processing protein RimM [Enterococcus faecalis TX0470]
 gi|312902686|ref|ZP_07761890.1| 16S rRNA processing protein RimM [Enterococcus faecalis TX0635]
 gi|229309427|gb|EEN75414.1| 16S rRNA processing protein RimM [Enterococcus faecalis TX1322]
 gi|255968425|gb|EET99047.1| 16S rRNA processing protein RimM [Enterococcus faecalis T2]
 gi|256598910|gb|EEU18086.1| 16S rRNA processing protein RimM [Enterococcus faecalis ATCC 4200]
 gi|256711882|gb|EEU26920.1| ribosome maturation factor rimM [Enterococcus faecalis T8]
 gi|256949717|gb|EEU66349.1| 16S rRNA processing protein RimM [Enterococcus faecalis DS5]
 gi|256987319|gb|EEU74621.1| ribosome maturation factor rimM [Enterococcus faecalis JH1]
 gi|256992919|gb|EEU80221.1| 16S rRNA processing protein RimM [Enterococcus faecalis Fly1]
 gi|256999003|gb|EEU85523.1| 16S rRNA processing protein rimM [Enterococcus faecalis CH188]
 gi|257158172|gb|EEU88132.1| 16S rRNA processing protein RimM [Enterococcus faecalis ARO1/DG]
 gi|294453183|gb|EFG21598.1| 16S rRNA processing protein RimM [Enterococcus faecalis PC1.1]
 gi|300850338|gb|EFK78088.1| 16S rRNA processing protein RimM [Enterococcus faecalis TUSoD Ef11]
 gi|306496307|gb|EFM65886.1| 16S rRNA processing protein RimM [Enterococcus faecalis TX0411]
 gi|306504065|gb|EFM73281.1| 16S rRNA processing protein RimM [Enterococcus faecalis TX0860]
 gi|306507758|gb|EFM76887.1| 16S rRNA processing protein RimM [Enterococcus faecalis TX2134]
 gi|306515409|gb|EFM83940.1| 16S rRNA processing protein RimM [Enterococcus faecalis TX4248]
 gi|310633740|gb|EFQ17023.1| 16S rRNA processing protein RimM [Enterococcus faecalis TX0635]
 gi|311292044|gb|EFQ70600.1| 16S rRNA processing protein RimM [Enterococcus faecalis TX0470]
 gi|315028951|gb|EFT40883.1| 16S rRNA processing protein RimM [Enterococcus faecalis TX4000]
 gi|315033330|gb|EFT45262.1| 16S rRNA processing protein RimM [Enterococcus faecalis TX0017]
 gi|315036710|gb|EFT48642.1| 16S rRNA processing protein RimM [Enterococcus faecalis TX0027]
 gi|315143553|gb|EFT87569.1| 16S rRNA processing protein RimM [Enterococcus faecalis TX2141]
 gi|315149306|gb|EFT93322.1| 16S rRNA processing protein RimM [Enterococcus faecalis TX0012]
 gi|315161511|gb|EFU05528.1| 16S rRNA processing protein RimM [Enterococcus faecalis TX0645]
 gi|315576950|gb|EFU89141.1| 16S rRNA processing protein RimM [Enterococcus faecalis TX0630]
 gi|323481045|gb|ADX80484.1| 16S rRNA processing protein RimM [Enterococcus faecalis 62]
 gi|329572862|gb|EGG54487.1| 16S rRNA processing protein RimM [Enterococcus faecalis TX1467]
          Length = 174

 Score =  138 bits (347), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 35/176 (19%), Positives = 74/176 (42%), Gaps = 8/176 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR------YVLYSNDNRELRILKMYRKN 57
           +   + +  I  T G+ GEV + S  + P +  +               EL +    +  
Sbjct: 1   MTDYLNVGKIVNTQGIKGEVRVISKTDFPEERYQKGATLLLFQEKKAPIELVVKSHRKHK 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              I +F G  NI+   + RD  L   + +  +  L EDEF+   +     +D  G   G
Sbjct: 61  NFDILSFEGHPNINDVEKYRDGILKVAKDNLAE--LAEDEFYYHQIIGATVYDETGSELG 118

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTT 173
           ++  + + GA  +  ++   +K  L+P+ +  V +V+++  +I +D     +++  
Sbjct: 119 KIKEILSPGANDVWVVQRPKKKDLLLPYIEGVVTKVDVENQRIDVDIPEGLIDDEN 174


>gi|268319237|ref|YP_003292893.1| 16S rRNA-processing protein rimM [Lactobacillus johnsonii FI9785]
 gi|262397612|emb|CAX66626.1| 16S rRNA-processing protein rimM [Lactobacillus johnsonii FI9785]
          Length = 173

 Score =  138 bits (347), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 40/175 (22%), Positives = 77/175 (44%), Gaps = 8/175 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-----YVLYSNDNRELRILKMYRKNK 58
           + +   +  I + HGL GEV +++  + P +        ++  +    EL +    R  +
Sbjct: 1   MTEYFEVGKILSPHGLKGEVKVNATTDFPEERLATGSRLFIKNNKQYEELIVENTRRHKQ 60

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFD-RQGKYWG 117
            ++  F  ID+I  A ++   +LY    D   +EL E  ++  D+     +D   G+  G
Sbjct: 61  FYLVKFEKIDDIDQAEKICSKELYVAETD--QQELPEGSYYFKDILNCPVYDAETGEKLG 118

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNT 172
            +  +   GA  I EIK+   K+F IP  +  V +V+L   +I +  +    +  
Sbjct: 119 VLENIETPGANDIWEIKSEKGKSFWIPNIESVVKKVDLANKRIEVTLLEGLRDEN 173


>gi|154251873|ref|YP_001412697.1| 16S rRNA-processing protein RimM [Parvibaculum lavamentivorans
           DS-1]
 gi|171769584|sp|A7HT07|RIMM_PARL1 RecName: Full=Ribosome maturation factor rimM
 gi|154155823|gb|ABS63040.1| 16S rRNA processing protein RimM [Parvibaculum lavamentivorans
           DS-1]
          Length = 188

 Score =  138 bits (347), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 46/179 (25%), Positives = 77/179 (43%), Gaps = 3/179 (1%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY-SNDNRELRILKMY-RKNKRFI 61
            DK V +  +   HG+ G V +  Y   P  +  Y    + D      + +        I
Sbjct: 10  QDKKVCLGVVTGAHGVRGLVRVKPYTEMPEGVAAYGPVETKDGATSFAISLKGMAKDLVI 69

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               G+D+   A+ LR  +LY  R+       +E+ ++  DL  +      G+ +G++ G
Sbjct: 70  CKLEGVDDRDVAAALRGTELYVPRERLPRASGDEEGWYYADLIGLRAVGLDGRDYGRIAG 129

Query: 122 VYNFGAGSILEIKN-TMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQY 179
           V NFGAG +LEI      +T L+ FT   V EV++   +++IDP A    +        
Sbjct: 130 VENFGAGDLLEIAPAEGGQTVLMGFTDENVPEVDIAGGRVVIDPPAGTFGDDAEAERGE 188


>gi|315174247|gb|EFU18264.1| 16S rRNA processing protein RimM [Enterococcus faecalis TX1346]
          Length = 174

 Score =  138 bits (347), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 35/176 (19%), Positives = 74/176 (42%), Gaps = 8/176 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR------YVLYSNDNRELRILKMYRKN 57
           +   + +  I  T G+ GEV + S  + P +  +               EL +    +  
Sbjct: 1   MTDYLNVGKIVNTQGIKGEVRVISKTDFPEERYQKGATLLLFQEKKAPIELVVKSHRKHK 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              I +F G  NI+   + RD  L   + +  +  L EDEF+   +     +D  G   G
Sbjct: 61  NFDILSFEGHPNINDVEKYRDGILKVAKDNLAE--LGEDEFYYHQIIGATVYDETGSELG 118

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTT 173
           ++  + + GA  +  ++   +K  L+P+ +  V +V+++  +I +D     +++  
Sbjct: 119 KIKEILSPGANDVWVVQRPKKKDLLLPYIEGVVTKVDVENQRIDVDIPEGLIDDEN 174


>gi|109897899|ref|YP_661154.1| 16S rRNA processing protein RimM [Pseudoalteromonas atlantica T6c]
 gi|123360985|sp|Q15VI8|RIMM_PSEA6 RecName: Full=Ribosome maturation factor rimM
 gi|109700180|gb|ABG40100.1| 16S rRNA processing protein RimM [Pseudoalteromonas atlantica T6c]
          Length = 176

 Score =  138 bits (347), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 40/173 (23%), Positives = 76/173 (43%), Gaps = 12/173 (6%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRK 56
           M      ++M  IG  +G+ G V I SY +    +  Y  +      + +E+ + +    
Sbjct: 1   MSHASDTLVMGKIGAPYGVKGWVKITSYTDELDGIFSYTPWLVGQEGNTKEIVVDQWRTH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           NK  +A   G++    A  +++L +  K Q     +L+ DEF+  +L  M+    QG   
Sbjct: 61  NKGLVAKLVGVETRDDAESIKNLDISIKAQQLP--QLDGDEFYWRELVGMQVVTEQGYNL 118

Query: 117 GQVCGVYNFGAGSILEIKNT-----MEKTFLIPF-TKFAVLEVNLQENKILID 163
           G V  ++  GA  ++ IK        +K  ++P+     V +V+ +   I +D
Sbjct: 119 GVVKELFETGANDVMLIKANLKDAFGQKERMVPYLIDQVVKKVDREAKTIQVD 171


>gi|160938808|ref|ZP_02086159.1| hypothetical protein CLOBOL_03702 [Clostridium bolteae ATCC
           BAA-613]
 gi|158437771|gb|EDP15531.1| hypothetical protein CLOBOL_03702 [Clostridium bolteae ATCC
           BAA-613]
          Length = 170

 Score =  138 bits (347), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 35/171 (20%), Positives = 68/171 (39%), Gaps = 6/171 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNR----ELRILKMYRKNKR 59
           ++ ++ +  I + HG+ GEV +    ++            D       + I  +      
Sbjct: 1   MENMLRVGVITSAHGIKGEVKVFPTTDDAKRFKELKEVILDTGKEHIPMEIEHVKFFKNM 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F G DNI+   + +   L   R      +LE DE+F TDL  +     QG   G +
Sbjct: 61  VILKFRGYDNINEIEKYKSRDLLITRDQ--AVDLEPDEYFITDLIGLTVVSDQGAELGTL 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
             V   GA  +  +     K  ++P     +L V+L++ ++ +  +   ++
Sbjct: 119 KDVLETGANDVYVVAMKDGKELMLPAIGDCILNVDLEQGRMEVHVLEGLMD 169


>gi|199597123|ref|ZP_03210555.1| RimM protein, required for 16S rRNA processing [Lactobacillus
           rhamnosus HN001]
 gi|229552443|ref|ZP_04441168.1| 16S rRNA processing protein RimM [Lactobacillus rhamnosus LMS2-1]
 gi|199591927|gb|EDZ00002.1| RimM protein, required for 16S rRNA processing [Lactobacillus
           rhamnosus HN001]
 gi|229314180|gb|EEN80153.1| 16S rRNA processing protein RimM [Lactobacillus rhamnosus LMS2-1]
 gi|259649942|dbj|BAI42104.1| 16S rRNA processing protein [Lactobacillus rhamnosus GG]
          Length = 198

 Score =  138 bits (347), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 34/175 (19%), Positives = 68/175 (38%), Gaps = 6/175 (3%)

Query: 3   KLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNRELRILKMYRKNK 58
           K+     + TI  THG+ GEV +    + P    +      + +     L I  + +   
Sbjct: 26  KMPDYYDIGTIVNTHGIRGEVRVLVTTDFPEQRFKVGNKVYVATTPKTALTINSVRQHKG 85

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
             + TF    +I+     +  KL       K   LEE  ++  D+  +   D  G+  G+
Sbjct: 86  LTMLTFKDYTDINQVLPFKGKKLQVTEAALKP--LEEGSYYYKDIIGLTVIDEHGQTLGK 143

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTT 173
           V  + + G   +  I    +   L+PF K  V  ++L++ +  +      +++  
Sbjct: 144 VSEILSPGPNDVWVIPRPGKSELLLPFLKSVVQTIDLEQKEAHVIVPEGLIDDAD 198


>gi|86742273|ref|YP_482673.1| 16S rRNA-processing protein RimM [Frankia sp. CcI3]
 gi|109893016|sp|Q2J6Z8|RIMM_FRASC RecName: Full=Ribosome maturation factor rimM
 gi|86569135|gb|ABD12944.1| 16S rRNA processing protein RimM [Frankia sp. CcI3]
          Length = 179

 Score =  138 bits (347), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 37/179 (20%), Positives = 69/179 (38%), Gaps = 10/179 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLN---RYVLYSNDNRELRILKMYRKNKRF 60
           + + +++  IG  HG+ GEV I+   + P         +        L +   +  + R 
Sbjct: 1   MAEEIVVGRIGRPHGIRGEVTIEIRTDVPHRRFVVGAVLGREGGGTALTVSGAHWHSGRL 60

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEED-------EFFNTDLEEMETFDRQG 113
           +  F G+D+  +A  LR + L            + D        +++ DL  +      G
Sbjct: 61  LLHFRGVDDRGAAEALRGVLLTIDADQAGSPLDDADGDGEAVEMWWDRDLVGLRAVTTAG 120

Query: 114 KYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNT 172
              G V  + +  AG +L I        L+PF +  V  V+    +I++DP    L+  
Sbjct: 121 MLLGHVTDIIHSPAGDLLAIGGPDGGEHLVPFVRDIVPTVDPPAGRIVVDPPPGLLDLD 179


>gi|224824769|ref|ZP_03697876.1| 16S rRNA processing protein RimM [Lutiella nitroferrum 2002]
 gi|224603262|gb|EEG09438.1| 16S rRNA processing protein RimM [Lutiella nitroferrum 2002]
          Length = 168

 Score =  138 bits (347), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 40/166 (24%), Positives = 79/166 (47%), Gaps = 7/166 (4%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRKN 57
           ++ D LVLM  +    G+ G V I +   +   L  Y ++           R      + 
Sbjct: 1   MRNDDLVLMGYVRGAFGVRGWVKIHADTGSADSLFDYPVWWLGRDGQWSSYRFEDGLVQP 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
           K   A   G+ +  +A  +R +++   R +F +   +E  ++ +DL  ++  ++ G+ +G
Sbjct: 61  KALAAKLEGVGSREAAEAMRGMQIAIPRSEFPETADDE--YYWSDLIGLDVVNKDGQRFG 118

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
           QV  +   GA  +L ++   ++ +LIPF    VL+VNL + +I +D
Sbjct: 119 QVAELMETGANDVLVVR-EGKREWLIPFVGQFVLDVNLTDKRITVD 163


>gi|84498357|ref|ZP_00997154.1| 16S rRNA-processing protein [Janibacter sp. HTCC2649]
 gi|84381857|gb|EAP97740.1| 16S rRNA-processing protein [Janibacter sp. HTCC2649]
          Length = 183

 Score =  138 bits (347), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 41/183 (22%), Positives = 80/183 (43%), Gaps = 9/183 (4%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLN--------RYVLYSNDNRELRILK 52
           M +    +L+A IG  HGL GEV + ++ ++P                 +   R L +  
Sbjct: 1   MPRSSNALLVARIGKPHGLRGEVTVQTHTDDPEARYVPGTVFDTEAQPGTGVPRTLTVST 60

Query: 53  MYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDE-FFNTDLEEMETFDR 111
                + ++  F+ I +   A  LR  +L+    +  + E +ED+ F+  DL  +   D 
Sbjct: 61  ARLHRQIWLLGFAEIPDRTGAESLRGTQLFLDPDEADEVESDEDDGFYEHDLVGLAVQDP 120

Query: 112 QGKYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN 171
            G   G+V G+       +LE++ T  +  L+PF +  V E++++   +++D  A   + 
Sbjct: 121 SGAVLGEVTGLVLGAVQDLLEVRLTNRRDVLVPFVEAIVTEIDIEAGHVVVDAPAGLFDL 180

Query: 172 TTM 174
              
Sbjct: 181 DEA 183


>gi|295836290|ref|ZP_06823223.1| 16S rRNA processing protein RimM [Streptomyces sp. SPB74]
 gi|197697345|gb|EDY44278.1| 16S rRNA processing protein RimM [Streptomyces sp. SPB74]
          Length = 235

 Score =  138 bits (347), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 34/176 (19%), Positives = 76/176 (43%), Gaps = 5/176 (2%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNR----YVLYSNDNRELRILKMYRKNKRFIAT 63
           +++A IG  HG+ GEV ++   + P                   L I +    + R +  
Sbjct: 3   LVVARIGRAHGIKGEVTVEVRTDEPELRLPPGAVLATDPPGAGPLTIEQGRVHSGRLLLR 62

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F+G+ +   A  LR++ L A+    ++   + +EF++  L +++     G+  G++  + 
Sbjct: 63  FAGVKDRTGAEALRNILLIAEIDP-EEVPEDPEEFYDYQLMDLDVITEDGQEIGRITEIS 121

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQY 179
           +  +  +  ++       +IPF +  V E++L E + +I+P    L+         
Sbjct: 122 HLPSQDLFIVERPDGSEVMIPFVEEIVTEIDLHEQRAVINPPRGLLDPDEADVASE 177


>gi|257082272|ref|ZP_05576633.1| 16S rRNA-processing protein [Enterococcus faecalis E1Sol]
 gi|256990302|gb|EEU77604.1| 16S rRNA-processing protein [Enterococcus faecalis E1Sol]
          Length = 174

 Score =  137 bits (346), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 35/176 (19%), Positives = 75/176 (42%), Gaps = 8/176 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR------YVLYSNDNRELRILKMYRKN 57
           +   + +  I  T G+ GEV + S  + P +  +               EL +    +  
Sbjct: 1   MTDYLNVGKIVNTQGIKGEVRVISKTDFPEERYQKGATLLLFQEKKAPIELVVKSHRKHK 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              I +F G  NI+   + RD  L   + +  +  L EDEF+   +     +D  G   G
Sbjct: 61  NFDILSFEGHPNINDVEKYRDGILKVAKDNLAE--LAEDEFYYHQIIGATVYDETGSELG 118

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTT 173
           ++  + + GA  +  ++ + +K  L+P+ +  V +V+++  +I +D     +++  
Sbjct: 119 KIKEILSPGANDVWVVQRSKKKDLLLPYIEGVVTKVDVENQRIDVDIPEGLIDDEN 174


>gi|89053239|ref|YP_508690.1| 16S rRNA-processing protein RimM [Jannaschia sp. CCS1]
 gi|109893020|sp|Q28UE7|RIMM_JANSC RecName: Full=Ribosome maturation factor rimM
 gi|88862788|gb|ABD53665.1| 16S rRNA processing protein RimM [Jannaschia sp. CCS1]
          Length = 187

 Score =  137 bits (346), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 49/181 (27%), Positives = 74/181 (40%), Gaps = 6/181 (3%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDN--RELRILKMYRKNK 58
           M   D    +  I  + G+ GEV + S+   P D+  Y   S ++  +   I        
Sbjct: 1   MTNPDH-TCVGAISGSFGVRGEVRLKSFCAEPSDIGSYGPLSTEDGAQTYTITLTRPVKA 59

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
            + A  SG+     A  LR  +LYA R       L +DEF++ DL  +   D  G+  G 
Sbjct: 60  GYAAMLSGVATKEDADALRGTRLYAPRSALPS--LPDDEFYHADLVGLTVLDTGGEVIGT 117

Query: 119 VCGVYNFGAGSILEIKNTM-EKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNP 177
           V  V N GAG ILE+         LIPFT   V  V++   ++++D     +        
Sbjct: 118 VASVANHGAGDILELSGPGLPSGLLIPFTLAVVPTVDIAAGRVIVDMPDGLIGGDKPDTS 177

Query: 178 Q 178
            
Sbjct: 178 D 178


>gi|302542207|ref|ZP_07294549.1| 16S rRNA processing protein RimM [Streptomyces hygroscopicus ATCC
           53653]
 gi|302459825|gb|EFL22918.1| 16S rRNA processing protein RimM [Streptomyces himastatinicus ATCC
           53653]
          Length = 191

 Score =  137 bits (346), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 37/172 (21%), Positives = 78/172 (45%), Gaps = 5/172 (2%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPI-DLNRYVLYSNDN---RELRILKMYRKNKRFIAT 63
           +++A IG  HG+ GEV ++   + P   L    + + +      L I      + R +  
Sbjct: 11  LVVARIGRAHGIKGEVTVEVRTDEPELRLGPGAVLATEPASAGPLTIETGRVHSGRLLLR 70

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F G+ +   A  LR++ L A+    ++   + +EF++  L +++     G   G++  + 
Sbjct: 71  FEGVRDRTGAEALRNVLLIAEVD-PEEVPEDPEEFYDHQLIDLDVVTVDGTAVGRISEIS 129

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMK 175
           +     +L +K       +IPF    V E++L+E + ++DP    L+    +
Sbjct: 130 HLPYQDLLIVKRPDGGEVMIPFVSEMVPEIDLEEQRAVVDPPPGLLDEAEAE 181


>gi|28899306|ref|NP_798911.1| 16S rRNA-processing protein RimM [Vibrio parahaemolyticus RIMD
           2210633]
 gi|153838717|ref|ZP_01991384.1| 16S rRNA processing protein RimM [Vibrio parahaemolyticus AQ3810]
 gi|260363660|ref|ZP_05776456.1| 16S rRNA processing protein RimM [Vibrio parahaemolyticus K5030]
 gi|260879002|ref|ZP_05891357.1| 16S rRNA processing protein RimM [Vibrio parahaemolyticus AN-5034]
 gi|260897212|ref|ZP_05905708.1| 16S rRNA processing protein RimM [Vibrio parahaemolyticus Peru-466]
 gi|31076894|sp|Q87LS9|RIMM_VIBPA RecName: Full=Ribosome maturation factor rimM
 gi|28807530|dbj|BAC60795.1| 16S rRNA processing protein RimM [Vibrio parahaemolyticus RIMD
           2210633]
 gi|149747877|gb|EDM58755.1| 16S rRNA processing protein RimM [Vibrio parahaemolyticus AQ3810]
 gi|308088448|gb|EFO38143.1| 16S rRNA processing protein RimM [Vibrio parahaemolyticus Peru-466]
 gi|308089631|gb|EFO39326.1| 16S rRNA processing protein RimM [Vibrio parahaemolyticus AN-5034]
 gi|308111019|gb|EFO48559.1| 16S rRNA processing protein RimM [Vibrio parahaemolyticus K5030]
 gi|328474161|gb|EGF44966.1| 16S rRNA-processing protein RimM [Vibrio parahaemolyticus 10329]
          Length = 182

 Score =  137 bits (346), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 37/173 (21%), Positives = 74/173 (42%), Gaps = 12/173 (6%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRF 60
           ++ +++   G T+G+ G + + SY +N   +  Y  +         E ++    R NK  
Sbjct: 11  NEKIVVGKFGATYGIRGWLKVFSYTDNAESIFDYSPWYINQKGKWVEYKVESWKRHNKGM 70

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +A   G+D    A  + + ++        +  L EDEF+  +L  M     +G   G V 
Sbjct: 71  VAKLEGMDVREDAHLMTNFEIAIDPAVLPE--LSEDEFYWRELFGMHVVTTKGYDLGVVT 128

Query: 121 GVYNFGAGSILEIKNT-----MEKTFLIPFTKF-AVLEVNLQENKILIDPIAA 167
            +   G+  +L +K        +K  LIPF +   +++V+ +  +I +D    
Sbjct: 129 DMLETGSNDVLVVKANLKDAFGQKERLIPFLEEQVIIKVDREAQRIEVDWDPG 181


>gi|256762839|ref|ZP_05503419.1| 16S rRNA processing protein RimM [Enterococcus faecalis T3]
 gi|256964818|ref|ZP_05568989.1| 16S rRNA processing protein RimM [Enterococcus faecalis HIP11704]
 gi|257422301|ref|ZP_05599291.1| 16S rRNA processing protein rimM [Enterococcus faecalis X98]
 gi|307272900|ref|ZP_07554147.1| 16S rRNA processing protein RimM [Enterococcus faecalis TX0855]
 gi|307287946|ref|ZP_07567979.1| 16S rRNA processing protein RimM [Enterococcus faecalis TX0109]
 gi|256684090|gb|EEU23785.1| 16S rRNA processing protein RimM [Enterococcus faecalis T3]
 gi|256955314|gb|EEU71946.1| 16S rRNA processing protein RimM [Enterococcus faecalis HIP11704]
 gi|257164125|gb|EEU94085.1| 16S rRNA processing protein rimM [Enterococcus faecalis X98]
 gi|306501091|gb|EFM70398.1| 16S rRNA processing protein RimM [Enterococcus faecalis TX0109]
 gi|306510514|gb|EFM79537.1| 16S rRNA processing protein RimM [Enterococcus faecalis TX0855]
 gi|315157026|gb|EFU01043.1| 16S rRNA processing protein RimM [Enterococcus faecalis TX0043]
 gi|315163844|gb|EFU07861.1| 16S rRNA processing protein RimM [Enterococcus faecalis TX1302]
 gi|315167369|gb|EFU11386.1| 16S rRNA processing protein RimM [Enterococcus faecalis TX1341]
 gi|327535419|gb|AEA94253.1| 16S rRNA processing protein RimM [Enterococcus faecalis OG1RF]
          Length = 174

 Score =  137 bits (346), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 35/176 (19%), Positives = 75/176 (42%), Gaps = 8/176 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR------YVLYSNDNRELRILKMYRKN 57
           +   + +  I  T G+ GEV + S  + P +  +               EL +    +  
Sbjct: 1   MTDYLNVGKIVNTQGIKGEVRVISKTDFPEERYQKGATLLLFQEKKAPIELVVKSHRKHK 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              I +F G  NI+   + RD  L  ++ +  +  L EDEF+   +     +D  G   G
Sbjct: 61  NFDILSFEGHPNINDVEKYRDGILKVEKDNLAE--LAEDEFYYHQIIGATVYDETGSELG 118

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTT 173
           ++  + + GA  +  ++   +K  L+P+ +  V +V+++  +I +D     +++  
Sbjct: 119 KIKEILSPGANDVWVVQRPKKKDLLLPYIEGVVTKVDVENQRIDVDIPEGLIDDEN 174


>gi|29376428|ref|NP_815582.1| 16S rRNA processing protein RimM [Enterococcus faecalis V583]
 gi|227519247|ref|ZP_03949296.1| 16S rRNA processing protein RimM [Enterococcus faecalis TX0104]
 gi|227555546|ref|ZP_03985593.1| 16S rRNA processing protein RimM [Enterococcus faecalis HH22]
 gi|256961602|ref|ZP_05565773.1| 16S rRNA-processing protein [Enterococcus faecalis Merz96]
 gi|257419593|ref|ZP_05596587.1| 16S rRNA-processing protein [Enterococcus faecalis T11]
 gi|293384455|ref|ZP_06630335.1| 16S rRNA processing protein RimM [Enterococcus faecalis R712]
 gi|293389164|ref|ZP_06633629.1| 16S rRNA processing protein RimM [Enterococcus faecalis S613]
 gi|312908378|ref|ZP_07767341.1| 16S rRNA processing protein RimM [Enterococcus faecalis DAPTO 512]
 gi|312910550|ref|ZP_07769392.1| 16S rRNA processing protein RimM [Enterococcus faecalis DAPTO 516]
 gi|48474386|sp|Q833P4|RIMM_ENTFA RecName: Full=Ribosome maturation factor rimM
 gi|29343892|gb|AAO81652.1| 16S rRNA processing protein RimM [Enterococcus faecalis V583]
 gi|227073303|gb|EEI11266.1| 16S rRNA processing protein RimM [Enterococcus faecalis TX0104]
 gi|227175322|gb|EEI56294.1| 16S rRNA processing protein RimM [Enterococcus faecalis HH22]
 gi|256952098|gb|EEU68730.1| 16S rRNA-processing protein [Enterococcus faecalis Merz96]
 gi|257161421|gb|EEU91381.1| 16S rRNA-processing protein [Enterococcus faecalis T11]
 gi|291078238|gb|EFE15602.1| 16S rRNA processing protein RimM [Enterococcus faecalis R712]
 gi|291081503|gb|EFE18466.1| 16S rRNA processing protein RimM [Enterococcus faecalis S613]
 gi|310625598|gb|EFQ08881.1| 16S rRNA processing protein RimM [Enterococcus faecalis DAPTO 512]
 gi|311289098|gb|EFQ67654.1| 16S rRNA processing protein RimM [Enterococcus faecalis DAPTO 516]
 gi|315169547|gb|EFU13564.1| 16S rRNA processing protein RimM [Enterococcus faecalis TX1342]
 gi|315574505|gb|EFU86696.1| 16S rRNA processing protein RimM [Enterococcus faecalis TX0309B]
 gi|315581833|gb|EFU94024.1| 16S rRNA processing protein RimM [Enterococcus faecalis TX0309A]
          Length = 174

 Score =  137 bits (346), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 35/176 (19%), Positives = 74/176 (42%), Gaps = 8/176 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR------YVLYSNDNRELRILKMYRKN 57
           +   + +  I  T G+ GEV + S  + P +  +               EL +    +  
Sbjct: 1   MTDYLNVGKIVNTQGIKGEVRVISKTDFPEERYQKGAMLLLFQEKKAPIELVVKSHRKHK 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              I +F G  NI+   + RD  L   + +  +  L EDEF+   +     +D  G   G
Sbjct: 61  NFDILSFEGHPNINDVEKYRDGILKVAKDNLAE--LAEDEFYYHQIIGATVYDETGSELG 118

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTT 173
           ++  + + GA  +  ++   +K  L+P+ +  V +V+++  +I +D     +++  
Sbjct: 119 KIKEILSPGANDVWVVQRPKKKDLLLPYIEGVVTKVDVENQRIDVDIPEGLIDDEN 174


>gi|303241506|ref|ZP_07328007.1| 16S rRNA processing protein RimM [Acetivibrio cellulolyticus CD2]
 gi|302590924|gb|EFL60671.1| 16S rRNA processing protein RimM [Acetivibrio cellulolyticus CD2]
          Length = 174

 Score =  137 bits (346), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 35/175 (20%), Positives = 78/175 (44%), Gaps = 8/175 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYV------LYSNDNRELRILKMYRKN 57
           + +   +  +  THG+ GE+ +    ++P   N+          S + ++     +    
Sbjct: 1   MLQYFEIGKVVNTHGVKGEIKVVPLTDDPNRFNKLKSAFIASEISENMQKYNFEGIKFHK 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              +    GID+ + A +L+D  +   R+D    +L E  FF  DL   E +D +    G
Sbjct: 61  NFVLLKLKGIDDPNEAEKLKDKFIIIDRED--AVKLPEGSFFVCDLINCEVYDEKENKLG 118

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNT 172
            +  +   G+  +  +++  +K  L+P  K  V EV++++ KI+++     +++ 
Sbjct: 119 VLIDILQTGSNDVYVVRDENKKEILVPALKSVVKEVSIEDKKIIVELPQGLIDDE 173


>gi|269961268|ref|ZP_06175635.1| 16S rRNA-processing protein [Vibrio harveyi 1DA3]
 gi|269834029|gb|EEZ88121.1| 16S rRNA-processing protein [Vibrio harveyi 1DA3]
          Length = 182

 Score =  137 bits (346), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 37/173 (21%), Positives = 76/173 (43%), Gaps = 12/173 (6%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND----NRELRILKMYRKNKRF 60
           ++ +++   G T+G+ G + + SY +N   +  Y  +  +      E ++    R NK  
Sbjct: 11  NEKIVVGKFGATYGIRGWLKVFSYTDNAESIFDYSPWFINQKGTWVEYKVESWKRHNKGM 70

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +A   G+D    A  + + ++        +  L EDEF+  +L  M+    +G   G V 
Sbjct: 71  VAKLEGLDIREDAHLMTNFEIAIDPAVLPE--LSEDEFYWRELFGMQVVTTKGYDLGVVS 128

Query: 121 GVYNFGAGSILEIKNT-----MEKTFLIPFTKF-AVLEVNLQENKILIDPIAA 167
            +   G+  +L +K        +K  LIPF +   +++V+ +  +I +D    
Sbjct: 129 DILETGSNDVLVVKANLKDAFGQKERLIPFLEEQVIIKVDREAQRIEVDWDPG 181


>gi|209965493|ref|YP_002298408.1| 16S rRNA processing protein RimM, putative [Rhodospirillum centenum
           SW]
 gi|238058954|sp|B6IP93|RIMM_RHOCS RecName: Full=Ribosome maturation factor rimM
 gi|209958959|gb|ACI99595.1| 16S rRNA processing protein RimM, putative [Rhodospirillum centenum
           SW]
          Length = 201

 Score =  137 bits (346), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 49/185 (26%), Positives = 94/185 (50%), Gaps = 3/185 (1%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDN--RELRILKMYRKNKRFI 61
           +   +++A I   HG++G V + S+  +   +  Y   ++++  RE ++ +       F+
Sbjct: 1   MTTRIVVAQILGAHGVHGRVKLKSFTADETAVFGYAPLTDESGRREFKLRRTGTGKDHFL 60

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
           A   GI    +A  LR  +LY +R      E +EDEF++ DL  ++T     + +G +  
Sbjct: 61  AEVDGITGKEAADALRGTRLYIERDRLPAPE-DEDEFYHADLIGLDTVTADDQPFGTIKA 119

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQYDC 181
           +Y+FGAG +LEI++  EKT  +PFTK  V  + +   +++++P A        +  + + 
Sbjct: 120 IYDFGAGDMLEIRHVSEKTVFLPFTKACVPVIEIAAGRVVVEPPANFFAPAGPQPAEGEE 179

Query: 182 PLDSA 186
             D A
Sbjct: 180 MPDGA 184


>gi|117620610|ref|YP_855209.1| 16S rRNA-processing protein RimM [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|171855192|sp|A0KG24|RIMM_AERHH RecName: Full=Ribosome maturation factor rimM
 gi|117562017|gb|ABK38965.1| 16S rRNA processing protein RimM [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 173

 Score =  137 bits (346), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 39/174 (22%), Positives = 76/174 (43%), Gaps = 12/174 (6%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND----NRELRILKMYRKNKR 59
           ++K V++ T+GT +G+ G + ++S+ +    +  Y  +  +     RE+++    R NK 
Sbjct: 1   MEKPVVLGTLGTVYGIKGWLKVNSFTDVAEAIFDYNPWLINQNGVWREIQVSSWKRHNKG 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I    GID    A  L ++++           L E EF+  DL        +G   G+V
Sbjct: 61  LICKLDGIDVREDALALTNVEIGVAADLLPA--LPEGEFYWRDLIGCSVVTTKGYDLGKV 118

Query: 120 CGVYNFGAGSILEIKNTME-----KTFLIPFTKF-AVLEVNLQENKILIDPIAA 167
             +   G+  +L ++  ++     K  LIPF +   +  ++L    I +D    
Sbjct: 119 TELMETGSNDVLVVEANVKDAFGAKERLIPFLEEQVIKNIDLTARTIEVDWDPG 172


>gi|257886946|ref|ZP_05666599.1| ribosome maturation factor rimM [Enterococcus faecium 1,141,733]
 gi|257898133|ref|ZP_05677786.1| ribosome maturation factor rimM [Enterococcus faecium Com15]
 gi|257823000|gb|EEV49932.1| ribosome maturation factor rimM [Enterococcus faecium 1,141,733]
 gi|257836045|gb|EEV61119.1| ribosome maturation factor rimM [Enterococcus faecium Com15]
          Length = 174

 Score =  137 bits (346), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 31/176 (17%), Positives = 73/176 (41%), Gaps = 8/176 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR------YVLYSNDNRELRILKMYRKN 57
           + + + +  I  T G+ GEV + S  + P +  +               EL +    +  
Sbjct: 1   MTEYLNVGKIVNTQGIKGEVRVISTTDFPEERYKKGTVLTLFQDGKAPVELTVKSHRKHK 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              + +F G  +I+   + RD  L   + +    +L E+EF+  ++  +   +  G   G
Sbjct: 61  NFDLLSFEGHPSINDVEKYRDGILKVSKDN--SVDLAENEFYYHEIIGLRVVEEDGTELG 118

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTT 173
           +V  + + GA  +  ++   +   L+P+    V EV+L+   + ++     +++  
Sbjct: 119 KVKEILSPGANDVWVVQRPKKADILLPYIASVVKEVDLEAGVVRVEIPEGLIDDED 174


>gi|125973285|ref|YP_001037195.1| 16S rRNA processing protein RimM [Clostridium thermocellum ATCC
           27405]
 gi|256003765|ref|ZP_05428753.1| 16S rRNA processing protein RimM [Clostridium thermocellum DSM
           2360]
 gi|281417489|ref|ZP_06248509.1| 16S rRNA processing protein RimM [Clostridium thermocellum JW20]
 gi|166226436|sp|A3DDH3|RIMM_CLOTH RecName: Full=Ribosome maturation factor rimM
 gi|125713510|gb|ABN52002.1| 16S rRNA processing protein RimM [Clostridium thermocellum ATCC
           27405]
 gi|255992326|gb|EEU02420.1| 16S rRNA processing protein RimM [Clostridium thermocellum DSM
           2360]
 gi|281408891|gb|EFB39149.1| 16S rRNA processing protein RimM [Clostridium thermocellum JW20]
 gi|316940483|gb|ADU74517.1| 16S rRNA processing protein RimM [Clostridium thermocellum DSM
           1313]
          Length = 174

 Score =  137 bits (345), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 47/175 (26%), Positives = 85/175 (48%), Gaps = 8/175 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVL------YSNDNRELRILKMYRKN 57
           + + + +  I  THG+ GEV      +NP   N+          SN+  +  I+ +    
Sbjct: 1   MIQYLQVGKIVNTHGIKGEVKAIPLTDNPRRFNKLKWAYVSKEISNEMPKFDIVSVKHHK 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              I  FSGID++++A +L++  +   R+D    +L +D FF  DL  M  FD + K  G
Sbjct: 61  NFVILKFSGIDDMNAAEKLKEHFVIIDRKD--AVKLPKDTFFICDLIGMNVFDTEEKKLG 118

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNT 172
            +  V + G+  +  +K+   K  LIP  K  V +V  ++NK+++D     +++ 
Sbjct: 119 VLTDVLSTGSNDVYVVKSDNNKEILIPALKSVVKKVCFEDNKMVVDLPQGLIDDE 173


>gi|156975744|ref|YP_001446651.1| 16S rRNA-processing protein [Vibrio harveyi ATCC BAA-1116]
 gi|166226487|sp|A7MYV0|RIMM_VIBHB RecName: Full=Ribosome maturation factor rimM
 gi|156527338|gb|ABU72424.1| hypothetical protein VIBHAR_03479 [Vibrio harveyi ATCC BAA-1116]
          Length = 182

 Score =  137 bits (345), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 38/173 (21%), Positives = 76/173 (43%), Gaps = 12/173 (6%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND----NRELRILKMYRKNKRF 60
           ++ +++   G T+G+ G + + SY +N   +  Y  +  +      E ++    R NK  
Sbjct: 11  NEKIVVGKFGATYGIRGWLKVFSYTDNAESIFDYSPWFINQKGTWVEYKVESWKRHNKGM 70

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +A   G+D    A  L + ++        +  L EDEF+  +L  M+    +G   G V 
Sbjct: 71  VAKLEGLDIREDAHLLTNFEIAIDPAVLPE--LSEDEFYWRELFGMQVVTTKGYDLGVVS 128

Query: 121 GVYNFGAGSILEIKNT-----MEKTFLIPFTKF-AVLEVNLQENKILIDPIAA 167
            +   G+  +L +K        +K  LIPF +   +++V+ +  +I +D    
Sbjct: 129 DILETGSNDVLVVKANLKDAFGQKERLIPFLEEQVIIKVDREAQRIEVDWDPG 181


>gi|49483402|ref|YP_040626.1| 16S rRNA-processing protein RimM [Staphylococcus aureus subsp.
           aureus MRSA252]
 gi|56749570|sp|Q6GHJ6|RIMM_STAAR RecName: Full=Ribosome maturation factor rimM
 gi|49241531|emb|CAG40217.1| 16S rRNA processing protein [Staphylococcus aureus subsp. aureus
           MRSA252]
          Length = 167

 Score =  137 bits (345), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 48/168 (28%), Positives = 84/168 (50%), Gaps = 8/168 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY-----VLYSNDNRELRILKMYRKNKRFIA 62
           V +  I  THG+ GE+ + S ++      +      V+++N++ E  +          + 
Sbjct: 3   VEVGQIVNTHGIKGEIKVKSNSDFTDVRFQPGQVLTVVHNNNDLEYTVKSHRVHKGLHML 62

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
           TF GI+NI+    L+   +Y +R   +D  LEE+EF+ +D+     FD Q    G+V  +
Sbjct: 63  TFEGINNINDIEHLKGSSIYQERDH-EDIVLEENEFYYSDIIGCTVFDDQETPIGRVINI 121

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           +  GA  +  IK    K +LIP+    V EV+++  KI+I P+   L+
Sbjct: 122 FETGANDVWVIK--ESKEYLIPYIADVVKEVDVENKKIIITPMEGLLD 167


>gi|210615862|ref|ZP_03290824.1| hypothetical protein CLONEX_03043 [Clostridium nexile DSM 1787]
 gi|210150065|gb|EEA81074.1| hypothetical protein CLONEX_03043 [Clostridium nexile DSM 1787]
          Length = 168

 Score =  137 bits (345), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 41/169 (24%), Positives = 80/169 (47%), Gaps = 6/169 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNR----ELRILKMYRKNKR 59
           +++L+ +  I +THG+ GEV +    ++     +      D       L I  +    + 
Sbjct: 1   MEQLLQVGVISSTHGVRGEVKVFPTTDDVKRFKKLKKVILDTGKEQLPLEIEGVKFFKQF 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F GIDNI+   + +  +L   R+     +L++DE+F  D+  M+ F   G+ +G +
Sbjct: 61  VILKFRGIDNINDIEKYKGKRLLVDREH--AVKLKKDEYFIADMIGMDVFTEDGELFGAL 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAG 168
             V   GA  +  I+ +  K  L+P  K  +L+V+++  K++I  +   
Sbjct: 119 KDVMETGANDVYIIEMSDGKEVLVPAIKQCILDVDIENRKMVIHLLEGL 167


>gi|258423920|ref|ZP_05686805.1| 16S rRNA processing protein RimM [Staphylococcus aureus A9635]
 gi|257845949|gb|EEV69978.1| 16S rRNA processing protein RimM [Staphylococcus aureus A9635]
          Length = 167

 Score =  137 bits (345), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 47/168 (27%), Positives = 84/168 (50%), Gaps = 8/168 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY-----VLYSNDNRELRILKMYRKNKRFIA 62
           V +  I  THG+ GE+ + S ++      +      V+++N++ +  +          + 
Sbjct: 3   VEVGQIVNTHGIKGEIKVKSNSDFTDVRFQPGQVLTVVHNNNDLKYTVKSHRVHKGLHML 62

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
           TF GI+NI+    L+   +Y +R   +D  LEE+EF+ +D+     FD Q    G+V  +
Sbjct: 63  TFEGINNINDIEHLKGSSIYQERDH-EDIVLEENEFYYSDIIGCTVFDDQETPIGRVINI 121

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           +  GA  +  IK    K +LIP+    V EV+++  KI+I P+   L+
Sbjct: 122 FETGANDVWVIK--GSKEYLIPYIADVVKEVDVENKKIIITPMEGLLD 167


>gi|170017562|ref|YP_001728481.1| RimM protein, required for 16S rRNA processing [Leuconostoc citreum
           KM20]
 gi|209573566|sp|B1MZT5|RIMM_LEUCK RecName: Full=Ribosome maturation factor rimM
 gi|169804419|gb|ACA83037.1| RimM protein, required for 16S rRNA processing [Leuconostoc citreum
           KM20]
          Length = 172

 Score =  137 bits (345), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 33/174 (18%), Positives = 67/174 (38%), Gaps = 7/174 (4%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-----VLYSNDNRELRILKMYRK 56
           +  +    + TI  THG+ GEV I +  +   D  +      +        + +      
Sbjct: 1   MTKENYFKVGTIVNTHGIRGEVKIMAITDFAADRFKKGAALQIETKQGFVPVTVQSSRLH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
              ++  F G+ NI+   + +   +Y   +  +   L +DE++  ++ +       G+  
Sbjct: 61  KNMWLVLFEGVTNINEIEKYKTNDIYVYGEAREA--LGDDEYYYDEIIDSRVVSLSGEAI 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           G V  +   GA  +  +K   +   LIP     V  V++    I ID +   L+
Sbjct: 119 GVVSEIMTTGANDVWVVKRPGQSDALIPMIDDVVKSVDVANKLITIDVLEGLLD 172


>gi|323441015|gb|EGA98722.1| 16S rRNA-processing protein RimM [Staphylococcus aureus O11]
 gi|323442332|gb|EGA99962.1| 16S rRNA-processing protein RimM [Staphylococcus aureus O46]
          Length = 167

 Score =  137 bits (345), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 48/168 (28%), Positives = 83/168 (49%), Gaps = 8/168 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY-----VLYSNDNRELRILKMYRKNKRFIA 62
           V +  I  THG+ GE+ + S ++      +      V+++N++ E  +          + 
Sbjct: 3   VEVGQIVNTHGIKGEIKVKSNSDFTDVRFQPGQVLTVVHNNNDLEYTVKSHRVHKGLHML 62

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
           TF GI+NI+    L+   +Y +R   +D  LEE+EF+ +D+     FD Q    G+V  +
Sbjct: 63  TFEGINNINDIEHLKGSSIYQERDH-EDIVLEENEFYYSDIIGCTVFDDQETPIGRVINI 121

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           +  GA  +  IK    K +LIP+    V EV+++  KI I P+   L+
Sbjct: 122 FETGANDVWVIK--GSKEYLIPYIADVVKEVDIENKKISITPMEGLLD 167


>gi|315639579|ref|ZP_07894720.1| 16S rRNA processing protein RimM [Enterococcus italicus DSM 15952]
 gi|315484678|gb|EFU75133.1| 16S rRNA processing protein RimM [Enterococcus italicus DSM 15952]
          Length = 174

 Score =  137 bits (345), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 38/176 (21%), Positives = 77/176 (43%), Gaps = 8/176 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR------YVLYSNDNRELRILKMYRKN 57
           + + + +  I  THG+ GEV + S  +  ++  +          +     L I    R  
Sbjct: 1   MTEYLNVGKIVNTHGIRGEVRVISQTDFALERYQPGKTLVLFRENQAPLTLTIDTYRRHK 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              + +F G  +I+     RD  L   ++D    EL E+EF+  ++   E    +GK  G
Sbjct: 61  NFDLLSFEGYPSINQVESFRDGILKVAKED--RVELAENEFYYYEIIGAEVVTEEGKVIG 118

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTT 173
           +V  + + GA  +  ++   +K  L+P+    + EV++   KI+++     L++  
Sbjct: 119 KVKEILSPGANDVWVVQRKGKKDALLPYIDSVIKEVDVTAQKIIVEIPEGLLDDEN 174


>gi|297191792|ref|ZP_06909190.1| 16S rRNA processing protein [Streptomyces pristinaespiralis ATCC
           25486]
 gi|297151068|gb|EDY65599.2| 16S rRNA processing protein [Streptomyces pristinaespiralis ATCC
           25486]
          Length = 187

 Score =  137 bits (345), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 37/188 (19%), Positives = 82/188 (43%), Gaps = 6/188 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPI-DLNRYVLYSNDN---RELRILKMYRKNKR 59
           +   +++  IG  HG+ GEV ++   + P   L    + + D      L I      + R
Sbjct: 1   MSVQLVVGRIGRAHGIKGEVTVEVRTDEPELRLGPGAVLATDPATAGPLTIETGRVHSGR 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +  F G+ + ++A  LR+  L A+     +   E DE+++  L +++     G   G++
Sbjct: 61  LLLRFEGVKDRNAAEALRNTLLIAEVDPE-ELPEEPDEYYDHQLMDLDVVLEDGTEIGRI 119

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMK-NPQ 178
             + +  +  +  ++       +IPF +  V E++L+E + +I P    ++ +  +    
Sbjct: 120 TEISHLPSQDLFIVERPDGSEVMIPFVQEIVAEIDLEEQRAVITPPRGLIDGSEAEVASG 179

Query: 179 YDCPLDSA 186
            D   D +
Sbjct: 180 RDASEDGS 187


>gi|323484789|ref|ZP_08090146.1| hypothetical protein HMPREF9474_01897 [Clostridium symbiosum
           WAL-14163]
 gi|323691862|ref|ZP_08106116.1| 16S rRNA processing protein RimM [Clostridium symbiosum WAL-14673]
 gi|323401895|gb|EGA94236.1| hypothetical protein HMPREF9474_01897 [Clostridium symbiosum
           WAL-14163]
 gi|323504069|gb|EGB19877.1| 16S rRNA processing protein RimM [Clostridium symbiosum WAL-14673]
          Length = 170

 Score =  137 bits (345), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 40/171 (23%), Positives = 72/171 (42%), Gaps = 6/171 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRE----LRILKMYRKNKR 59
           +++ + +  I +THG+ GEV +    ++            D  +    + + ++      
Sbjct: 1   MEQFLRVGVISSTHGIKGEVKVFPTTDDVNRYKDLKEVFLDTGKGRILMELEQVKFHKNM 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F G DNI+     +   L   R+      L  DE F  DL  ++    +GK +G V
Sbjct: 61  VIVKFKGYDNINDIEMYKGKDLLISREH--AVSLAPDENFIIDLIGLKVVTDEGKDFGTV 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
             +   GA  +  I     K +L P  K  +L+VNL+E K+ +  +   L+
Sbjct: 119 KDILQTGANDVYVIDGNDGKEYLFPSIKECILDVNLEEGKVTVHILDGLLD 169


>gi|91228774|ref|ZP_01262684.1| 16S rRNA-processing protein [Vibrio alginolyticus 12G01]
 gi|262393310|ref|YP_003285164.1| 16S rRNA processing protein RimM [Vibrio sp. Ex25]
 gi|269966293|ref|ZP_06180381.1| 16S rRNA-processing protein [Vibrio alginolyticus 40B]
 gi|91187681|gb|EAS74003.1| 16S rRNA-processing protein [Vibrio alginolyticus 12G01]
 gi|262336904|gb|ACY50699.1| 16S rRNA processing protein RimM [Vibrio sp. Ex25]
 gi|269829090|gb|EEZ83336.1| 16S rRNA-processing protein [Vibrio alginolyticus 40B]
          Length = 182

 Score =  137 bits (345), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 37/173 (21%), Positives = 74/173 (42%), Gaps = 12/173 (6%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRF 60
           ++ +++   G T+G+ G + + SY +N   +  Y  +         E ++    R NK  
Sbjct: 11  NEKIVVGKFGATYGIRGWLKVFSYTDNAESIFDYSPWYINQKGKWVEYKVESWKRHNKGM 70

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +A   G+D    A  + + ++        +  L EDEF+  +L  M+    +G   G V 
Sbjct: 71  VAKLEGMDVREDAHLMTNFEIAIDPAVLPE--LSEDEFYWRELFGMQVVTTKGYDLGVVT 128

Query: 121 GVYNFGAGSILEIKNT-----MEKTFLIPFTKF-AVLEVNLQENKILIDPIAA 167
            +   G+  +L +K        +K  LIPF +   ++ V+ +  +I +D    
Sbjct: 129 DMLETGSNDVLVVKANLKDAFGQKERLIPFLEEQVIINVDREAQRIEVDWDPG 181


>gi|302332843|gb|ADL23036.1| 16S rRNA processing protein RimM [Staphylococcus aureus subsp.
           aureus JKD6159]
          Length = 167

 Score =  137 bits (345), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 47/168 (27%), Positives = 84/168 (50%), Gaps = 8/168 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY-----VLYSNDNRELRILKMYRKNKRFIA 62
           V +  I  THG+ GE+ + S ++      +      V+++N++ E  +          + 
Sbjct: 3   VEVGQIVNTHGIKGEIKVKSNSDFTDVRFQPGQVLTVVHNNNDLEYTVKSHRVHKGLHML 62

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
           TF GI+NI+    L+   +Y +R   +D  LEE+E++ +D+     FD Q    G+V  +
Sbjct: 63  TFEGINNINDIEHLKGSSIYQERDH-EDIVLEENEYYYSDIIGCTVFDDQETPIGRVINI 121

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           +  GA  +  IK    K +LIP+    V EV+++  KI+I P+   L+
Sbjct: 122 FETGANDVWVIK--GSKEYLIPYIADVVKEVDVENKKIIIKPMEGLLD 167


>gi|148544376|ref|YP_001271746.1| 16S rRNA-processing protein RimM [Lactobacillus reuteri DSM 20016]
 gi|184153740|ref|YP_001842081.1| 16S rRNA-processing protein RimM [Lactobacillus reuteri JCM 1112]
 gi|227363199|ref|ZP_03847333.1| 16S rRNA processing protein RimM [Lactobacillus reuteri MM2-3]
 gi|325682696|ref|ZP_08162212.1| 16S rRNA processing protein RimM [Lactobacillus reuteri MM4-1A]
 gi|166985956|sp|A5VKN5|RIMM_LACRD RecName: Full=Ribosome maturation factor rimM
 gi|229564323|sp|B2G819|RIMM_LACRJ RecName: Full=Ribosome maturation factor rimM
 gi|148531410|gb|ABQ83409.1| 16S rRNA processing protein RimM [Lactobacillus reuteri DSM 20016]
 gi|183225084|dbj|BAG25601.1| 16S rRNA processing protein RimM [Lactobacillus reuteri JCM 1112]
 gi|227071805|gb|EEI10094.1| 16S rRNA processing protein RimM [Lactobacillus reuteri MM2-3]
 gi|324977046|gb|EGC13997.1| 16S rRNA processing protein RimM [Lactobacillus reuteri MM4-1A]
          Length = 168

 Score =  137 bits (345), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 31/168 (18%), Positives = 72/168 (42%), Gaps = 7/168 (4%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-----YVLYSNDNRELRILKMYRKNKRF 60
           +   +  I  THG+ GEV + +  +   +        Y+  S +   L I    +     
Sbjct: 2   EYYNVGKIVNTHGVRGEVRVLATTDFIDERFAKGNTLYLQQSGEPLPLTIESTRQHKGFV 61

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +  F G DNI+   + RD +L     D   + L++ +++   +  ++     G++ G++ 
Sbjct: 62  LVKFVGYDNINDVEQFRDHELMVSADD--QQPLDDGQYYYHQIIGLDVETTDGRHLGKIK 119

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAG 168
            + + GA  +  ++   ++  L+P     V  V+L +N + ++ +   
Sbjct: 120 EILSPGANDVWVVERPEKRDLLLPVIDEVVKNVDLDKNFVTVELMEGL 167


>gi|134299898|ref|YP_001113394.1| 16S rRNA processing protein RimM [Desulfotomaculum reducens MI-1]
 gi|172044314|sp|A4J666|RIMM_DESRM RecName: Full=Ribosome maturation factor rimM
 gi|134052598|gb|ABO50569.1| 16S rRNA processing protein RimM [Desulfotomaculum reducens MI-1]
          Length = 169

 Score =  137 bits (345), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 36/169 (21%), Positives = 72/169 (42%), Gaps = 6/169 (3%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYV----LYSNDNRELRILKMYRKNKRF 60
           ++ + +  +  T G+ GEV I    + P    +      L     R+  I +++   +  
Sbjct: 3   EEYITVGKVVNTQGIQGEVRIIPTTDFPERFVKNDKISVLLRGQRRDYTIERVWEHKQFI 62

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           I  FS I ++ +A +L+   L    ++     L E  ++   +  ++  D   +  G V 
Sbjct: 63  IIKFSEIPDMTAAEKLKGGLLQVTMEEL--VPLPEGNYYIFQIVGLKVVDENEQELGTVA 120

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
            V   GA  +  +K +  K  LIP  K  V E+N+ E K+ ++ +   +
Sbjct: 121 QVLQTGANDVYVVKRSEGKDILIPAIKSVVKEINITEGKMKVELLEGLI 169


>gi|258646853|ref|ZP_05734322.1| 16S rRNA processing protein RimM [Dialister invisus DSM 15470]
 gi|260404292|gb|EEW97839.1| 16S rRNA processing protein RimM [Dialister invisus DSM 15470]
          Length = 168

 Score =  137 bits (345), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 27/168 (16%), Positives = 58/168 (34%), Gaps = 4/168 (2%)

Query: 1   MVKLD--KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNK 58
           M  ++  K + +  I   HG+ G++ +      P    +        R   +        
Sbjct: 1   MNDMNSGKWITVGRIVAPHGVRGDLRVLPETERPAMFKKLKKLFLGGRTYDVRSSRPHKN 60

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
            +I   +G+++ + A  L    +     +    +L E E++   L  +      G   G 
Sbjct: 61  VYIIHLAGVEDRNGAEPLVGTPVEIPVAELP--KLPEGEYYYFQLIGLTVVSDTGDTVGT 118

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIA 166
           +  +   GA ++  +K    K   +P     VL V  +E  + +    
Sbjct: 119 LTEIIETGANNVYAVKTAEGKEIYLPAIPSCVLSVQPEEKTMTVHLPE 166


>gi|145593858|ref|YP_001158155.1| 16S rRNA-processing protein RimM [Salinispora tropica CNB-440]
 gi|209573594|sp|A4X4H7|RIMM_SALTO RecName: Full=Ribosome maturation factor rimM
 gi|145303195|gb|ABP53777.1| 16S rRNA processing protein RimM [Salinispora tropica CNB-440]
          Length = 180

 Score =  137 bits (345), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 36/180 (20%), Positives = 72/180 (40%), Gaps = 17/180 (9%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNR---------------YVLYSNDNRELRIL 51
           ++++  IG  HG+ GEV ++   + P                    +        EL + 
Sbjct: 1   MLVVGRIGKPHGIRGEVTVEVRTDEPETRFAPGSVLRTEPGANVPAHPGAYRVPGELTVE 60

Query: 52  KMYRKNKR-FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFD 110
                  R  + TF G+ + + A  LR   +   R D      + +EF +  L  +    
Sbjct: 61  AARWHQGRVLLVTFEGVLDRNVAEALRGTLVGVDRADVAPPT-DPEEFHDHQLVGLAVVT 119

Query: 111 RQGKYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
             G+  G++  + +  A  +L ++    +  LIPF +  V E++L   ++++DP    L+
Sbjct: 120 SAGERLGEIARIDHAPAADLLVLRRPGRRDVLIPFVQAIVPEIDLAGGRVVVDPPGGLLD 179


>gi|329121414|ref|ZP_08250039.1| 16S rRNA processing protein RimM [Dialister micraerophilus DSM
           19965]
 gi|327469704|gb|EGF15171.1| 16S rRNA processing protein RimM [Dialister micraerophilus DSM
           19965]
          Length = 168

 Score =  137 bits (345), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 22/165 (13%), Positives = 69/165 (41%), Gaps = 2/165 (1%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFI 61
           +K D++ ++  I   HG+ G++ +    + P             +  +++        +I
Sbjct: 4   MKTDEMTVVGRIVAPHGVRGDLRVLPEIDKPEIFKNIKHIYFGEKSYKVISSRPHKNIYI 63

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               G+ + +++  +  L     + +      +E E++  +L +ME + ++G + G +  
Sbjct: 64  MKVEGVTDRNTSESMVGLSASLSKDEIPPC--KEGEYYCFELLDMEVYTQEGTFVGTLKE 121

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIA 166
           +   GA  +  +    ++   +P     + +V+++  K+ ++   
Sbjct: 122 IIETGANDVYTVIGPDKEEIYLPAIPSCIKKVDVESRKMTVELPE 166


>gi|167767998|ref|ZP_02440051.1| hypothetical protein CLOSS21_02541 [Clostridium sp. SS2/1]
 gi|317498407|ref|ZP_07956702.1| 16S rRNA processing protein RimM [Lachnospiraceae bacterium
           5_1_63FAA]
 gi|167710327|gb|EDS20906.1| hypothetical protein CLOSS21_02541 [Clostridium sp. SS2/1]
 gi|291561000|emb|CBL39800.1| 16S rRNA processing protein RimM [butyrate-producing bacterium
           SSC/2]
 gi|316894301|gb|EFV16488.1| 16S rRNA processing protein RimM [Lachnospiraceae bacterium
           5_1_63FAA]
          Length = 171

 Score =  136 bits (344), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 36/173 (20%), Positives = 73/173 (42%), Gaps = 7/173 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR----YVLYSNDNRELRILKMYRKNKR 59
           +++ + +  I  THG+ GEV +    ++     +    Y+    + + L ++       +
Sbjct: 1   MEEFLQVGAIANTHGIAGEVKVFPMTDDIKRFKKLKEVYLDTGKERKLLHVVSCKFVKNQ 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDR-QGKYWGQ 118
            +  F    NI+     +   L+  R       LE+DE+F  DL  +       G+  G+
Sbjct: 61  PVLRFKEFSNINEVEMYKRKGLFVTRDQ--AVPLEKDEYFIADLIGLSVIREDNGEVLGE 118

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN 171
           +  V   GA  + E+K    K  L+P  +  +  V+LQ+ +I +  +   L+ 
Sbjct: 119 LTDVLQTGANDVYEVKMEDGKEVLLPAIRECIKNVDLQKGEITVHVMKGLLDE 171


>gi|311068122|ref|YP_003973045.1| 16S rRNA-processing protein RimM [Bacillus atrophaeus 1942]
 gi|310868639|gb|ADP32114.1| 16S rRNA-processing protein RimM [Bacillus atrophaeus 1942]
          Length = 174

 Score =  136 bits (344), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 32/178 (17%), Positives = 76/178 (42%), Gaps = 11/178 (6%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-------YVLYSNDNRELRILKM 53
           M K  +   +  I  THG+ GEV + S  +   +  +       ++  S +  ++ +   
Sbjct: 1   MAK--RWFNVGKIVNTHGIKGEVRVISKTDFAEERYKPGKTLYLFMSGSKEPVQVTVQTH 58

Query: 54  YRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQG 113
               +  +  F    +++   EL++  +    +D    EL+  E++  ++   E +   G
Sbjct: 59  RLHKQFHLLQFKERPSLNDVEELKNAIIKVPEEDL--GELDAGEYYFHEIIGCEVYTEDG 116

Query: 114 KYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN 171
           +  G +  +   GA  +  ++   +K  LIP+ +  V ++++ E KI I  +   ++ 
Sbjct: 117 ERIGVIREILTPGANDVWVVERKGQKDALIPYIESIVKDIDVTEKKIQIHLMEGLIDE 174


>gi|229918607|ref|YP_002887253.1| 16S rRNA processing protein RimM [Exiguobacterium sp. AT1b]
 gi|259585644|sp|C4L602|RIMM_EXISA RecName: Full=Ribosome maturation factor rimM
 gi|229470036|gb|ACQ71808.1| 16S rRNA processing protein RimM [Exiguobacterium sp. AT1b]
          Length = 172

 Score =  136 bits (344), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 42/174 (24%), Positives = 79/174 (45%), Gaps = 9/174 (5%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-----YVLYSNDNRELRILKMYRKNKRF 60
             + +  I  THGL GEV I +  + P +  +     ++      +E+ I       +  
Sbjct: 2   DWLYVGKIANTHGLKGEVKILAATDFPEERFKKGNTLFLDVDGTKQEMTITTYRPHKQFH 61

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           + TF G DNI+   + + LKLY   +     +L+E EF+  ++   E     G+  G V 
Sbjct: 62  LVTFKGFDNINLIEKYKGLKLYVHAEH--VHDLDEHEFYYHEIIGCEA-VVDGEVIGVVD 118

Query: 121 GVYNF-GAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTT 173
            ++   GA  +  IK   +   LIP+ +  V E+++   +++I PI   +++  
Sbjct: 119 DIFETNGANDVWVIKRPGKSDALIPYIESVVQEIDVDAKRVVITPIPGMIDDED 172


>gi|242373531|ref|ZP_04819105.1| 16S rRNA processing protein [Staphylococcus epidermidis M23864:W1]
 gi|242348894|gb|EES40496.1| 16S rRNA processing protein [Staphylococcus epidermidis M23864:W1]
          Length = 167

 Score =  136 bits (344), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 43/168 (25%), Positives = 81/168 (48%), Gaps = 8/168 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNR-----YVLYSNDNRELRILKMYRKNKRFIA 62
           V +  I  THG+ GEV + S ++      +      V ++N++ +  I          + 
Sbjct: 3   VEVGQIVNTHGIKGEVKVKSNSDFTATRFQPGENLIVKHNNNDIQYTIASYRIHKGFHML 62

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F GI+NI+    L+   LY +R   +D EL+E E++ +D+     FD      G+V  +
Sbjct: 63  KFEGINNINDIEHLKGDYLYQERDH-EDIELDEHEYYYSDIIGCTVFDDNNTPIGRVINI 121

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           +  GA  +  +K   +K +LIP+ +  V +++++   I I P+   L+
Sbjct: 122 FETGANDVWVVK--GDKEYLIPYIEDVVKDIDVEGKSIRITPMEGLLD 167


>gi|242240275|ref|YP_002988456.1| 16S rRNA-processing protein RimM [Dickeya dadantii Ech703]
 gi|242132332|gb|ACS86634.1| 16S rRNA processing protein RimM [Dickeya dadantii Ech703]
          Length = 182

 Score =  136 bits (344), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 31/172 (18%), Positives = 71/172 (41%), Gaps = 12/172 (6%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRFI 61
             +++  IG+T+G+ G + + S       +  Y  +        +++ I      N+  I
Sbjct: 12  NPIVLGKIGSTYGIRGWLKVFSSTEEADSIFDYQPWFIQNKGQWQQVEIESWRYHNQSLI 71

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
                +D+  +A+ L + ++        +  L++ EF+  DL   +     G   G+V  
Sbjct: 72  IKIKHVDDRDAANLLTNCEIVVDSTQLPE--LDDGEFYWKDLIGCDVVTVSGYELGKVID 129

Query: 122 VYNFGAGSILEIKNTME-----KTFLIPF-TKFAVLEVNLQENKILIDPIAA 167
           +   G+  +L ++  ++     K  LIPF  +  +  ++L   +I +D    
Sbjct: 130 MMETGSNDVLVVRANLKDAYGVKERLIPFLNEQVIKHIDLSARRIEVDWDPG 181


>gi|182435680|ref|YP_001823399.1| 16S rRNA-processing protein RimM [Streptomyces griseus subsp.
           griseus NBRC 13350]
 gi|326776305|ref|ZP_08235570.1| Ribosome maturation factor rimM [Streptomyces cf. griseus
           XylebKG-1]
 gi|238689008|sp|B1VYW1|RIMM_STRGG RecName: Full=Ribosome maturation factor rimM
 gi|178464196|dbj|BAG18716.1| putative 16S rRNA processing protein [Streptomyces griseus subsp.
           griseus NBRC 13350]
 gi|326656638|gb|EGE41484.1| Ribosome maturation factor rimM [Streptomyces cf. griseus
           XylebKG-1]
          Length = 198

 Score =  136 bits (344), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 37/190 (19%), Positives = 84/190 (44%), Gaps = 8/190 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPI-DLNRYVLYSNDN---RELRILKMYRKNKRFIAT 63
           +++A IG  HG+ GEV ++   + P   L    + + +      L +      + R +  
Sbjct: 3   LVVARIGRAHGIKGEVTVEVRTDEPELRLGPGAVLATEPAATGPLTVEAGRVHSGRLLLR 62

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F G+ +   A  LR+  L A+     +   EEDEF++  L +++     G   G++  + 
Sbjct: 63  FEGVRDRTGAEALRNTLLIAEVDP-DELPEEEDEFYDHQLIDLDVVLADGTGIGRITEIS 121

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTT---MKNPQYD 180
           +  +  +  ++       +IPF +  V E++L+E + +I P    ++ +      +   +
Sbjct: 122 HLPSQDLFIVERPDGSEVMIPFVEEIVTEIDLEEQRAVITPPPGLIDESEAVVASSRDEE 181

Query: 181 CPLDSAGKKS 190
               ++G ++
Sbjct: 182 TGEAASGDEA 191


>gi|299536771|ref|ZP_07050079.1| 16S rRNA-processing protein [Lysinibacillus fusiformis ZC1]
 gi|298727783|gb|EFI68350.1| 16S rRNA-processing protein [Lysinibacillus fusiformis ZC1]
          Length = 171

 Score =  136 bits (344), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 39/171 (22%), Positives = 74/171 (43%), Gaps = 8/171 (4%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLN-------RYVLYSNDNRELRILKMYRKNK 58
           +   +  I  THG+ GEV + S  +   +          +         + I  + R   
Sbjct: 2   EWFNVGRIVNTHGIRGEVRVLSTTDFEEERFTVGNKLAAFKKDDKKPTWVTIESVRRHKN 61

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
             + TF G++NI+    L++  L   +    D+ LEE+EFF  ++        +G+  G 
Sbjct: 62  FILLTFEGMNNINLVEPLKEGMLKVTKDQMSDDLLEENEFFFHEIIGCTVISEEGETIGV 121

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           V  +   GA  +  +K T +K   IP+ +  V ++++ + KI+I  +   L
Sbjct: 122 VADILQTGANDVWVVKGT-KKEHYIPYIEDIVKDIDVMDKKIVIHVMEGLL 171


>gi|225568164|ref|ZP_03777189.1| hypothetical protein CLOHYLEM_04238 [Clostridium hylemonae DSM
           15053]
 gi|225162883|gb|EEG75502.1| hypothetical protein CLOHYLEM_04238 [Clostridium hylemonae DSM
           15053]
          Length = 168

 Score =  136 bits (344), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 38/170 (22%), Positives = 74/170 (43%), Gaps = 6/170 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNR----ELRILKMYRKNKR 59
           ++K++ +  I +THG+ GEV +    ++P           D      +L I  +    + 
Sbjct: 1   MEKMLKVGVITSTHGIRGEVKVFPTTDDPGRFKVLKQVILDTGKDTLQLEIENVKFFKQF 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F GIDNI+     +   L  +RQD     LE+ E+F  D+  M+     G+ +G +
Sbjct: 61  VILKFKGIDNINDVERYKRCALLVERQD--AVPLEDGEYFVADMLGMKVQTEDGELFGTL 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
             V   GA  +  I +      L+P  +  +  +++++  + I  +   +
Sbjct: 119 ADVMETGANDVYVIASPAHGEVLVPAIRECIQNIDIEQGMMTIHLMEGLI 168


>gi|319892248|ref|YP_004149123.1| 16S rRNA processing protein RimM [Staphylococcus pseudintermedius
           HKU10-03]
 gi|317161944|gb|ADV05487.1| 16S rRNA processing protein RimM [Staphylococcus pseudintermedius
           HKU10-03]
 gi|323464655|gb|ADX76808.1| 16S rRNA processing protein RimM [Staphylococcus pseudintermedius
           ED99]
          Length = 167

 Score =  136 bits (344), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 44/170 (25%), Positives = 76/170 (44%), Gaps = 9/170 (5%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRE-----LRILKMYRKNKRFI 61
            V +  I  THG+ GEV + S+++      +         +     L +          +
Sbjct: 2   KVEVGKIVNTHGIKGEVKVQSHSDFTEIRFQPGEVLQAEYQGQTLLLTVKSHRMHKGLHM 61

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
            TF G  NI+    L+   LY +R   +  EL+E EF+ +D+     FD   +  G+V  
Sbjct: 62  LTFEGYTNINDIEHLKGTHLYQERDH-EAIELDEHEFYYSDIIGCTVFD-GDRPIGRVTE 119

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN 171
           ++  GA  +  +K   +K  LIP+    V EV+++  +I+I P+   LN 
Sbjct: 120 IFETGANDVWVVK--GDKEHLIPYIADVVKEVDIEGRRIVITPLEGLLNE 167


>gi|304392572|ref|ZP_07374512.1| 16S rRNA processing protein RimM [Ahrensia sp. R2A130]
 gi|303295202|gb|EFL89562.1| 16S rRNA processing protein RimM [Ahrensia sp. R2A130]
          Length = 183

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 50/184 (27%), Positives = 85/184 (46%), Gaps = 4/184 (2%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKR 59
           M     L+L+A IG   G+ GE+ + ++ +NP  L+ Y  L + D R  ++ +M      
Sbjct: 1   MTDPSSLILLAQIGRPQGIKGELRVKAFTDNPEALDDYGALRTADGRRFKVKRMRPGKGV 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F G++    A      +L+ +R      E +EDEF+ TDL  M   D +G   G V
Sbjct: 61  LIVKFEGVNTREEAEAENGTELFIERHRLPPVE-DEDEFYVTDLIGMVVVDGEGLQIGTV 119

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL-NNTTMKNPQ 178
               +FGAGS+LEI      + ++ FT   V +V+L   ++ +   A  + +    +  +
Sbjct: 120 KDAPDFGAGSVLEITGGAG-SVMVDFTHANVPDVDLAAGRVTVIMPAELVTDENDGEEDE 178

Query: 179 YDCP 182
               
Sbjct: 179 IGEG 182


>gi|188579901|ref|YP_001923346.1| 16S rRNA-processing protein RimM [Methylobacterium populi BJ001]
 gi|209573581|sp|B1ZL68|RIMM_METPB RecName: Full=Ribosome maturation factor rimM
 gi|179343399|gb|ACB78811.1| 16S rRNA processing protein RimM [Methylobacterium populi BJ001]
          Length = 224

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 59/187 (31%), Positives = 83/187 (44%), Gaps = 13/187 (6%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKR----FI 61
           LVL+   G  HGL+GEV + S+   P+ +  Y  L+++D R L +              I
Sbjct: 45  LVLLGEFGRPHGLHGEVRLKSFTGEPLAIAGYGPLHASDGRTLELEDARPAPGGSPDLLI 104

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               G+DN   A  L  + L   R+     E +EDEFF TDL  +   D  G   G +  
Sbjct: 105 VRVKGVDNRSGAEALNRITLAIARERLGQAE-DEDEFFLTDLIGLAVEDPSGTVIGTIVA 163

Query: 122 VYNFGAGSILEIKN-TMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQYD 180
           V N+G G +LEI+      T L+PFTK  V  ++L   K++ DP            P   
Sbjct: 164 VPNYGGGDLLEIRPAAGGPTALLPFTKAFVPTLDLAGGKVVADPPEDLF------APPGP 217

Query: 181 CPLDSAG 187
            P D  G
Sbjct: 218 KPADDPG 224


>gi|218782475|ref|YP_002433793.1| 16S rRNA processing protein RimM [Desulfatibacillum alkenivorans
           AK-01]
 gi|218763859|gb|ACL06325.1| 16S rRNA processing protein RimM [Desulfatibacillum alkenivorans
           AK-01]
          Length = 169

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 37/172 (21%), Positives = 67/172 (38%), Gaps = 8/172 (4%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDN-----RELRILKMYRK 56
           +     V +  +   HG+ G V + S+A+NP    +             +E  +      
Sbjct: 1   MTSKDFVEVGQVAGVHGIRGAVLLRSFADNPDIFAKGGKLLLKGPGENIQEYILESSRPY 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
             + +A   G+ +   A  L+   +   R    +  LE DE++  DL  ME     G   
Sbjct: 61  KGKLLAELQGVSDRSGAEALKGRMILVHRDALPE--LEPDEYYWFDLIGMEVAAPDGSRL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAG 168
           G +  +   GA  +  IK+  EK  L P   + VL ++L+   +++D     
Sbjct: 119 GVLDAIIETGANDVYVIKD-GEKEILAPALPWVVLSIDLEAGVMIVDLPEGL 169


>gi|22298609|ref|NP_681856.1| 16S rRNA-processing protein [Thermosynechococcus elongatus BP-1]
 gi|32129963|sp|Q8DK05|RIMM_THEEB RecName: Full=Ribosome maturation factor rimM
 gi|22294789|dbj|BAC08618.1| tlr1065 [Thermosynechococcus elongatus BP-1]
          Length = 183

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 39/178 (21%), Positives = 76/178 (42%), Gaps = 17/178 (9%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLN----RYVLYSNDNRELRILKMY----RK 56
            + + +  I   HGL GEV +  +++ P        R++      +   +  +      +
Sbjct: 9   SEWLCIGQIVGAHGLRGEVKVKPFSDFPERFTVPGCRWLRSPRQPQPYAVTLLRGRFLPR 68

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
            ++F+ TF+ I +  +A  L+  ++     D     L  +E+   DL  +  + + G+  
Sbjct: 69  AEQFVVTFAEISDRTAAEALKGAEILVPASDRPP--LAANEYHLMDLIGLAVYHQ-GERV 125

Query: 117 GQVCGVYNFGAGSILEIK-----NTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           G+V G+ N G   +LE++         ++  IPF    V  V+L   +I IDP    L
Sbjct: 126 GEVVGLVNAG-NDLLEVQLLDPAPKAPQSVYIPFVPAIVPVVDLAARRIEIDPPLGLL 182


>gi|330839280|ref|YP_004413860.1| Ribosome maturation factor rimM [Selenomonas sputigena ATCC 35185]
 gi|329747044|gb|AEC00401.1| Ribosome maturation factor rimM [Selenomonas sputigena ATCC 35185]
          Length = 172

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 36/166 (21%), Positives = 66/166 (39%), Gaps = 2/166 (1%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIATF 64
           D  V++   G  HGL GEV +    + P             R   +  ++   +  + T 
Sbjct: 6   DGRVVIGKAGAPHGLRGEVRVIPLTDFPERFESLREVFIGERVFHVEHVHYHRQFVLLTL 65

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
           +   +  +A++L    L   R+D     L E EF+  D+  +   D  G+  G+V  V  
Sbjct: 66  AECTSREAAAKLTGELLRVARED--AAPLAEGEFYTFDIIGLAVLDMAGERLGEVTNVLK 123

Query: 125 FGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
            G+  +  +K T     L+P  K  V E+++    + +D      +
Sbjct: 124 TGSNDVYVVKKTDGAELLVPALKKVVREIDIAGGFLRVDLQEELED 169


>gi|313904184|ref|ZP_07837563.1| 16S rRNA processing protein RimM [Eubacterium cellulosolvens 6]
 gi|313470986|gb|EFR66309.1| 16S rRNA processing protein RimM [Eubacterium cellulosolvens 6]
          Length = 170

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 35/171 (20%), Positives = 77/171 (45%), Gaps = 6/171 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYV----LYSNDNRELRILKMYRKNKR 59
           +++ + +  I TTHG+ GEV +    ++              +       I  +     +
Sbjct: 1   MEQYLKIGVITTTHGVRGEVKVFPTTDDAGRFLDLDEVMLCKNGKTENHEIENVKFFKNQ 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I   SGI +++ A   R+ +++  R++    +LE+DE++  DL  +  ++  G  +G +
Sbjct: 61  VILKLSGITSMNDAELYRNWEIFIPREE--GVDLEDDEYYQADLIGLTVYNEDGSEFGVL 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
             +   GA  +  +K       LIP  K  +++VN++E  + +  +   L+
Sbjct: 119 KEIIETGANDVYVVKTQTHGEVLIPAIKDCIIDVNIEEGHMTVHLMPGILD 169


>gi|114571436|ref|YP_758116.1| 16S rRNA processing protein RimM [Maricaulis maris MCS10]
 gi|122315003|sp|Q0AKL5|RIMM_MARMM RecName: Full=Ribosome maturation factor rimM
 gi|114341898|gb|ABI67178.1| 16S rRNA processing protein RimM [Maricaulis maris MCS10]
          Length = 185

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 54/185 (29%), Positives = 87/185 (47%), Gaps = 9/185 (4%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY--VLYSNDNRELRILKMYRKNKRFIA 62
           D LV +A I   HG+ GE  + S+A NP D  +Y   L  +    L           F+ 
Sbjct: 6   DDLVFIAAIAGAHGVRGECKVKSFAGNPADAFKYGAFLDIDGKTILTPKAARPVKDGFVV 65

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F+   +   A  L+  KL+  R    +  LEEDEF+++DL  ++     G   G +  V
Sbjct: 66  RFAEPLDRDKAQALKGTKLHVLRSALPE--LEEDEFYHSDLLGLKVQGLDGAPMGTLKAV 123

Query: 123 YNFGAGSILEIKNTMEK--TFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQYD 180
           +NFG+G +LEI  T ++  ++++PFT+  V  V++ E  I IDP     +  +    +  
Sbjct: 124 HNFGSGDLLEITGTPDRNGSWMLPFTREFVPHVSIAEGVITIDPPE---DVGSKAEEEGG 180

Query: 181 CPLDS 185
              D 
Sbjct: 181 GAPDD 185


>gi|330466289|ref|YP_004404032.1| 16S rRNA-processing protein RimM [Verrucosispora maris AB-18-032]
 gi|328809260|gb|AEB43432.1| 16S rRNA-processing protein RimM [Verrucosispora maris AB-18-032]
          Length = 187

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 40/186 (21%), Positives = 70/186 (37%), Gaps = 23/186 (12%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLN----------------------RYVLYSND 44
           L+++  IG  HG+ GEV ++   + P                                  
Sbjct: 2   LLIVGRIGKPHGIRGEVTVEVRTDEPDTRFAPGVVLATMPGVVPRGGQEPAAEPGERYEV 61

Query: 45  NRELRILKMYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLE 104
              L +  +     R +  F G+ +   A  LR   L     D    E + +EF +  L 
Sbjct: 62  PDALTVEAVRWHQGRLLVAFEGVLDRDVAEALRGTLLTVDSADVAPPE-DPEEFHDHQLV 120

Query: 105 EMETFDRQGKYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
            +      G+  G+V  + +  A  +L ++    +T LIPF K  V EV+L   ++++DP
Sbjct: 121 GLAVVTPSGERLGEVARIDHAPASDLLVLRRPEGRTALIPFVKAIVPEVDLAGGRVVVDP 180

Query: 165 IAAGLN 170
               L+
Sbjct: 181 PGGLLD 186


>gi|84515964|ref|ZP_01003325.1| putative 16S rRNA processing protein [Loktanella vestfoldensis
           SKA53]
 gi|84510406|gb|EAQ06862.1| putative 16S rRNA processing protein [Loktanella vestfoldensis
           SKA53]
          Length = 171

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 50/173 (28%), Positives = 86/173 (49%), Gaps = 5/173 (2%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRE--LRILKMYRKNKRFI 61
           +   V++  IG + G+ GEV + S+  +P+ +  Y     ++ +   +++   +    F 
Sbjct: 1   MTDRVIVGMIGGSFGVKGEVRLKSFCADPMAIADYTPLYTEHGDSIAQVVLTGQLKGGFT 60

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
           A  SG+     A  LR++ LYA+R       L +DE++  DL  +   D  G   GQV  
Sbjct: 61  ARLSGVVTKEDADALRNVALYAERAAMPS--LPDDEYYYADLIGLAVLDTGGSKLGQVKS 118

Query: 122 VYNFGAGSILEIKNTMEK-TFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTT 173
           V + GAG++LE+    +  T L+PFT+ AV  V+L   +I+ DP A    +  
Sbjct: 119 VVDHGAGALLELHVPGQSDTVLLPFTQAAVPTVDLAAGRIIADPPAGLFASDD 171


>gi|289644819|ref|ZP_06476872.1| 16S rRNA processing protein RimM [Frankia symbiont of Datisca
           glomerata]
 gi|289505375|gb|EFD26421.1| 16S rRNA processing protein RimM [Frankia symbiont of Datisca
           glomerata]
          Length = 208

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 36/177 (20%), Positives = 66/177 (37%), Gaps = 9/177 (5%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDN----RELRILKMYRKNKRF 60
           D+ V++  IG  HG+ GEV ID   + P        +          L +        R 
Sbjct: 32  DEPVVVGRIGRPHGIRGEVTIDVRTDVPERRFAPGTHLCGEPPTATPLMVAVARWHAGRL 91

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELE-----EDEFFNTDLEEMETFDRQGKY 115
           +  F G+ +  +A  LR   L            +      + +++ DL  +         
Sbjct: 92  LVRFEGVGDRDAAEALRGRVLTIAAGQAGQAADDGDEDAGNLWWDRDLVGLRVVTVDDAD 151

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNT 172
            G V  V +  AG +L +++   +  L+PF +  V  V +   +I++DP     +  
Sbjct: 152 VGTVVDVVHTPAGELLAVEHVGGREVLVPFVREIVPTVEVPVGRIVVDPPPGLFDLE 208


>gi|261408020|ref|YP_003244261.1| 16S rRNA processing protein RimM [Paenibacillus sp. Y412MC10]
 gi|329929602|ref|ZP_08283309.1| 16S rRNA processing protein RimM [Paenibacillus sp. HGF5]
 gi|261284483|gb|ACX66454.1| 16S rRNA processing protein RimM [Paenibacillus sp. Y412MC10]
 gi|328936247|gb|EGG32699.1| 16S rRNA processing protein RimM [Paenibacillus sp. HGF5]
          Length = 173

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 31/173 (17%), Positives = 65/173 (37%), Gaps = 10/173 (5%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR------YVLYSNDNRELRILKMYRKNK 58
           +KL  +  I  THG+ GEV +  + +              V    +  E+ +        
Sbjct: 3   EKLYTVGKIVNTHGIRGEVKVMPHTDFADQRFAAKSKLYIVPDKGNKIEVTVETSRFHKN 62

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETF--DRQGKYW 116
            ++  F  +  I+ A + +   L         EEL E+E++  ++   +    +   +  
Sbjct: 63  MYVLKFKELHGINEAEKYKGSLLKITEDL--QEELPENEYYFHEIIGCKVMTDEEPAEEL 120

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           G +  +   GA  +  +K    K  L+P     VL+V+ +   + +  +   L
Sbjct: 121 GTISEILTPGANDVWVVKTPKGKEILLPAIPDVVLDVDKESKLVRVHLMEGLL 173


>gi|296330817|ref|ZP_06873292.1| 16S rRNA-processing protein RimM [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305674335|ref|YP_003866007.1| 16S rRNA-processing protein RimM [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|296151822|gb|EFG92696.1| 16S rRNA-processing protein RimM [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305412579|gb|ADM37698.1| 16S rRNA-processing protein RimM [Bacillus subtilis subsp.
           spizizenii str. W23]
          Length = 174

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 38/178 (21%), Positives = 77/178 (43%), Gaps = 11/178 (6%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-------YVLYSNDNRELRILKM 53
           M K  +   +  I  THG+ GEV + S  +   +  +       ++  SN+  E+ +   
Sbjct: 1   MTK--RWFNVGKIVNTHGIKGEVRVISKTDFAEERYKPGNTLYLFMDGSNEPVEVTVNTH 58

Query: 54  YRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQG 113
               +  +  F    +++   +L++  +    +D    EL E EF+  ++   E F   G
Sbjct: 59  RLHKQFHLLQFKERQSLNEVEKLKNAIIKVPEEDL--GELNEGEFYFHEIIGCEVFTEDG 116

Query: 114 KYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN 171
           +  G+V  +   GA  +  I    +K  LIP+ +  V  +++ E KI I+ +   ++ 
Sbjct: 117 ELIGKVKEILTPGANDVWVIGRKGKKDALIPYIESVVKYIDVSEKKIEIELMEGLIDE 174


>gi|307634723|gb|ADI83484.2| 16S rRNA processing protein RimM [Geobacter sulfurreducens KN400]
          Length = 172

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 36/174 (20%), Positives = 77/174 (44%), Gaps = 8/174 (4%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRIL-----KMYRK 56
           ++ D L L+  I TTHG+ G++ + S++     +          ++ R+      +    
Sbjct: 1   MRQDDLKLLGKIVTTHGIRGQLKVASFSGEFDTILSLETVVLKGKDGRMETFPVARATVH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           + R + + +   NI+    L   +LYA R  F    LEE E++  DL  ++     G   
Sbjct: 61  HDRVLLSLTPFTNINEVLHLIGCELYAHRDQFPP--LEEGEYYWCDLIGLQVVTAAGTVI 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           G++  +    +  +  ++    + +LIP  +  V++V+L+   + + P    L+
Sbjct: 119 GRLDSILPTESHDVYVVRGAD-REYLIPAVEDVVVQVDLEAGTMTVSPPEGLLD 171


>gi|16761528|ref|NP_457145.1| 16S rRNA-processing protein RimM [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|16765990|ref|NP_461605.1| 16S rRNA-processing protein RimM [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|29142999|ref|NP_806341.1| 16S rRNA-processing protein RimM [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|56414640|ref|YP_151715.1| 16S rRNA-processing protein RimM [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|161615607|ref|YP_001589572.1| 16S rRNA-processing protein RimM [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|197363567|ref|YP_002143204.1| 16S rRNA-processing protein RimM [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|207858023|ref|YP_002244674.1| 16S rRNA-processing protein RimM [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|213419596|ref|ZP_03352662.1| 16S rRNA-processing protein [Salmonella enterica subsp. enterica
           serovar Typhi str. E01-6750]
 gi|213581512|ref|ZP_03363338.1| 16S rRNA-processing protein [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-0664]
 gi|213622615|ref|ZP_03375398.1| 16S rRNA-processing protein [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-2068]
 gi|213647493|ref|ZP_03377546.1| 16S rRNA-processing protein [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
 gi|238909518|ref|ZP_04653355.1| 16S rRNA-processing protein [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
 gi|289824173|ref|ZP_06543768.1| 16S rRNA-processing protein RimM [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-3139]
 gi|61230458|sp|P0A2B5|RIMM_SALTY RecName: Full=Ribosome maturation factor rimM
 gi|61230463|sp|P0A2B6|RIMM_SALTI RecName: Full=Ribosome maturation factor rimM
 gi|67461314|sp|Q5PFF7|RIMM_SALPA RecName: Full=Ribosome maturation factor rimM
 gi|189040851|sp|A9MZ50|RIMM_SALPB RecName: Full=Ribosome maturation factor rimM
 gi|238689950|sp|B5BE93|RIMM_SALPK RecName: Full=Ribosome maturation factor rimM
 gi|238690393|sp|B5QUG3|RIMM_SALEP RecName: Full=Ribosome maturation factor rimM
 gi|25364905|pir||AG0833 16S rRNA processing protein [imported] - Salmonella enterica subsp.
           enterica serovar Typhi (strain CT18)
 gi|16421221|gb|AAL21564.1| 16S rRNA processing protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|16503829|emb|CAD05854.1| 16S rRNA processing protein [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29138632|gb|AAO70201.1| 16S rRNA processing protein [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56128897|gb|AAV78403.1| 16S rRNA processing protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|161364971|gb|ABX68739.1| hypothetical protein SPAB_03388 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|197095044|emb|CAR60590.1| 16S rRNA processing protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|206709826|emb|CAR34178.1| 16S rRNA processing protein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|261247867|emb|CBG25696.1| 16S rRNA processing protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267994817|gb|ACY89702.1| 16S rRNA-processing protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|301159235|emb|CBW18750.1| 16S rRNA processing protein rimM. Probable 16S rRNA processing
           protein rimM [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312913698|dbj|BAJ37672.1| 16S rRNA-processing protein RimM [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|320087153|emb|CBY96920.1| Ribosome maturation factor rimM [Salmonella enterica subsp.
           enterica serovar Weltevreden str. 2007-60-3289-1]
 gi|322621458|gb|EFY18311.1| 16S rRNA-processing protein RimM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322624319|gb|EFY21152.1| 16S rRNA-processing protein RimM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322629382|gb|EFY26160.1| 16S rRNA-processing protein RimM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322633622|gb|EFY30364.1| 16S rRNA-processing protein RimM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322638335|gb|EFY35033.1| 16S rRNA-processing protein RimM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322639773|gb|EFY36456.1| 16S rRNA-processing protein RimM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322647365|gb|EFY43861.1| 16S rRNA-processing protein RimM [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322650465|gb|EFY46875.1| 16S rRNA-processing protein RimM [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322656042|gb|EFY52342.1| 16S rRNA-processing protein RimM [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322661436|gb|EFY57661.1| 16S rRNA-processing protein RimM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322667009|gb|EFY63184.1| 16S rRNA-processing protein RimM [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322671378|gb|EFY67501.1| 16S rRNA-processing protein RimM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322677615|gb|EFY73678.1| 16S rRNA-processing protein RimM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322681559|gb|EFY77589.1| 16S rRNA-processing protein RimM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322683959|gb|EFY79969.1| 16S rRNA-processing protein RimM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|323195528|gb|EFZ80706.1| 16S rRNA-processing protein RimM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323197901|gb|EFZ83024.1| 16S rRNA-processing protein RimM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323203079|gb|EFZ88111.1| 16S rRNA-processing protein RimM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323205320|gb|EFZ90295.1| 16S rRNA-processing protein RimM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323210530|gb|EFZ95414.1| 16S rRNA-processing protein RimM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323218189|gb|EGA02901.1| 16S rRNA-processing protein RimM [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323223765|gb|EGA08070.1| 16S rRNA-processing protein RimM [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323230952|gb|EGA15070.1| 16S rRNA-processing protein RimM [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323238735|gb|EGA22785.1| 16S rRNA-processing protein RimM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323241435|gb|EGA25466.1| 16S rRNA-processing protein RimM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323246868|gb|EGA30835.1| 16S rRNA-processing protein RimM [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323260464|gb|EGA44075.1| 16S rRNA-processing protein RimM [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323264479|gb|EGA47985.1| 16S rRNA-processing protein RimM [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|326624441|gb|EGE30786.1| 16S rRNA processing protein RimM [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
 gi|332989599|gb|AEF08582.1| 16S rRNA-processing protein RimM [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 182

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 32/172 (18%), Positives = 74/172 (43%), Gaps = 12/172 (6%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRFI 61
           + V++  +G+++G+ G + + S   +   +  Y  +        +++++      N+  I
Sbjct: 12  EPVVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQQVQLESWKHHNQDLI 71

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               G+D+  +A+ L + ++           LEE +++  DL   +    +G   G+V  
Sbjct: 72  IKLKGVDDRDAANLLTNCEIVVDSSQLPA--LEEGDYYWKDLMGCQVVTAEGYDLGKVID 129

Query: 122 VYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILIDPIAA 167
           +   G+  +L IK  ++     K  L+PF     + +V+L    I +D    
Sbjct: 130 MMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLATRTIEVDWDPG 181


>gi|240851323|ref|YP_002972726.1| 16S rRNA processing protein RimM [Bartonella grahamii as4aup]
 gi|240268446|gb|ACS52034.1| 16S rRNA processing protein RimM [Bartonella grahamii as4aup]
          Length = 185

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 62/178 (34%), Positives = 98/178 (55%), Gaps = 2/178 (1%)

Query: 3   KLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND-NRELRILKMYRKNKRFI 61
           KL   V +A IG  HG+ G+V++   +  P     Y    +D  R   I+ +  +  + I
Sbjct: 7   KLKNKVYLAIIGMPHGIKGDVFVKILSAEPQRFKSYSTLYDDMGRSYEIVTLRIQKNKAI 66

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
             F G++N + A  L+ ++LY  R    D+ L+EDEF+  DL  +   D  GK  G+VCG
Sbjct: 67  VRFKGVENRNVAESLKGIRLYVMRDQLIDD-LDEDEFYQVDLIGLRVQDCGGKVVGEVCG 125

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQY 179
            +NFGAG +LEI+    K  LIPF+K AV E+ +    +++DP+AAGL++    + + 
Sbjct: 126 FFNFGAGDLLEIRLNTSKRVLIPFSKVAVPEICMDSGFLVVDPMAAGLSDGGDNDKKE 183


>gi|293374722|ref|ZP_06621030.1| 16S rRNA processing protein RimM [Turicibacter sanguinis PC909]
 gi|292646636|gb|EFF64638.1| 16S rRNA processing protein RimM [Turicibacter sanguinis PC909]
          Length = 168

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 30/169 (17%), Positives = 76/169 (44%), Gaps = 7/169 (4%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-----YVLYSNDNRELRILKMYRKNKRF 60
           + + +  I  TH L GEV + S ++   +  +     ++ ++ +  E+ +          
Sbjct: 2   EFLQVGKIVNTHALQGEVKVVSNSDFKEERFKKGSQLFIEFNGEYIEVIVATHREHKGAD 61

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +  F  +++I+   + +   L    ++  D  L+E+EF+  ++         G+  G++ 
Sbjct: 62  LLKFKHLNSINDVEKYKGCDLLVSAENLDD--LDENEFYYFEIIGCTVKATTGEEIGEIT 119

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
            +   GA  +  +K   +K  LIP+ +  V  V+++  +++I+ +   L
Sbjct: 120 EILETGANDVWVVKRKGQKDALIPYIEDVVKSVDVEAKEVIIEVLEGLL 168


>gi|163839830|ref|YP_001624235.1| 16S rRNA-processing protein RimM [Renibacterium salmoninarum ATCC
           33209]
 gi|162953306|gb|ABY22821.1| 16S rRNA processing protein [Renibacterium salmoninarum ATCC 33209]
          Length = 201

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 33/174 (18%), Positives = 63/174 (36%), Gaps = 5/174 (2%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNR----YVLYSNDNRELRILKMYRKNKRFIAT 63
           V +  IG  HG+ GEV ++   + P +       +         L +          +  
Sbjct: 29  VHVGRIGKPHGIRGEVTVEVLTDTPQERFSAGAVFSTEPTSAGPLTVETARWNKDILLLG 88

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F  +++ + A  LR  +L  +      +E E D ++  +L  +E      +  G+V  + 
Sbjct: 89  FEEVNDRNRAETLRGTRLIFETDSVASDESESDSWYEHELIGLEA-RVGDQTVGKVSALN 147

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNP 177
              A  +L I     +  L+PF    V EV++    I + P     +       
Sbjct: 148 PMPAQDLLVITTAAGEEVLVPFVAEIVPEVDIAAGFIRLVPPGGLFDINRKDAE 201


>gi|260886931|ref|ZP_05898194.1| 16S rRNA processing protein RimM [Selenomonas sputigena ATCC 35185]
 gi|260862993|gb|EEX77493.1| 16S rRNA processing protein RimM [Selenomonas sputigena ATCC 35185]
          Length = 169

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 36/166 (21%), Positives = 66/166 (39%), Gaps = 2/166 (1%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIATF 64
           D  V++   G  HGL GEV +    + P             R   +  ++   +  + T 
Sbjct: 3   DGRVVIGKAGAPHGLRGEVRVIPLTDFPERFESLREVFIGERVFHVEHVHYHRQFVLLTL 62

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
           +   +  +A++L    L   R+D     L E EF+  D+  +   D  G+  G+V  V  
Sbjct: 63  AECTSREAAAKLTGELLRVARED--AAPLAEGEFYTFDIIGLAVLDMAGERLGEVTNVLK 120

Query: 125 FGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
            G+  +  +K T     L+P  K  V E+++    + +D      +
Sbjct: 121 TGSNDVYVVKKTDGAELLVPALKKVVREIDIAGGFLRVDLQEELED 166


>gi|260881183|ref|ZP_05893339.1| 16S rRNA processing protein RimM [Mitsuokella multacida DSM 20544]
 gi|260849730|gb|EEX69737.1| 16S rRNA processing protein RimM [Mitsuokella multacida DSM 20544]
          Length = 180

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 32/163 (19%), Positives = 58/163 (35%), Gaps = 2/163 (1%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIATF 64
              V +  +G  HG++GE+ I    +              +  L I       +  +  F
Sbjct: 15  KDRVTIGKVGAAHGIHGEMRIIPLTDFTERFADMKEVMVGDELLHIESCKYHKQFILLKF 74

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
                   A  L    L   R +     LEE EF+  D+  +  +D  G   G V  V  
Sbjct: 75  REYPVREDAMRLTGRLLTVDRSE--AVPLEEGEFYTFDIIGLTVYDETGNTLGTVENVLR 132

Query: 125 FGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAA 167
            G+  + + +    +  LIP  K  V  +++   ++++D    
Sbjct: 133 TGSNDVYQARRPDGRELLIPALKAVVKVIDVAGGRMVVDLPEE 175


>gi|194466486|ref|ZP_03072473.1| 16S rRNA processing protein RimM [Lactobacillus reuteri 100-23]
 gi|227544360|ref|ZP_03974409.1| 16S rRNA processing protein RimM [Lactobacillus reuteri CF48-3A]
 gi|300909779|ref|ZP_07127240.1| 16S rRNA processing protein RimM [Lactobacillus reuteri SD2112]
 gi|194453522|gb|EDX42419.1| 16S rRNA processing protein RimM [Lactobacillus reuteri 100-23]
 gi|227185623|gb|EEI65694.1| 16S rRNA processing protein RimM [Lactobacillus reuteri CF48-3A]
 gi|300893644|gb|EFK87003.1| 16S rRNA processing protein RimM [Lactobacillus reuteri SD2112]
          Length = 168

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 31/168 (18%), Positives = 72/168 (42%), Gaps = 7/168 (4%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-----YVLYSNDNRELRILKMYRKNKRF 60
           +   +  I  THG+ GEV + +  +   +        Y+  S +   L I    +     
Sbjct: 2   EYYNVGKIVNTHGVRGEVRVLATTDFIDERFAKGNTLYLQQSGEPLPLTIESTRQHKGFV 61

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +  F G DNI+   + RD +L     D   + L++ +++   +  ++     G++ G++ 
Sbjct: 62  LVKFVGYDNINDVEQFRDHELMVSADD--QQPLDDGQYYYHQIIGLDVETTDGRHLGKIK 119

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAG 168
            + + GA  +  ++   ++  L+P     V  V+L +N + ++ +   
Sbjct: 120 EILSPGANDVWVVERPEKRDLLLPVIDDVVKNVDLDKNLVTVELMEGL 167


>gi|157960878|ref|YP_001500912.1| 16S rRNA-processing protein RimM [Shewanella pealeana ATCC 700345]
 gi|189040854|sp|A8H1E0|RIMM_SHEPA RecName: Full=Ribosome maturation factor rimM
 gi|157845878|gb|ABV86377.1| 16S rRNA processing protein RimM [Shewanella pealeana ATCC 700345]
          Length = 176

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 39/173 (22%), Positives = 78/173 (45%), Gaps = 12/173 (6%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRK 56
           M    + V++  IG+++G+ G + I +Y ++   +  Y  +      + RE+++ +   +
Sbjct: 1   MSSKQEPVILGKIGSSYGIKGWLKITTYTDSVEGIFDYSPWLIKEQGEWREVKVAQWRFQ 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
            K  +A   G+     A  L + ++       +D  L EDEF+  DL   E  + +G   
Sbjct: 61  GKAVVACLEGVSTRDEAQALTNCEIAVPADQMQD--LPEDEFYWRDLIGCEVINTKGYNM 118

Query: 117 GQVCGVYNFGAGSILEIKNT-----MEKTFLIPFT-KFAVLEVNLQENKILID 163
           G V  +   G+  +L +K        +   +IPF     + +V+L   +IL+D
Sbjct: 119 GTVQEIVETGSNDVLLVKANAKDGFGKAERMIPFVTDQFIQKVDLAAKQILVD 171


>gi|37521074|ref|NP_924451.1| 16S rRNA-processing protein RimM [Gloeobacter violaceus PCC 7421]
 gi|46577644|sp|Q7NKH3|RIMM_GLOVI RecName: Full=Ribosome maturation factor rimM
 gi|35212070|dbj|BAC89446.1| gll1505 [Gloeobacter violaceus PCC 7421]
          Length = 181

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 38/184 (20%), Positives = 73/184 (39%), Gaps = 11/184 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-----YVLYSNDNRELRILKMY--RK 56
           + + + +  +    GL GEV +    +    L R          +D R  R+        
Sbjct: 1   MQQWLEIGKVVAAQGLRGEVRVQPATDFAERLTRPGARLVGRSLDDGRVFRLQSGRAIPG 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQ-GKY 115
              F+  F G++  ++A +L    L+    +     L   EF+  DL  +  F +  G+ 
Sbjct: 61  KDLFVCRFEGVEERNAAEKLVGSTLWIGAAERP--VLAAGEFWLPDLMGVRVFRQDTGEA 118

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMK 175
            G+V  +   G   +L I+ +  KT ++PF    V  V+L+  +I +  I   L+    +
Sbjct: 119 IGEVSDMTRAG-NDLLVIRLSGGKTVMVPFVHALVPVVDLEAGRIEVVAIPGLLDPEAAE 177

Query: 176 NPQY 179
             + 
Sbjct: 178 ADEA 181


>gi|315502433|ref|YP_004081320.1| 16S rRNA processing protein rimm [Micromonospora sp. L5]
 gi|315409052|gb|ADU07169.1| 16S rRNA processing protein RimM [Micromonospora sp. L5]
          Length = 179

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 40/178 (22%), Positives = 71/178 (39%), Gaps = 15/178 (8%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNR-----------YVLYSNDNR---ELRILK 52
           L+++  IG  HG+ GEV ++   + P                        R    L +  
Sbjct: 2   LLVVGRIGKPHGIRGEVTVEVRTDEPEARFAPGSVLTTEPGVVPSEPGAWRVPPTLTVES 61

Query: 53  MYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQ 112
                 R +  F G+     A  LR+  L     D    E + +EF +  L  +    R 
Sbjct: 62  ARWHQGRLLVAFEGVLERDVAEALRNTLLGVDSADVAPPE-DPEEFHDHQLVGLTVVTRD 120

Query: 113 GKYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           G++ G+V  + +  A  +L ++    +T L+PF K  V EV+L   ++++D     L+
Sbjct: 121 GEHVGEVARIDHAPASDMLVLRRPEGRTALVPFVKAIVPEVDLAGGRVVVDLPGGLLD 178


>gi|85712461|ref|ZP_01043510.1| RimM [Idiomarina baltica OS145]
 gi|85693739|gb|EAQ31688.1| RimM [Idiomarina baltica OS145]
          Length = 181

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 42/181 (23%), Positives = 78/181 (43%), Gaps = 17/181 (9%)

Query: 1   MVKL-DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRE--------LRIL 51
           M K     +++  IG  +G+ G + I S+  NP D+  Y  ++             + ++
Sbjct: 1   MTKQTSDALVVGHIGAVYGVKGWLKIQSFTENPEDIFDYTPWTLQGNAARQTTEEVINVV 60

Query: 52  KMYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDR 111
           +  R N   IA   GI++   A+    L +    +   +  L +DEF+  DL  +   ++
Sbjct: 61  QWRRHNNGLIAQLEGINDRELAATKTGLSICINAEKLPE--LADDEFYWRDLIGLRVVNK 118

Query: 112 QGKYWGQVCGVYNFGAGSILEIKNT-----MEKTFLIPFTK-FAVLEVNLQENKILIDPI 165
           QG   G V  +    A  +L +         +   LIPF +   VL+V+ ++ +I +D  
Sbjct: 119 QGYDMGVVEQIMPTAANDVLVVTANSNDAFGKSERLIPFVQSQYVLDVDNEKQQIQVDWP 178

Query: 166 A 166
           A
Sbjct: 179 A 179


>gi|254382008|ref|ZP_04997370.1| 16S rRNA processing protein [Streptomyces sp. Mg1]
 gi|194340915|gb|EDX21881.1| 16S rRNA processing protein [Streptomyces sp. Mg1]
          Length = 196

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 38/178 (21%), Positives = 79/178 (44%), Gaps = 5/178 (2%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPI-DLNRYVLYSNDN---RELRILKMYRKNKRFIAT 63
           +++A IG  HG+ GEV ++   + P   L    +   +      L I      + R +  
Sbjct: 3   LVVARIGRAHGIKGEVTVEVRTDEPELRLGPGAVLETEPASAGPLTIETGRVHSGRLLLR 62

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F G+ +   A  LR++ L A+    +  E EEDE+++  L +++     G   G++  + 
Sbjct: 63  FEGVKDRTGAEALRNILLIAEVDPTELPE-EEDEYYDHQLMDLDVVLEDGTEIGRITEIS 121

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQYDC 181
           +  +  +  ++       +IPF +  V E++L+E + +I P    +++        D 
Sbjct: 122 HLPSQDLFIVERPDGTEVMIPFVEEIVAEIDLEEQRCVITPPPGLIDDRAEIASARDA 179


>gi|51892607|ref|YP_075298.1| 16S rRNA processing protein [Symbiobacterium thermophilum IAM
           14863]
 gi|59798669|sp|Q67PD9|RIMM_SYMTH RecName: Full=Ribosome maturation factor rimM
 gi|51856296|dbj|BAD40454.1| 16S rRNA processing protein [Symbiobacterium thermophilum IAM
           14863]
          Length = 174

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 36/169 (21%), Positives = 71/169 (42%), Gaps = 5/169 (2%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDL--NRYVLYSNDNRELRILKMYRKNKRFIAT 63
            L+ +  +   HG+ G V +    + P      + V+    +R +            I  
Sbjct: 8   DLIRIGQVTAPHGVRGAVRVYPTTDFPERFVTLKRVMIDGPDRAVGARFRGFVKNLVILE 67

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
             GI + + A  LR   L   R++     L E  +++ D+  +E  D  G+  G+V  V 
Sbjct: 68  LEGITDRNQAERLRGADLLVPREE--VHPLPEGYYYDFDIIGIEVVDPDGRQLGRVVEVD 125

Query: 124 NF-GAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN 171
           +      +  ++    K +L+P  +  V E++L+  +++IDPI   L +
Sbjct: 126 HTSPVHDLYVVETAPGKRYLVPAVRRFVKEIDLETGRMVIDPIPGLLED 174


>gi|314933417|ref|ZP_07840782.1| 16S rRNA processing protein RimM [Staphylococcus caprae C87]
 gi|313653567|gb|EFS17324.1| 16S rRNA processing protein RimM [Staphylococcus caprae C87]
          Length = 167

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 41/168 (24%), Positives = 81/168 (48%), Gaps = 8/168 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNR-----YVLYSNDNRELRILKMYRKNKRFIA 62
           V +  I  THG+ GE+ + S ++      +      V ++N++ +  +          + 
Sbjct: 3   VEVGQIVNTHGIKGEIKVKSNSDFTETRFQPGENLIVKHNNEDLQYTVSSYRIHKGFHML 62

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F GI+NI+    L+   LY +R   +D EL+E E++ +D+     FD      G+V  +
Sbjct: 63  KFEGINNINDIEHLKGDYLYQERDH-EDIELDEHEYYYSDIIGCTVFDDTDTPIGRVINI 121

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           +  GA  +  +K   +K +LIP+ +  V +++++   I I P+   L+
Sbjct: 122 FETGANDVWVVK--GDKEYLIPYIEDVVKDIDVEGKSIKITPMEGLLD 167


>gi|157374299|ref|YP_001472899.1| 16S rRNA-processing protein [Shewanella sediminis HAW-EB3]
 gi|189040855|sp|A8FSE8|RIMM_SHESH RecName: Full=Ribosome maturation factor rimM
 gi|157316673|gb|ABV35771.1| 16S rRNA processing protein RimM [Shewanella sediminis HAW-EB3]
          Length = 176

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 41/173 (23%), Positives = 83/173 (47%), Gaps = 12/173 (6%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRK 56
           M    + V++  +G++HG+ G + I +Y ++   +  Y  +      + RE+++L+   +
Sbjct: 1   MSSKQEPVVLGKLGSSHGIKGWLKITTYTDSVEGIFDYSPWLIKEQGEWREVKVLQWRFQ 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
            K  +A   G++    A  L + ++    +    + L EDEF+  DL   E  + +G   
Sbjct: 61  GKAVVACLEGVETREHAQMLTNCEIAVTPEQM--DTLPEDEFYWRDLIGCEVMNTKGYNM 118

Query: 117 GQVCGVYNFGAGSILEIKNT-----MEKTFLIPFT-KFAVLEVNLQENKILID 163
           G+V  +   G+  +L +K        +   +IPF  +  ++EVNL E +I +D
Sbjct: 119 GKVQEIVETGSNDVLLVKANAKDGFGKAERMIPFVTEQFIIEVNLTEKQITVD 171


>gi|319404834|emb|CBI78435.1| Ribosome maturation factor rimM [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 171

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 55/172 (31%), Positives = 94/172 (54%), Gaps = 3/172 (1%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND-NRELRILKMYRKNKRFIA 62
           + K V +A IG  HG+ G+V +   ++NP  L  Y ++ ++  R   ++    +    I 
Sbjct: 1   MKKKVYLAIIGAAHGIKGDVVVKVLSSNPESLKSYSVFYDETERSYEVVSFRMQKNNAII 60

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F GI+   +A  LR +KLY +R    D+ L+EDEF+  DL  +  ++   ++ G+V G 
Sbjct: 61  HFKGIEERSAAESLRGIKLYVERNQLADD-LDEDEFYQIDLIGLCVYNCAKQFLGKVSGF 119

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPI-AAGLNNTT 173
           +NFGAG ++EI+    K  LI F+K AV E+ +    +++DPI A   ++  
Sbjct: 120 FNFGAGDLIEIQLVSGKKVLISFSKAAVPEICVASGFLIVDPIAAGLFHDQE 171


>gi|319401470|gb|EFV89680.1| 16S rRNA processing protein RimM [Staphylococcus epidermidis
           FRI909]
          Length = 167

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 41/168 (24%), Positives = 76/168 (45%), Gaps = 8/168 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNR-----YVLYSNDNRELRILKMYRKNKRFIA 62
           V +  I  THG+ GEV + S ++      +      V ++N      +          + 
Sbjct: 3   VEVGQIVNTHGIKGEVKVKSNSDFTETRFQPGEQLLVKHNNTEIVYTVDSYRIHKGFHML 62

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F GI+NI+    L+   +Y +R   +D EL E E++ +D+     F       G+V  +
Sbjct: 63  RFEGINNINEIEHLKGDYIYQERDH-QDIELGEHEYYYSDIIGCTVFKDDDTPIGRVINI 121

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           +  GA  +  +K   EK +LIP+ +  V +++++   I I P+   L+
Sbjct: 122 FETGANDVWVVK--GEKEYLIPYIEDVVKDIDIENKTIKITPMEGLLD 167


>gi|90109245|pdb|2F1L|A Chain A, Crystal Structure Of A Putative 16s Ribosomal Rna
           Processing Protein Rimm (Pa3744) From Pseudomonas
           Aeruginosa At 2.46 A Resolution
          Length = 187

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 36/167 (21%), Positives = 74/167 (44%), Gaps = 10/167 (5%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRKNKRF 60
           D LV++  I + +G+ GEV + S+ +   +L  Y  +      + R+  +++     K  
Sbjct: 18  DDLVVIGKIVSVYGIRGEVKVYSFTDPLDNLLDYRRWTLRRDGEIRQAELVRGRLHGKVL 77

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
            A   G+D+   A      ++   R +     LEE E++   LE ++  D+  +  G + 
Sbjct: 78  AAKLKGLDDREEARTFTGYEICIPRSELPS--LEEGEYYWHQLEGLKVIDQGRQLLGVID 135

Query: 121 GVYNFGAGSILEIKNT----MEKTFLIPFTKFAVLEVNLQENKILID 163
            +   GA  +  +K       ++  L+P+T   VL ++L   +  +D
Sbjct: 136 HLLETGANDVXVVKPCAGSLDDRERLLPYTGQCVLSIDLAAGEXRVD 182


>gi|271963365|ref|YP_003337561.1| 16S rRNA processing protein RimM [Streptosporangium roseum DSM
           43021]
 gi|270506540|gb|ACZ84818.1| 16S rRNA processing protein RimM [Streptosporangium roseum DSM
           43021]
          Length = 171

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 34/170 (20%), Positives = 68/170 (40%), Gaps = 7/170 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNR----YVLYSNDNRELRILKMYRKNKRFIAT 63
           +++  IG  HGL G+V ++   ++P                   L I      +   +  
Sbjct: 3   LVIGRIGRPHGLRGDVSVEVRTDDPERRFAPGTAVATDPASAGPLVIESRRWHSGVLLVR 62

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F G+++ + A +LR   L     D    +  ++ F++  L  +      G+  G+V  V 
Sbjct: 63  FEGVNDRNRAEDLRGTTLVIDSADIPPSDDPDE-FYDHQLIGLAVLTPDGERVGEVSDVL 121

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTT 173
           + G   +L ++        +PF K  V  V+L +  +++D  A  L+   
Sbjct: 122 HHG-QDLLVVRR-GGAEVYVPFVKALVPVVDLDKGVLVVDGPAGLLDPDE 169


>gi|226325146|ref|ZP_03800664.1| hypothetical protein COPCOM_02938 [Coprococcus comes ATCC 27758]
 gi|225206494|gb|EEG88848.1| hypothetical protein COPCOM_02938 [Coprococcus comes ATCC 27758]
          Length = 170

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 38/172 (22%), Positives = 75/172 (43%), Gaps = 6/172 (3%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNR----ELRILKMYRKN 57
           ++ +  + +  I +THG+ GEV +    ++P           D       L I  +    
Sbjct: 1   MQQNDYLQVGVITSTHGIKGEVKVFPTTDDPNRFRALKDVVLDTGKEQIPLEIEGVKFFK 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
           +  I  F GIDNI+   + R + L   R++    ELEEDE++  D+  M+ +   G+ +G
Sbjct: 61  QYVILKFKGIDNINDIEKYRKMPLLVSREN--AVELEEDEYYMADIIGMDVYTEDGEKFG 118

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
            +  +   GA  +  +        L+P     +L+V+ +  K+ +  +   +
Sbjct: 119 VLEDIMETGANDVYVVSTEAHTEVLLPAIHDCILDVDTENRKMTVHLMDGLI 170


>gi|27467832|ref|NP_764469.1| rimM protein [Staphylococcus epidermidis ATCC 12228]
 gi|251810669|ref|ZP_04825142.1| 16S rRNA processing protein [Staphylococcus epidermidis
           BCM-HMP0060]
 gi|282876329|ref|ZP_06285196.1| 16S rRNA processing protein RimM [Staphylococcus epidermidis SK135]
 gi|293366796|ref|ZP_06613472.1| 16S rRNA processing protein RimM [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|33301521|sp|Q8CPH7|RIMM_STAES RecName: Full=Ribosome maturation factor rimM
 gi|27315377|gb|AAO04511.1|AE016747_8 rimM protein [Staphylococcus epidermidis ATCC 12228]
 gi|251805829|gb|EES58486.1| 16S rRNA processing protein [Staphylococcus epidermidis
           BCM-HMP0060]
 gi|281295354|gb|EFA87881.1| 16S rRNA processing protein RimM [Staphylococcus epidermidis SK135]
 gi|291319097|gb|EFE59467.1| 16S rRNA processing protein RimM [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|329724354|gb|EGG60866.1| 16S rRNA processing protein RimM [Staphylococcus epidermidis
           VCU144]
 gi|329736333|gb|EGG72605.1| 16S rRNA processing protein RimM [Staphylococcus epidermidis
           VCU028]
 gi|329736626|gb|EGG72892.1| 16S rRNA processing protein RimM [Staphylococcus epidermidis
           VCU045]
          Length = 167

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 41/168 (24%), Positives = 76/168 (45%), Gaps = 8/168 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNR-----YVLYSNDNRELRILKMYRKNKRFIA 62
           V +  I  THG+ GEV + S ++      +      V ++N      +          + 
Sbjct: 3   VEVGQIVNTHGIKGEVKVKSNSDFTETRFQPGEQLLVKHNNTEIVYTVASYRIHKGFHML 62

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F GI+NI+    L+   +Y +R   +D EL E E++ +D+     F       G+V  +
Sbjct: 63  RFEGINNINEIEHLKGDYIYQERDH-QDIELGEHEYYYSDIIGCTVFKDDDTPIGRVINI 121

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           +  GA  +  +K   EK +LIP+ +  V +++++   I I P+   L+
Sbjct: 122 FETGANDVWVVK--GEKEYLIPYIEDVVKDIDIETKTIKITPMEGLLD 167


>gi|289550971|ref|YP_003471875.1| 16S rRNA processing protein RimM [Staphylococcus lugdunensis
           HKU09-01]
 gi|289180503|gb|ADC87748.1| 16S rRNA processing protein RimM [Staphylococcus lugdunensis
           HKU09-01]
          Length = 166

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 43/168 (25%), Positives = 77/168 (45%), Gaps = 9/168 (5%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYV-----LYSNDNRELRILKMYRKNKRFIA 62
           V +  I  THG+ GEV + S+++      +        ++NDN EL +          + 
Sbjct: 3   VEVGQIVNTHGIKGEVKVKSHSDFTDTRFQPGEVLTLKHNNDNVELTVTSYRIHKGFHML 62

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F G DNI+     +   LY +R   +  EL E EF+ +D+     F+      G+V  +
Sbjct: 63  KFEGFDNINDVESYKGDYLYQERDH-EGIELAEHEFYYSDIIGCTVFN-GEIPIGRVTNI 120

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
              GA  +  +K   +K ++IP+    V +V+++   I+I P+   L+
Sbjct: 121 IETGANDVWVVK--GDKEYMIPYIADVVKDVDIENKTIMITPLEGLLD 166


>gi|325685918|gb|EGD27983.1| 16S rRNA processing protein RimM [Lactobacillus delbrueckii subsp.
           lactis DSM 20072]
          Length = 167

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 36/167 (21%), Positives = 76/167 (45%), Gaps = 6/167 (3%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNR---YVLYSNDNRELRILKMYRKNKRFIA 62
               +  I  THGL GEV +    + P D  R    +   +D+RE+ +       + ++ 
Sbjct: 2   NYYNVGKIIATHGLKGEVKVALTTDFPEDRFRAGSRLYLGDDSREVTVAAGRPFKQFWLV 61

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMET-FDRQGKYWGQVCG 121
           TF+ I +I  A +L+  ++    +D    EL +  ++  +L   +   D  G+  G++  
Sbjct: 62  TFAEITDIDQAEKLKGTEILISEED--QGELPDGVYYYRELLGCKVLDDESGEEIGELTD 119

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAG 168
           +   GA  I E+ +   K+F +P+    V  V++ + ++ ++ +   
Sbjct: 120 IEAPGANDIWEVTDENGKSFWLPYIPQVVKSVDIDKKEVRVELMEGL 166


>gi|291086323|ref|ZP_06355423.2| 16S rRNA processing protein RimM [Citrobacter youngae ATCC 29220]
 gi|291068897|gb|EFE07006.1| 16S rRNA processing protein RimM [Citrobacter youngae ATCC 29220]
          Length = 183

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 32/184 (17%), Positives = 74/184 (40%), Gaps = 19/184 (10%)

Query: 1   MVKLD-------KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELR 49
           M+            +++  +G+++G+ G + + S   +   +  Y  +        ++++
Sbjct: 1   MMSKQLAAQAPVDPIVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQQVQ 60

Query: 50  ILKMYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETF 109
           +      N+  I    G+D+  SA+ L + ++           LEE  ++  DL   +  
Sbjct: 61  LESWKHHNQDLIIKLKGVDDRDSANLLTNCEIVVDSSQLPA--LEEGSYYWKDLMGCQVV 118

Query: 110 DRQGKYWGQVCGVYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILID 163
             +G   G+V  +   G+  ++ IK  ++     K  L+PF     + +V+L    I +D
Sbjct: 119 TTEGYDLGKVVDMMETGSNDVIVIKANLKDAFGIKERLVPFLDGQVIKKVDLATRTIEVD 178

Query: 164 PIAA 167
               
Sbjct: 179 WDPG 182


>gi|288957358|ref|YP_003447699.1| 16S rRNA processing protein [Azospirillum sp. B510]
 gi|288909666|dbj|BAI71155.1| 16S rRNA processing protein [Azospirillum sp. B510]
          Length = 192

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 45/187 (24%), Positives = 83/187 (44%), Gaps = 7/187 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDN--RELRILKMYRKNKRFI 61
           +   + +     +HG+ G V + S+   P D+  Y   S++   R   +         F+
Sbjct: 1   MTVKICVGQFAGSHGVRGLVKLRSFTAEPADIATYGPLSDEAGARRFTLTLQGMVKDNFL 60

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
           A   G+ +   A  L  ++L+  R      E +EDEF++ DL  +      G  +G V  
Sbjct: 61  AKVDGVTSREQAQALAGVRLHVDRDALPATE-DEDEFYHADLIGLRAELADGSLYGTVKA 119

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQYDC 181
           +Y+FGAG +LE++       ++PF+K  V  V+++  +I++D  A        +    D 
Sbjct: 120 IYDFGAGDVLEVRTAGGPLEMLPFSKACVPVVDVRGGRIVVDLPAVI----EAREGSGDD 175

Query: 182 PLDSAGK 188
             D  G+
Sbjct: 176 SEDEGGE 182


>gi|54026126|ref|YP_120368.1| 16S rRNA-processing protein RimM [Nocardia farcinica IFM 10152]
 gi|59798616|sp|Q5YS37|RIMM_NOCFA RecName: Full=Ribosome maturation factor rimM
 gi|54017634|dbj|BAD59004.1| putative 16S rRNA processing protein [Nocardia farcinica IFM 10152]
          Length = 174

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 36/173 (20%), Positives = 75/173 (43%), Gaps = 9/173 (5%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNR-------YVLYSNDNRELRILKMYRKNKRF 60
           +++  +  +HG+ GE+ ++   ++P             +  S + RE  +      + R 
Sbjct: 3   LVVGRVAKSHGVRGELVVEVRTDDPDARFAEGTVLRGRLPRSTEVREFTVESAREHSGRL 62

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           + + +G+D+  +A  LR         +    +  ++ F++ +LE +   D  G   G V 
Sbjct: 63  LVSLAGVDDRSAADALRGTLFVVDSAELPPSDDPDE-FYDHELEGLSVRDTAGAVLGTVT 121

Query: 121 GVYNFGAGSILEIKN-TMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNT 172
            V +  AG +L ++     +  LIPF    V  V++ E  ++IDP    L+  
Sbjct: 122 EVLHSAAGELLSMRAAEDGREILIPFVTAIVPTVSVAEGYVVIDPPEGLLDPE 174


>gi|310641517|ref|YP_003946275.1| ribosome maturation factor rimm [Paenibacillus polymyxa SC2]
 gi|309246467|gb|ADO56034.1| Ribosome maturation factor rimM [Paenibacillus polymyxa SC2]
          Length = 171

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 34/173 (19%), Positives = 73/173 (42%), Gaps = 9/173 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLN----RYVLYSNDNR---ELRILKMYRK 56
           + ++  +  I  THG+ GE+ I +  +   D        ++   D +    + +     +
Sbjct: 1   MQQMFNVGKIVNTHGIRGELKILTTTDFLEDRFAKGSELLIVPADGKAPIPVTVETARFQ 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
               +  F    NI+   + +   L    +     ELEE+EF+  ++  ME     G   
Sbjct: 61  KNMVVVKFKEYHNINDVEKYKGTLLKVSAERL--GELEENEFYFHEVVGMEVVTEDGTKL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           G+V  +   GA  +  ++    K  L+P+ +  +L+VN++E ++ +  +   L
Sbjct: 119 GEVKEILTPGANDVWVVQMPKGKELLLPYIEDVILDVNVREKRVTVRLMEGLL 171


>gi|313124063|ref|YP_004034322.1| ribosome maturation factor rimm [Lactobacillus delbrueckii subsp.
           bulgaricus ND02]
 gi|312280626|gb|ADQ61345.1| Ribosome maturation factor rimM [Lactobacillus delbrueckii subsp.
           bulgaricus ND02]
          Length = 167

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 36/167 (21%), Positives = 76/167 (45%), Gaps = 6/167 (3%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNR---YVLYSNDNRELRILKMYRKNKRFIA 62
               +  I  THGL GEV +    + P D  R    +   +D+RE+ +       + ++ 
Sbjct: 2   NYYNVGKIIATHGLKGEVKVALTTDFPEDRFRAGSRLYLGDDSREVTVAAGRPFKQFWLV 61

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMET-FDRQGKYWGQVCG 121
           TF+ I +I  A +L+  ++    +D    EL +  ++  +L   +   D  G+  G++  
Sbjct: 62  TFTEITDIDQAEKLKGTEILISEED--QGELPDGVYYYRELLGCKVLDDESGEEIGELTD 119

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAG 168
           +   GA  I E+ +   K+F +P+    V  V++ + ++ ++ +   
Sbjct: 120 IEAPGANDIWEVTDENGKSFWLPYIPQVVKSVDIDKKEVRVELMEGL 166


>gi|168262153|ref|ZP_02684126.1| 16S rRNA processing protein RimM [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|168464152|ref|ZP_02698069.1| 16S rRNA processing protein RimM [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|194445761|ref|YP_002041938.1| 16S rRNA-processing protein RimM [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194448986|ref|YP_002046680.1| 16S rRNA-processing protein RimM [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194470975|ref|ZP_03076959.1| 16S rRNA processing protein RimM [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194735018|ref|YP_002115685.1| 16S rRNA-processing protein RimM [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197247653|ref|YP_002147611.1| 16S rRNA-processing protein RimM [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197262483|ref|ZP_03162557.1| 16S rRNA processing protein RimM [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|197301201|ref|ZP_03166323.1| 16S rRNA processing protein RimM [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|198245720|ref|YP_002216685.1| 16S rRNA-processing protein RimM [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|200388134|ref|ZP_03214746.1| 16S rRNA processing protein RimM [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|204929602|ref|ZP_03220676.1| 16S rRNA processing protein RimM [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|205357377|ref|ZP_02347273.2| 16S rRNA processing protein RimM [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|205357811|ref|ZP_03223844.1| 16S rRNA processing protein RimM [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205358802|ref|ZP_03224142.1| 16S rRNA processing protein RimM [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|205359386|ref|ZP_03224284.1| 16S rRNA processing protein RimM [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|213424864|ref|ZP_03357614.1| 16S rRNA-processing protein [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
 gi|289806537|ref|ZP_06537166.1| 16S rRNA-processing protein RimM [Salmonella enterica subsp.
           enterica serovar Typhi str. AG3]
 gi|194404424|gb|ACF64646.1| 16S rRNA processing protein RimM [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194407290|gb|ACF67509.1| 16S rRNA processing protein RimM [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194457339|gb|EDX46178.1| 16S rRNA processing protein RimM [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194710520|gb|ACF89741.1| 16S rRNA processing protein RimM [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|195633267|gb|EDX51681.1| 16S rRNA processing protein RimM [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|197211356|gb|ACH48753.1| 16S rRNA processing protein RimM [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197240738|gb|EDY23358.1| 16S rRNA processing protein RimM [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|197287839|gb|EDY27227.1| 16S rRNA processing protein RimM [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|197940236|gb|ACH77569.1| 16S rRNA processing protein RimM [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|199605232|gb|EDZ03777.1| 16S rRNA processing protein RimM [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|204321321|gb|EDZ06521.1| 16S rRNA processing protein RimM [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|205322055|gb|EDZ09894.1| 16S rRNA processing protein RimM [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|205329278|gb|EDZ16042.1| 16S rRNA processing protein RimM [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205331817|gb|EDZ18581.1| 16S rRNA processing protein RimM [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|205336450|gb|EDZ23214.1| 16S rRNA processing protein RimM [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|205349285|gb|EDZ35916.1| 16S rRNA processing protein RimM [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|321223466|gb|EFX48531.1| 16S rRNA processing protein RimM [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
 gi|322614477|gb|EFY11408.1| 16S rRNA-processing protein RimM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322662636|gb|EFY58844.1| 16S rRNA-processing protein RimM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|323131019|gb|ADX18449.1| 16S rRNA processing protein RimM [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
 gi|323221545|gb|EGA05958.1| 16S rRNA-processing protein RimM [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323234696|gb|EGA18782.1| 16S rRNA-processing protein RimM [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323253267|gb|EGA37097.1| 16S rRNA-processing protein RimM [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323257063|gb|EGA40772.1| 16S rRNA-processing protein RimM [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323269614|gb|EGA53067.1| 16S rRNA-processing protein RimM [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
          Length = 183

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 33/184 (17%), Positives = 76/184 (41%), Gaps = 19/184 (10%)

Query: 1   MVKLD-------KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELR 49
           M+          + V++  +G+++G+ G + + S   +   +  Y  +        ++++
Sbjct: 1   MMSKQLAAQVPAEPVVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQQVQ 60

Query: 50  ILKMYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETF 109
           +      N+  I    G+D+  +A+ L + ++           LEE +++  DL   +  
Sbjct: 61  LESWKHHNQDLIIKLKGVDDRDAANLLTNCEIVVDSSQLPA--LEEGDYYWKDLMGCQVV 118

Query: 110 DRQGKYWGQVCGVYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILID 163
             +G   G+V  +   G+  +L IK  ++     K  L+PF     + +V+L    I +D
Sbjct: 119 TAEGYDLGKVIDMMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLATRTIEVD 178

Query: 164 PIAA 167
               
Sbjct: 179 WDPG 182


>gi|254000094|ref|YP_003052157.1| 16S rRNA processing protein RimM [Methylovorus sp. SIP3-4]
 gi|253986773|gb|ACT51630.1| 16S rRNA processing protein RimM [Methylovorus sp. SIP3-4]
          Length = 164

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 37/161 (22%), Positives = 71/161 (44%), Gaps = 6/161 (3%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRKNKRFIA 62
           +V+M  +   +G+ G + I         L  Y  +        +E  +       K  + 
Sbjct: 1   MVVMGRVVAPYGIYGWLKIQPDTETIDSLFDYDNWWLGRDPKWQEYPVEAAKVHGKTLLV 60

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
              GID+  +A   +  ++   R+   +   EE E++ +DL  +   + Q   +G V  V
Sbjct: 61  KLVGIDDRDAAFAAKGKQVSVPREQLPEA--EEGEYYWSDLIGLRVSNLQQVDFGTVVDV 118

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
           +  GA  ++ +K+   +  L+PFT  AV EVN++   +L+D
Sbjct: 119 FETGANDVVVVKDDAGRERLVPFTAEAVPEVNVEAGTMLVD 159


>gi|167856651|ref|ZP_02479344.1| 16S rRNA-processing protein [Haemophilus parasuis 29755]
 gi|167852224|gb|EDS23545.1| 16S rRNA-processing protein [Haemophilus parasuis 29755]
          Length = 175

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 33/165 (20%), Positives = 69/165 (41%), Gaps = 12/165 (7%)

Query: 9   LMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRFIATF 64
           ++  +G+T+G+ G + + S    P  +  Y  +        +++ +      N   I   
Sbjct: 8   VVGKLGSTYGIRGWLRLYSSTEYPESIFDYQPWFLKIKGQWQQVELESWRYHNNDLIVKL 67

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
            G ++  +A  L + ++      F +  LEE +++  DL   +  + +G   G V  +  
Sbjct: 68  KGTEDRETAQLLTNAEIGVDLAVFPE--LEEGDYYWHDLIGCQVLNLEGYAMGTVTEMME 125

Query: 125 FGAGSILEIKNT-----MEKTFLIPFT-KFAVLEVNLQENKILID 163
            G+  +L +K        ++  LIPF  +  V  V+L    I +D
Sbjct: 126 TGSNDVLVVKAGSKDAFGKQERLIPFLYEQVVKRVDLATKTITVD 170


>gi|325840597|ref|ZP_08167078.1| 16S rRNA processing protein RimM [Turicibacter sp. HGF1]
 gi|325490246|gb|EGC92579.1| 16S rRNA processing protein RimM [Turicibacter sp. HGF1]
          Length = 168

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 30/169 (17%), Positives = 76/169 (44%), Gaps = 7/169 (4%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-----YVLYSNDNRELRILKMYRKNKRF 60
           + + +  I  TH L GEV + S ++   +  +     ++ ++ +  E+ +          
Sbjct: 2   EFLQVGKIVNTHALQGEVKVVSNSDFKEERFKKGNQLFIEFNGEYIEVIVATHREHKGAD 61

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +  F  +++I+   + +   L    ++  D  L+E+EF+  ++         G+  G++ 
Sbjct: 62  LLKFKHLNSINDVEKYKGCDLLVSAENLDD--LDENEFYYFEIIGCTVKATTGEEIGEIT 119

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
            +   GA  +  +K   +K  LIP+ +  V  V+++  +++I+ +   L
Sbjct: 120 EILETGANDVWVVKRKGQKDALIPYIEDVVKSVDVEAKEVIIEVLEGLL 168


>gi|170725616|ref|YP_001759642.1| 16S rRNA-processing protein RimM [Shewanella woodyi ATCC 51908]
 gi|238688673|sp|B1KI69|RIMM_SHEWM RecName: Full=Ribosome maturation factor rimM
 gi|169810963|gb|ACA85547.1| 16S rRNA processing protein RimM [Shewanella woodyi ATCC 51908]
          Length = 176

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 44/173 (25%), Positives = 84/173 (48%), Gaps = 12/173 (6%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRK 56
           M    + V++  IG++HG+ G + I +Y  +   +  Y  +      + RE+++ +   +
Sbjct: 1   MSSKQEPVVLGKIGSSHGIKGWLKITTYTESVEGIFDYSPWLIKEQGEWREVKVTQWRFQ 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
            K  +A+  G++    A  L + ++    +  ++  L EDEF+  DL   E  + +G   
Sbjct: 61  GKAVVASLEGVETRDQAQMLTNCEIAVSAEQMQE--LPEDEFYWRDLIGCEVTNTKGYNM 118

Query: 117 GQVCGVYNFGAGSILEIKNT-----MEKTFLIPFT-KFAVLEVNLQENKILID 163
           G+V  +   G+  +L +K        +   +IPF  +  VLEVNL E +IL+D
Sbjct: 119 GKVQEIVETGSNDVLLVKANAKDGFGKAERMIPFVTEQFVLEVNLTEKQILVD 171


>gi|104774247|ref|YP_619227.1| 16S rRNA-processing protein RimM [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC 11842]
 gi|116514337|ref|YP_813243.1| 16S rRNA-processing protein RimM [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC BAA-365]
 gi|122274931|sp|Q049R7|RIMM_LACDB RecName: Full=Ribosome maturation factor rimM
 gi|122397101|sp|Q1G9L3|RIMM_LACDA RecName: Full=Ribosome maturation factor rimM
 gi|103423328|emb|CAI98171.1| 16S rRNA processing protein RimM [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC 11842]
 gi|116093652|gb|ABJ58805.1| 16S rRNA processing protein RimM [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC BAA-365]
 gi|325126033|gb|ADY85363.1| Probable 16S rRNA processing protein rimM [Lactobacillus
           delbrueckii subsp. bulgaricus 2038]
          Length = 167

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 36/167 (21%), Positives = 76/167 (45%), Gaps = 6/167 (3%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNR---YVLYSNDNRELRILKMYRKNKRFIA 62
               +  I  THGL GEV +    + P D  R    +   +D+RE+ +       + ++ 
Sbjct: 2   NYYNVGKIIATHGLKGEVKVALTTDFPEDRFRAGSRLYLGDDSREVTVAAGRPFKQFWLV 61

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMET-FDRQGKYWGQVCG 121
           TF+ I +I  A +L+  ++    +D    EL +  ++  +L   +   D  G+  G++  
Sbjct: 62  TFAEITDIDQAEKLKGTEILISEED--QGELPDGVYYYRELLGCKVLDDESGEEIGELTD 119

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAG 168
           +   GA  I E+ +   K+F +P+    V  V++ + ++ ++ +   
Sbjct: 120 IEAPGANDIWEVTDKNGKSFWLPYIPQVVKSVDIDKKEVRVELMEGL 166


>gi|220922841|ref|YP_002498143.1| 16S rRNA-processing protein RimM [Methylobacterium nodulans ORS
           2060]
 gi|254797756|sp|B8IGW5|RIMM_METNO RecName: Full=Ribosome maturation factor rimM
 gi|219947448|gb|ACL57840.1| 16S rRNA processing protein RimM [Methylobacterium nodulans ORS
           2060]
          Length = 204

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 52/178 (29%), Positives = 81/178 (45%), Gaps = 6/178 (3%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSN-DNRELRILKMYRKNK---RFIA 62
            VL+   G  HGL GEV + SY  +P+ +  Y   +  + R + +  +   +      IA
Sbjct: 27  FVLLGEFGRAHGLQGEVRLKSYTADPMAIGSYGPLTGANGRAIALTALRPASGAPDMLIA 86

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
             SG+    +A  L  L LY +R+     E +EDEFF+ DL  +   D  G   G +  V
Sbjct: 87  RVSGVSGRDAAEALNRLALYVRRECLGAPE-DEDEFFSADLIGLAVVDAAGTRLGTIRAV 145

Query: 123 YNFGAGSILEIKNTMEKTF-LIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQY 179
            N+G G +LEI+ T      L+PFT+  V +V++   ++ IDP               
Sbjct: 146 PNYGGGDLLEIEPTGGGAAALLPFTRAFVPKVDIAAREVTIDPPDDLFAPAKPSPEDE 203


>gi|322418206|ref|YP_004197429.1| 16S rRNA processing protein RimM [Geobacter sp. M18]
 gi|320124593|gb|ADW12153.1| 16S rRNA processing protein RimM [Geobacter sp. M18]
          Length = 172

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 40/174 (22%), Positives = 76/174 (43%), Gaps = 8/174 (4%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS-----NDNRELRILKMYRK 56
           +   K VL+  I   HG+ G++ +  +A +   +++              E  ++     
Sbjct: 1   MSGSKKVLIGKIQGPHGIRGQLRVIPFAGDASSISQLNSVFLKSPKGAMEEYSVVSAKNN 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
            KR I T    DNI+    L   ++YA R    D  L +DEF+ +DL  ++     G+  
Sbjct: 61  GKRIILTLKPFDNINQVLHLVGSEIYADRVALPD--LPDDEFYWSDLLGLQVVTSDGEEL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           G++  +   G+  +  +K+   +  LIP  +  VL V+L E ++ +      L+
Sbjct: 119 GELVDIIETGSNDVYVVKH-NGREVLIPALEDVVLSVDLAEGRMTVSLPEGLLD 171


>gi|331085166|ref|ZP_08334252.1| 16S rRNA processing protein RimM [Lachnospiraceae bacterium
           9_1_43BFAA]
 gi|330407949|gb|EGG87439.1| 16S rRNA processing protein RimM [Lachnospiraceae bacterium
           9_1_43BFAA]
          Length = 189

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 42/169 (24%), Positives = 75/169 (44%), Gaps = 6/169 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNR----ELRILKMYRKNKR 59
           +++   +  I +THG+ GEV +    ++     +      D       L + ++    + 
Sbjct: 22  MEQQFQVGVISSTHGVRGEVKVFPTTDDVKRFKKLKHVLLDTGKEQLPLEVEQVKFFKQF 81

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F GIDNI+   + +   L   R+D    +L++DE+F  D+  M  F   G  +G +
Sbjct: 82  AILKFKGIDNINDIEKYKGKSLLVDRKD--AVKLKKDEYFIADMIGMHVFTEDGAEFGTL 139

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAG 168
             V   GA  +  I  T  K  L+P  K  +L V+++E K+ I  +   
Sbjct: 140 RDVLETGANDVYIIDTTDGKEVLVPAIKQCILNVDIEEQKMTIHLLEGL 188


>gi|225374448|ref|ZP_03751669.1| hypothetical protein ROSEINA2194_00063 [Roseburia inulinivorans DSM
           16841]
 gi|225213686|gb|EEG96040.1| hypothetical protein ROSEINA2194_00063 [Roseburia inulinivorans DSM
           16841]
          Length = 173

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 43/174 (24%), Positives = 80/174 (45%), Gaps = 6/174 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKM---YRKNKR 59
           ++ L+ +  I TTHG+ GEV +    ++P    +   +  +  +EL  L++         
Sbjct: 1   MEDLLQVGVITTTHGVRGEVKVFPTTDDPARFKKLKNVVLDTGKELVDLEVAGVKFFKNM 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F GIDNI+   + R   LY  R++    +L+++E+F  DL  ++    +G+  G++
Sbjct: 61  VIVKFKGIDNINDVEKYRKKSLYVTREN--AVKLKKNEYFIADLIGLQAESDEGEDLGEL 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTT 173
             V   GA  +  +        L+P  K  V EV+L+  KI++  +        
Sbjct: 119 SDVLQTGANDVYVLSKEGTDDILLPAIKECVKEVDLENGKIIVHLLPGLRELNE 172


>gi|172045629|sp|A8ANE1|RIMM_CITK8 RecName: Full=Ribosome maturation factor rimM
          Length = 182

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 30/172 (17%), Positives = 73/172 (42%), Gaps = 12/172 (6%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRFI 61
           + +++  +G+++G+ G + + S   +   +  Y  +        +++++      N+  I
Sbjct: 12  EPIVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQQVQLESWKHHNQDLI 71

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               G+D+  SA+ L + ++           LE+  ++  DL   +    +G   G+V  
Sbjct: 72  IKLKGVDDRDSANLLTNCEIVVDSSQLPA--LEDGSYYWKDLMGCQVVTTEGYDLGKVVD 129

Query: 122 VYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILIDPIAA 167
           +   G+  ++ IK  ++     K  L+PF     + +V+L    I +D    
Sbjct: 130 MMETGSNDVIVIKANLKDAFGIKERLVPFLDGQVIKKVDLATRTIEVDWDPG 181


>gi|283786228|ref|YP_003366093.1| 16S rRNA processing protein [Citrobacter rodentium ICC168]
 gi|282949682|emb|CBG89301.1| 16S rRNA processing protein [Citrobacter rodentium ICC168]
          Length = 182

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 30/172 (17%), Positives = 74/172 (43%), Gaps = 12/172 (6%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRFI 61
             +++  +G+++G+ G + + S   +   +  Y  +        +++++      N+  I
Sbjct: 12  DPIVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQQVQLESWRHHNQDLI 71

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               G+D+  +A+ L + ++          +LEE +++  DL   +    +G   G+V  
Sbjct: 72  IKLKGVDDRDAANLLTNCEIVVDSSQLP--QLEEGDYYWKDLMGCQVVTTEGYDLGKVVD 129

Query: 122 VYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILIDPIAA 167
           +   G+  ++ IK  ++     K  L+PF     + +V+L    I +D    
Sbjct: 130 MMETGSNDVIVIKANLKDAFGIKERLVPFLDGQVIKKVDLTTRTIEVDWDPG 181


>gi|153854840|ref|ZP_01996063.1| hypothetical protein DORLON_02068 [Dorea longicatena DSM 13814]
 gi|149752542|gb|EDM62473.1| hypothetical protein DORLON_02068 [Dorea longicatena DSM 13814]
          Length = 187

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 42/170 (24%), Positives = 76/170 (44%), Gaps = 6/170 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND----NRELRILKMYRKNKR 59
           +++L+ +  I +THG+ GEV +    ++P           D     + L +  +    + 
Sbjct: 20  MEELLQVGVITSTHGVRGEVKVFPTTDDPNRFKSLKHVLLDTGREKKSLEVQGVKFFKQF 79

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F GIDNI+     +   L  +R+D    ELEEDE+F  D+  +E      K +G +
Sbjct: 80  VILKFKGIDNINDIERYKRCPLLVERKD--AVELEEDEYFIADMIGIEVVTEDDKPFGTL 137

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
             V   GA  +  I        L+P  +  +L+V+++  K+ I  +   +
Sbjct: 138 KDVMETGANDVYVIDTDEHGEVLVPAIRECILDVDIENQKMKIHLMDGLI 187


>gi|119470051|ref|ZP_01612856.1| 16S rRNA processing protein [Alteromonadales bacterium TW-7]
 gi|119446761|gb|EAW28034.1| 16S rRNA processing protein [Alteromonadales bacterium TW-7]
          Length = 178

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 34/175 (19%), Positives = 71/175 (40%), Gaps = 12/175 (6%)

Query: 3   KLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRKNK 58
               ++++  +G  +G+ G + + S+ ++P  +  +  +        + L ++   R NK
Sbjct: 5   NTSSIIVVGKLGAPYGIKGWLKVHSFTDDPAGIFDFSPWLIGQQGKWQSLEVVDWRRHNK 64

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
            FIA F+ +++   A      ++        +  L + EF+  DL  M     +G   G 
Sbjct: 65  GFIAKFAQVNDRDEAMAYTHAEISMDATQLPE--LPQGEFYWRDLIGMSVVTDKGYNLGT 122

Query: 119 VCGVYNFGAGSILEIKNTME-----KTFLIPF-TKFAVLEVNLQENKILIDPIAA 167
           V  +   G+  +L +K   +        LIPF T   + +V     +I +D    
Sbjct: 123 VDDLMETGSNDVLVVKANSKDAFGQSERLIPFLTDSVIKDVKYDVKEITVDWDPG 177


>gi|329766863|ref|ZP_08258391.1| 16S rRNA processing protein RimM [Gemella haemolysans M341]
 gi|328837588|gb|EGF87213.1| 16S rRNA processing protein RimM [Gemella haemolysans M341]
          Length = 169

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 43/169 (25%), Positives = 79/169 (46%), Gaps = 8/169 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYV---LYSNDN---RELRILKMYRKNKRFI 61
           + +  I  TH L GEV + S  +            L +  N   +E+ +          +
Sbjct: 3   LKVGKIVNTHSLKGEVKVISSTDFEEQRFEKGTELLITRGNQVVKEVTVESYRTHKNNLL 62

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
             F GID+I  A +L++L++     +    ELEE+EF+  ++   E FD  GK  G++  
Sbjct: 63  VKFVGIDSIEEAEKLKNLQIKIDSDNI--GELEENEFYFHEIIGCEVFDENGKSLGEISE 120

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           +   GA  +  IK+   K  LIP+ +  V +++++  KI I+ +   ++
Sbjct: 121 ILTPGANDVWVIKSQNGKEILIPYIEDIVKKIDVENKKIDIEVMEGLID 169


>gi|253573495|ref|ZP_04850838.1| 16S rRNA processing protein RimM [Paenibacillus sp. oral taxon 786
           str. D14]
 gi|251847023|gb|EES75028.1| 16S rRNA processing protein RimM [Paenibacillus sp. oral taxon 786
           str. D14]
          Length = 172

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 34/172 (19%), Positives = 67/172 (38%), Gaps = 9/172 (5%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-------YVLYSNDNRELRILKMYRKN 57
           D L+ +  I  THG+ GE+ +    + P                + +  E+ +       
Sbjct: 3   DSLLTVGKIVNTHGIRGELRVLLQTDFPEVRFAPKSRLLIVHPETGERLEVTVQSARPYK 62

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
           + +I  F    NI+     +   L   + +    EL E+E++  ++        +G+  G
Sbjct: 63  QMYIVKFVEFSNINDVERFKGRDLKVSKAE--SVELPENEYYFHEIIGCRVVSDEGEELG 120

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           ++  +   GA  +   K    K  L+P     VL+VN++E  I +  +   L
Sbjct: 121 EIVEILRPGANDVWVAKLPNGKQLLLPVIDDVVLDVNVKEKIITVHMMEGLL 172


>gi|297202648|ref|ZP_06920045.1| 16S rRNA processing protein RimM [Streptomyces sviceus ATCC 29083]
 gi|197713223|gb|EDY57257.1| 16S rRNA processing protein RimM [Streptomyces sviceus ATCC 29083]
          Length = 183

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 40/182 (21%), Positives = 80/182 (43%), Gaps = 5/182 (2%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPI-DLNRYVLYSNDN---RELRILKMYRKNKRFIAT 63
           +++A IG  HG+ GEV ++   + P   L    + + D      L I      + R +  
Sbjct: 3   LVVARIGRAHGIKGEVTVEVRTDEPELRLAPGAVLATDPAATGPLTIETGRVHSGRLLLR 62

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F G+ +  +A  LR+  L A+     +   EEDE+++  L +++     G   G++  + 
Sbjct: 63  FEGVRDRTAAEALRNTLLIAEVDPE-ELPEEEDEYYDHQLMDLDVVTEDGVEVGRITEIS 121

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQYDCPL 183
           +  +  +  ++       +IPF +  V E++L E K +I P    +++        D   
Sbjct: 122 HLPSQDLFIVERPDGSEVMIPFVEEIVAEIDLAEQKAVITPPPGLIDDRAEIASSRDSED 181

Query: 184 DS 185
           +S
Sbjct: 182 ES 183


>gi|49476238|ref|YP_034279.1| 16s rRNA processing protein rimM [Bartonella henselae str.
           Houston-1]
 gi|59798261|sp|Q6G1R8|RIMM_BARHE RecName: Full=Ribosome maturation factor rimM
 gi|49239046|emb|CAF28346.1| 16s rRNA processing protein rimM [Bartonella henselae str.
           Houston-1]
          Length = 180

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 63/175 (36%), Positives = 96/175 (54%), Gaps = 2/175 (1%)

Query: 3   KLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND-NRELRILKMYRKNKRFI 61
           KL   V +A IG  HG+ G+V +   ++ P  L  Y    +D      I+ +  + K  I
Sbjct: 7   KLKNKVCLAIIGMPHGIKGDVLLKILSSEPQRLKTYGTLYDDRGHSYEIVMLRMQKKNAI 66

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
             F G+++  +A  LR + LY  R    D+ L EDEF+  DL  +   D  G+  G+V G
Sbjct: 67  VHFKGVEDRSAAEALRGIHLYVARDQLVDD-LTEDEFYQVDLIGLRVQDCTGRILGEVSG 125

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKN 176
           ++NFGAG +LE++    KT LIPF+K AVLEV +    +++DP+AAGL++     
Sbjct: 126 LFNFGAGDLLEMRLNTGKTVLIPFSKAAVLEVCIASGFLVVDPVAAGLSDGGENT 180


>gi|259503523|ref|ZP_05746425.1| 16S rRNA processing protein RimM [Lactobacillus antri DSM 16041]
 gi|259168601|gb|EEW53096.1| 16S rRNA processing protein RimM [Lactobacillus antri DSM 16041]
          Length = 168

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 29/168 (17%), Positives = 67/168 (39%), Gaps = 7/168 (4%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-----YVLYSNDNRELRILKMYRKNKRF 60
           +   +  I  THG+ GEV +    +   +        Y+  ++   EL +    +     
Sbjct: 2   QFYNVGKIVNTHGIRGEVRVLPTTDFVKERFAPQQKLYLQEADGPLELTVEGARQHKGFI 61

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +  F+G DNI++    R  +L     D   + LE+ +++   +  +      G+  G++ 
Sbjct: 62  LVKFAGYDNINAVEGFRGHELMVSAAD--QQPLEDGQYYYHQIIGLAVKTVAGEELGRIK 119

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAG 168
            +   GA  +  ++   +   L+P     V  V+L +  + ++ +   
Sbjct: 120 EILAPGANDVWVVERPGKTDLLLPVIDDVVKRVDLDQGLVTVELMEGL 167


>gi|240146495|ref|ZP_04745096.1| 16S rRNA processing protein RimM [Roseburia intestinalis L1-82]
 gi|257201351|gb|EEU99635.1| 16S rRNA processing protein RimM [Roseburia intestinalis L1-82]
 gi|291535149|emb|CBL08261.1| 16S rRNA processing protein RimM [Roseburia intestinalis M50/1]
          Length = 194

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 38/179 (21%), Positives = 75/179 (41%), Gaps = 6/179 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRE----LRILKMYRKNKR 59
           ++ L+ +  I TTHG+ GEV +    ++     +      D  +    L I  +      
Sbjct: 18  MENLLQVGVITTTHGVRGEVKVFPTTDDAARFKKLKQVILDTGKEHLALEIAGVKFFKNM 77

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F G DNI+     R   LY  R++    +L+++E+F  DL  ++    +G+  G++
Sbjct: 78  VILKFKGYDNINDVEMFRKKSLYVTREN--AVKLKKNEYFIADLIGLKVISDEGEDLGEL 135

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQ 178
             V   GA  +  I        L+P  K  V +V+++   + +  +    +  + +   
Sbjct: 136 TDVLQTGANDVYVISKEGADDILLPAIKDCVKQVDIEGGTMQVHLLDGLRDLNSRREEA 194


>gi|261250234|ref|ZP_05942810.1| 16S rRNA processing protein RimM [Vibrio orientalis CIP 102891]
 gi|260939350|gb|EEX95336.1| 16S rRNA processing protein RimM [Vibrio orientalis CIP 102891]
          Length = 182

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 37/173 (21%), Positives = 69/173 (39%), Gaps = 12/173 (6%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRF 60
           D  +++   G ++G+ G + + SY +N   +  Y  +         E +     R NK  
Sbjct: 11  DNKIVVGKFGASYGIRGWLKVLSYTDNAESIFDYAPWWINQGGQWVEYKAESWKRHNKGL 70

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +    G+D    A  L + ++        +  L  DEF+  DL  M+    +G   G V 
Sbjct: 71  VVKLEGLDVREDAQLLTNFEILIDPAVLPE--LPSDEFYWRDLIGMQVVTDKGYDLGTVS 128

Query: 121 GVYNFGAGSILEIKNT-----MEKTFLIPFTKF-AVLEVNLQENKILIDPIAA 167
            +   G+  +L IK        +K  LIPF +   +  ++ +  +I +D    
Sbjct: 129 DMLETGSNDVLVIKANLKDAFGQKERLIPFLEEQVIKNIDREAQRIEVDWDPG 181


>gi|77359891|ref|YP_339466.1| 16S rRNA processing protein [Pseudoalteromonas haloplanktis TAC125]
 gi|109893034|sp|Q3IEC8|RIMM_PSEHT RecName: Full=Ribosome maturation factor rimM
 gi|76874802|emb|CAI86023.1| 16S rRNA processing protein [Pseudoalteromonas haloplanktis TAC125]
          Length = 178

 Score =  135 bits (341), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 35/175 (20%), Positives = 72/175 (41%), Gaps = 12/175 (6%)

Query: 3   KLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRKNK 58
               ++++  +G  +G+ G + + S+ ++P  +  +  +        + L ++   R NK
Sbjct: 5   NTSSIIVVGKLGAPYGIKGWLKVHSFTDDPAGIFDFSPWLIGQQGKWQTLEVVDWRRHNK 64

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
            FIA F+ +++   A      ++        +  L + EF+  DL  M     +G   G 
Sbjct: 65  GFIAKFAQVNDRDEAVAYTHAEISMDSAQLPE--LPQGEFYWRDLIGMSVVTDKGYDLGI 122

Query: 119 VCGVYNFGAGSILEIKNTME-----KTFLIPF-TKFAVLEVNLQENKILIDPIAA 167
           V  +   G+  +L +K   +        LIPF T   ++EV     +I +D    
Sbjct: 123 VDDLMETGSNDVLVVKANSKDAFGQAERLIPFLTDTVIIEVKHDAREITVDWDPG 177


>gi|145297737|ref|YP_001140578.1| 16S rRNA-processing protein RimM [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|172044435|sp|A4SIV8|RIMM_AERS4 RecName: Full=Ribosome maturation factor rimM
 gi|142850509|gb|ABO88830.1| 16S rRNA processing protein RimM [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 173

 Score =  135 bits (341), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 40/174 (22%), Positives = 76/174 (43%), Gaps = 12/174 (6%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRKNKR 59
           ++K V++ T+GT +G+ G + ++S+ +    +  Y  +    +   REL++    R NK 
Sbjct: 1   MEKPVVLGTLGTVYGIKGWLKVNSFTDVAEAIFDYNPWMINQNGVWRELKVSAWKRHNKG 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I    GID    A  L ++++           L E EF+  DL        +G   G+V
Sbjct: 61  LICKIDGIDLREDALALTNVEIGVPADLLPA--LPEGEFYWRDLIGCSVSTTKGYDLGKV 118

Query: 120 CGVYNFGAGSILEIKNTME-----KTFLIPFTKF-AVLEVNLQENKILIDPIAA 167
             +   G+  +L ++  ++     K  LIPF +   +  ++L    I +D    
Sbjct: 119 TELMETGSNDVLVVEANVKDAFGAKERLIPFLEEQVIKHIDLTARTIEVDWDPG 172


>gi|302554428|ref|ZP_07306770.1| 16S rRNA processing protein RimM [Streptomyces viridochromogenes
           DSM 40736]
 gi|302472046|gb|EFL35139.1| 16S rRNA processing protein RimM [Streptomyces viridochromogenes
           DSM 40736]
          Length = 180

 Score =  135 bits (341), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 37/181 (20%), Positives = 75/181 (41%), Gaps = 9/181 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPI-DLNRYVLYSNDN---RELRILKMYRKNKRFIAT 63
           +++A IG  HG+ GEV ++   + P   L    + + D      L I      + R +  
Sbjct: 3   LVVARIGRAHGIKGEVTVEVRTDEPELRLAPGAVLTTDPAATGPLTIETGRVHSGRLLLR 62

Query: 64  FSGIDNIHSASELRDLKL--YAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
           F G+ +   A  LR+  L       +  +    EDE+++  L +++     G   G++  
Sbjct: 63  FEGVSDRTGAEALRNTLLIAEIDPDELPE---GEDEYYDHQLIDLDVVTADGTEVGRITE 119

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQYDC 181
           + +     +  ++       LIPF +  V E++L+E K +I P    +++        + 
Sbjct: 120 ISHLPTQDLFIVERPDGSEVLIPFVEEIVAEIDLEEQKAVITPPPGLIDDRAEIASSREE 179

Query: 182 P 182
            
Sbjct: 180 S 180


>gi|219871999|ref|YP_002476374.1| 16S rRNA-processing protein RimM [Haemophilus parasuis SH0165]
 gi|254797751|sp|B8F7X4|RIMM_HAEPS RecName: Full=Ribosome maturation factor rimM
 gi|219692203|gb|ACL33426.1| 16S rRNA-processing protein [Haemophilus parasuis SH0165]
          Length = 175

 Score =  135 bits (341), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 33/165 (20%), Positives = 69/165 (41%), Gaps = 12/165 (7%)

Query: 9   LMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRFIATF 64
           ++  +G+T+G+ G + + S    P  +  Y  +        +++ +      N   I   
Sbjct: 8   VVGKLGSTYGIRGWLRLYSSTEYPESIFDYQPWFLKIKGQWQQVELESWRYHNNDLIVKL 67

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
            G ++  +A  L + ++      F +  LEE +++  DL   +  + +G   G V  +  
Sbjct: 68  KGTEDRETAQLLTNAEIGVDLAVFPE--LEEGDYYWHDLIGCQVVNLEGYAMGTVTEMME 125

Query: 125 FGAGSILEIKNT-----MEKTFLIPFT-KFAVLEVNLQENKILID 163
            G+  +L +K        ++  LIPF  +  V  V+L    I +D
Sbjct: 126 TGSNDVLVVKAGSKDAFGKQERLIPFLYEQVVKRVDLATKTITVD 170


>gi|212636511|ref|YP_002313036.1| 16S rRNA-processing protein RimM [Shewanella piezotolerans WP3]
 gi|226734092|sp|B8CQI3|RIMM_SHEPW RecName: Full=Ribosome maturation factor rimM
 gi|212557995|gb|ACJ30449.1| RimM protein:PRC-barrel [Shewanella piezotolerans WP3]
          Length = 176

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 39/173 (22%), Positives = 82/173 (47%), Gaps = 12/173 (6%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRK 56
           M    + V++  +G++HG+ G + I +Y ++   +  Y  +      + RE+++L+   +
Sbjct: 1   MSSKQEPVVLGKLGSSHGIKGWLKITTYTDSVEGIFDYSPWLLKEQGEWREVKVLQWRMQ 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
            K  +A   G++    A  L + ++    +  +   L EDEF+  DL   E  + +G   
Sbjct: 61  GKAVVACLEGVETRDQAQALTNCEIAVTPEQME--VLPEDEFYWRDLIGCEVVNTKGYNM 118

Query: 117 GQVCGVYNFGAGSILEIKNT-----MEKTFLIPFT-KFAVLEVNLQENKILID 163
           G+V  +   G+  +L +K        +   +IPF  +  + +V+L   +IL+D
Sbjct: 119 GKVQEIVETGSNDVLLVKANAKDGFGKAERMIPFVTEQFIQKVDLTAKQILVD 171


>gi|284024232|ref|ZP_06378630.1| 16S rRNA-processing protein RimM [Staphylococcus aureus subsp.
           aureus 132]
          Length = 167

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 48/168 (28%), Positives = 84/168 (50%), Gaps = 8/168 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY-----VLYSNDNRELRILKMYRKNKRFIA 62
           V +  I  THG+ GE+ + S ++      +      V+++N++ E  +          + 
Sbjct: 3   VEVGQIVNTHGIKGEIKVKSNSDFTDVRFQPGQVLTVVHNNNDLEYTVKSHRVHKGLHML 62

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
           TF GI+NI+    L+   +Y +R   +D  LEE+EF+ +D+     FD Q    G+V  +
Sbjct: 63  TFEGINNINDIEHLKGSSIYQERDH-EDIVLEENEFYYSDIIGCTVFDDQETPIGRVINI 121

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           +  GA  +  IK    K +LIP+    V EV+++  KI+I P+   L+
Sbjct: 122 FETGANDVWVIK--GSKEYLIPYIADVVKEVDVENKKIIIMPMEGLLD 167


>gi|145296016|ref|YP_001138837.1| 16S rRNA-processing protein RimM [Corynebacterium glutamicum R]
 gi|166226437|sp|A4QFB9|RIMM_CORGB RecName: Full=Ribosome maturation factor rimM
 gi|140845936|dbj|BAF54935.1| hypothetical protein [Corynebacterium glutamicum R]
          Length = 171

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 45/174 (25%), Positives = 80/174 (45%), Gaps = 9/174 (5%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNR-----ELRILKMYRK 56
           +  ++ + +  +  +HG+ GEV ++   ++P          N  +      L I      
Sbjct: 1   MSTEQELQIGKVVKSHGIRGEVVVELSTDDPDIRFAIGEVLNGKQAGKEHSLTIDAARMH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
             R +  F+ + +  +A  LR  + +A   + +D   +ED F++ +LE +      G+  
Sbjct: 61  QGRLLVKFAEVPDRTAADSLRGTRFFAAPLEDED---DEDGFYDHELESLRVIHE-GEDI 116

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           G+V GV +  AG ILE++ T  K  LIPF    V EV+L+E    I P    L+
Sbjct: 117 GEVTGVMHGPAGEILEVRLTSGKETLIPFVHAIVPEVDLEEGTATITPPEGLLD 170


>gi|162139559|ref|YP_217663.2| 16S rRNA-processing protein RimM [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|322715732|gb|EFZ07303.1| Ribosome maturation factor rimM [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
          Length = 182

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 32/172 (18%), Positives = 75/172 (43%), Gaps = 12/172 (6%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRFI 61
           + V++  +G+++G+ G + + S   +   +  Y+ +        +++++      N+  I
Sbjct: 12  EPVVLGKMGSSYGIRGWLRVFSSTEDAESIFDYLPWFIQKAGQWQQVQLESWKHHNQDLI 71

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               G+D+  +A+ L + ++           LEE +++  DL   +    +G   G+V  
Sbjct: 72  IKLKGVDDRDAANLLTNCEIVVDSSQLPA--LEEGDYYWKDLMGCQVVTAEGYDLGKVID 129

Query: 122 VYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILIDPIAA 167
           +   G+  +L IK  ++     K  L+PF     + +V+L    I +D    
Sbjct: 130 MMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLATRTIEVDWDPG 181


>gi|83589818|ref|YP_429827.1| 16S rRNA processing protein RimM [Moorella thermoacetica ATCC
           39073]
 gi|109893023|sp|Q2RJV5|RIMM_MOOTA RecName: Full=Ribosome maturation factor rimM
 gi|83572732|gb|ABC19284.1| 16S rRNA processing protein RimM [Moorella thermoacetica ATCC
           39073]
          Length = 176

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 30/175 (17%), Positives = 64/175 (36%), Gaps = 12/175 (6%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNR----------ELRILKMYR 55
           + + +  I  THG+ GEV +    + P           +             + ++ +  
Sbjct: 4   ERIGVGKIIGTHGIRGEVKVFPLTDFPERFRPGTRLILEQEGADGREGRTFPVTVISVRP 63

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
                I   + I++   A  +R   L    + ++ E L E  ++   L     +   G++
Sbjct: 64  GKGNLILKLAEINDADQAGAVRGATLKV--EPWEVEPLPEGHYYIYQLLGSRVYTTGGEF 121

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
            G +  +   GA  +  ++N      LIP  K  V +V+L   +I ++      +
Sbjct: 122 LGILRDILATGANDVYVVRNEDAGEILIPALKTVVRQVDLARKEIRVELPPGLRD 176


>gi|251797469|ref|YP_003012200.1| 16S rRNA processing protein RimM [Paenibacillus sp. JDR-2]
 gi|247545095|gb|ACT02114.1| 16S rRNA processing protein RimM [Paenibacillus sp. JDR-2]
          Length = 172

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 25/172 (14%), Positives = 62/172 (36%), Gaps = 9/172 (5%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-------YVLYSNDNRELRILKMYRKN 57
           +K   +  +  THGL GEV +    +                  +    E+ +       
Sbjct: 3   NKYYNVGKLVNTHGLRGEVKVLPQTDFAESRFASGSKLSLQHPDNGQKLEVEVTGAREHK 62

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
             FI    G ++I+   + +   L    ++ +  +L++ E++  ++         G+  G
Sbjct: 63  GMFILKLKGYNDINEVEKYKGWTLKIGEEELE--QLDDGEYYYHEIIGCRVLTEDGEELG 120

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
            +  +   GA  +  +    +K  L+P     +L V++    + +  +   +
Sbjct: 121 TISDILRPGANDVWVVDMPKKKQLLLPVIDDVLLNVDVTNKTVTVRLLEGLI 172


>gi|302344584|ref|YP_003809113.1| 16S rRNA processing protein RimM [Desulfarculus baarsii DSM 2075]
 gi|301641197|gb|ADK86519.1| 16S rRNA processing protein RimM [Desulfarculus baarsii DSM 2075]
          Length = 179

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 44/181 (24%), Positives = 74/181 (40%), Gaps = 7/181 (3%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDN-----RELRILKMYRK 56
           +   +LV M     + GL GEV I S+A +     R  +          +  R+L     
Sbjct: 1   MPAQRLVTMGRSAGSFGLRGEVKISSFAEDHEVFARAGVVYLGAEPGVAKPYRLLGARWH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
             R + T  G+     A+ L    LY +R+D     L +DEF+  +L        QG+  
Sbjct: 61  GGRLLMTLEGVTTREDAAALGGAWLYLRREDLPP--LADDEFYWFELIGARARTAQGQDL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKN 176
           G V  + + GA   L ++    K  +IP  +  ++E++L    +++DP    L       
Sbjct: 119 GHVFALTDNGAHDNLVLRGPGGKEAMIPLVEGVLVEMDLAAGLVVVDPPEGLLEAQGWDE 178

Query: 177 P 177
           P
Sbjct: 179 P 179


>gi|157148121|ref|YP_001455440.1| 16S rRNA-processing protein RimM [Citrobacter koseri ATCC BAA-895]
 gi|157085326|gb|ABV15004.1| hypothetical protein CKO_03931 [Citrobacter koseri ATCC BAA-895]
          Length = 183

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 31/184 (16%), Positives = 75/184 (40%), Gaps = 19/184 (10%)

Query: 1   MVKLD-------KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELR 49
           M+          + +++  +G+++G+ G + + S   +   +  Y  +        ++++
Sbjct: 1   MMSKQLTAQAPVEPIVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQQVQ 60

Query: 50  ILKMYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETF 109
           +      N+  I    G+D+  SA+ L + ++           LE+  ++  DL   +  
Sbjct: 61  LESWKHHNQDLIIKLKGVDDRDSANLLTNCEIVVDSSQLPA--LEDGSYYWKDLMGCQVV 118

Query: 110 DRQGKYWGQVCGVYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILID 163
             +G   G+V  +   G+  ++ IK  ++     K  L+PF     + +V+L    I +D
Sbjct: 119 TTEGYDLGKVVDMMETGSNDVIVIKANLKDAFGIKERLVPFLDGQVIKKVDLATRTIEVD 178

Query: 164 PIAA 167
               
Sbjct: 179 WDPG 182


>gi|260893267|ref|YP_003239364.1| 16S rRNA processing protein RimM [Ammonifex degensii KC4]
 gi|260865408|gb|ACX52514.1| 16S rRNA processing protein RimM [Ammonifex degensii KC4]
          Length = 169

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 32/168 (19%), Positives = 61/168 (36%), Gaps = 6/168 (3%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDL----NRYVLYSNDNRELRILKMYRKNKRFI 61
             + +  I   HG  G + +    + P          VL         + +     K  +
Sbjct: 4   DFITVGEIVAPHGYRGALKVLPLTDFPERFLGMKEAMVLLKGRRTTYTVKRARLHGKFVL 63

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               G++ +  A  LR   +   R++     L    ++  DL  ME F  +G + G++  
Sbjct: 64  LELVGVERMEEAEALRGGLVQVPREE--VYPLPPGHYYIFDLIGMEVFTEEGAFLGKIEA 121

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           V +  A  +  +++   K  LIP  K  V  V++   K+ +      L
Sbjct: 122 VLSTRANDVFSVRSPEGKEILIPALKTVVCSVDVPGRKMTVKLPEGLL 169


>gi|312883947|ref|ZP_07743664.1| 16S rRNA-processing protein RimM [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309368405|gb|EFP95940.1| 16S rRNA-processing protein RimM [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 182

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 33/173 (19%), Positives = 68/173 (39%), Gaps = 12/173 (6%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRF 60
           +  +++   G ++G+ G + + SY +N   +  Y  +         E ++    R NK  
Sbjct: 11  NDKIVVGKFGASYGIRGWLKVFSYTDNTESIFDYSPWFVNQNGSWVEYKVESWKRHNKSM 70

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +    G++    A  + + ++          +L ED+F+  +L  M      G   G V 
Sbjct: 71  VVKLEGLEVREEAQLMTNFEICIDPAVLP--KLPEDQFYWRELIGMSVVTEGGYDLGVVS 128

Query: 121 GVYNFGAGSILEIKNT-----MEKTFLIPFTKF-AVLEVNLQENKILIDPIAA 167
            +   G+  +L IK        +K  LIPF +   +  ++    +I +D    
Sbjct: 129 DMLETGSNDVLVIKANLKDAFGQKERLIPFLEEQVIKNIDRTAQRIEVDWDPG 181


>gi|312898906|ref|ZP_07758294.1| 16S rRNA processing protein RimM [Megasphaera micronuciformis
           F0359]
 gi|310620068|gb|EFQ03640.1| 16S rRNA processing protein RimM [Megasphaera micronuciformis
           F0359]
          Length = 166

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 32/165 (19%), Positives = 59/165 (35%), Gaps = 2/165 (1%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFI 61
           +   +   +  I   HG+ G+V +    + P           D  +  I       +  +
Sbjct: 1   MAETEFFTIGQIVAPHGVRGDVRVYPDTDFPERFLTMKYAYIDGVKYEITDARFHKRVVL 60

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
             F GI + +    L   +L   RQD     LEE + +  D+     FD++    G V  
Sbjct: 61  MKFVGIHDRNGVEPLLHKELQVTRQDL--MPLEEGQHYVFDIIGCRVFDKENNVLGTVTD 118

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIA 166
           +   G+  +  + +   K  L+      +L V+     I+ DP  
Sbjct: 119 ILKTGSNDVYIVTDEDGKELLLAVIPQVILSVDTDTKTIIADPPE 163


>gi|257068183|ref|YP_003154438.1| 16S rRNA processing protein RimM [Brachybacterium faecium DSM 4810]
 gi|256559001|gb|ACU84848.1| 16S rRNA processing protein RimM [Brachybacterium faecium DSM 4810]
          Length = 194

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 45/191 (23%), Positives = 82/191 (42%), Gaps = 8/191 (4%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS-----NDNRELRILKMYR 55
           M  LD  V++ATIG  HGL GEV +    + P +  +             R L +     
Sbjct: 1   MSTLD--VIVATIGRAHGLRGEVALTLRTDQPEERLQPGTAFEVEVAGQVRALTVQSTRM 58

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
           +  R+   F  +D+   A+ LR + L       ++ E + D ++   L+ +      G+ 
Sbjct: 59  QQDRWYVRFEEVDDRTGAASLRGIDLVLSLDAEQEAEEDPDAWYPAQLKGLSVRHVDGRE 118

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMK 175
            G V GV ++ A  +L ++    +   +P  +  V EV+L++  ++ DP     +    +
Sbjct: 119 LGTVAGVDHYPAQDLLVVRTPDRRRVQLPLVEELVPEVDLEQGVVIADPPGGLFD-ALPE 177

Query: 176 NPQYDCPLDSA 186
           + Q   P  SA
Sbjct: 178 DEQGPEPETSA 188


>gi|221632147|ref|YP_002521368.1| 16S rRNA processing protein RimM [Thermomicrobium roseum DSM 5159]
 gi|221155506|gb|ACM04633.1| 16S rRNA processing protein RimM [Thermomicrobium roseum DSM 5159]
          Length = 184

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 31/162 (19%), Positives = 68/162 (41%), Gaps = 4/162 (2%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDL--NRYVLYSNDNRELRILKMYRKNKRFIAT 63
           + + +  I   HG+ G V +  + + P  +    YV    +    R+L+   +       
Sbjct: 19  ERLSIGRIVGAHGVRGTVKLKIWTHFPERIPHLEYVYLGEEPTPRRLLRARVQGDLAFLQ 78

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
             GI   + A  +R + +   R       L EDE++  ++  ++  D  G   G+V  + 
Sbjct: 79  LEGITTRNEAEAMRGVVVRIDRSQ--AAPLGEDEYYQFEILGLQVVDEAGNVLGRVIEIL 136

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPI 165
             GA  +  ++       L+P  +  +L V+L++ ++++ P 
Sbjct: 137 ETGANDVYVVQRPDGSELLLPAIRSVILAVDLEQQRLVVRPP 178


>gi|330831189|ref|YP_004394141.1| ribosome maturation factor rimM [Aeromonas veronii B565]
 gi|328806325|gb|AEB51524.1| Ribosome maturation factor rimM [Aeromonas veronii B565]
          Length = 173

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 40/174 (22%), Positives = 76/174 (43%), Gaps = 12/174 (6%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRKNKR 59
           ++K V++ T+GT +G+ G + ++S+ +    +  Y  +    +   RE+R+    R NK 
Sbjct: 1   MEKPVVLGTLGTVYGIKGWLKVNSFTDVAEAIFDYNPWLINQNGAWREIRVSSWKRHNKG 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I    GID    A  L ++++           L E EF+  DL        +G   G+V
Sbjct: 61  LICKLDGIDVREDALALTNVEIGVPADLLPA--LPEGEFYWRDLIGCSVVTTKGYDLGKV 118

Query: 120 CGVYNFGAGSILEIKNTME-----KTFLIPFTKF-AVLEVNLQENKILIDPIAA 167
             +   G+  +L ++  ++     K  LIPF +   +  ++L    I +D    
Sbjct: 119 TELMETGSNDVLVVEANVKDAFGAKERLIPFLEEQVIKNIDLTVRTIEVDWDPG 172


>gi|323495856|ref|ZP_08100924.1| 16S rRNA-processing protein RimM [Vibrio sinaloensis DSM 21326]
 gi|323319072|gb|EGA72015.1| 16S rRNA-processing protein RimM [Vibrio sinaloensis DSM 21326]
          Length = 182

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 36/173 (20%), Positives = 69/173 (39%), Gaps = 12/173 (6%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRF 60
           D  +++   G T+G+ G + + SY +N   +  Y  +         E ++    R NK  
Sbjct: 11  DDKIVVGKFGATYGIRGWLKVFSYTDNTESIFDYAPWFIKQGEKWVEYKVESWKRHNKGL 70

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +    G+D    A  + + ++        +  L  DEF+  DL  M+    +G   G V 
Sbjct: 71  VVKLEGLDVREEAQLMTNFEISIDPAVLPE--LPSDEFYWRDLIGMQVVTDKGYDLGTVS 128

Query: 121 GVYNFGAGSILEIKNT-----MEKTFLIPFTKF-AVLEVNLQENKILIDPIAA 167
            +   G+  +L +K        +K  LIPF +   +  ++    +I +D    
Sbjct: 129 DMLETGSNDVLVVKANLKDAFGQKERLIPFLEEQVIKTIDRTAQRIEVDWDPG 181


>gi|145224752|ref|YP_001135430.1| 16S rRNA-processing protein [Mycobacterium gilvum PYR-GCK]
 gi|315445082|ref|YP_004077961.1| 16S rRNA processing protein RimM [Mycobacterium sp. Spyr1]
 gi|189040844|sp|A4TE78|RIMM_MYCGI RecName: Full=Ribosome maturation factor rimM
 gi|145217238|gb|ABP46642.1| 16S rRNA processing protein RimM [Mycobacterium gilvum PYR-GCK]
 gi|315263385|gb|ADU00127.1| 16S rRNA processing protein RimM [Mycobacterium sp. Spyr1]
          Length = 173

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 38/172 (22%), Positives = 67/172 (38%), Gaps = 8/172 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLN-------RYVLYSNDNRELRILKMYRKNKRF 60
           +++  +   HG+ GE+ ++   ++P                    RE  I  +     R 
Sbjct: 3   LVVGRVAKAHGVTGELTVEVRTDDPQGRFVRGAVLRGRPPRGGAEREYVIESVRTHGDRL 62

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +  F G+ +  +A  LR         D    E  ++ F++  LE +      G   G+V 
Sbjct: 63  LVRFDGVADRDAADALRGTVFLVDSADLPPIEDPDE-FYDHQLEGLTVITTSGGEVGKVA 121

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNT 172
            V +  AG +L ++   +   L+PF    VL V+L +  I IDP    L   
Sbjct: 122 EVLHTAAGELLAVRTADDTEVLVPFVSAIVLSVSLDDQLITIDPPDGLLELD 173


>gi|323141929|ref|ZP_08076789.1| 16S rRNA processing protein RimM [Phascolarctobacterium sp. YIT
           12067]
 gi|322413596|gb|EFY04455.1| 16S rRNA processing protein RimM [Phascolarctobacterium sp. YIT
           12067]
          Length = 167

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 35/164 (21%), Positives = 73/164 (44%), Gaps = 3/164 (1%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND-NRELRILKMYRKNKRFIA 62
           ++  +++  I   HG+ G++ I    + P              R+L +       +  + 
Sbjct: 1   MENQIVIGKIVAPHGVRGDIRILPLTDKPEQFLDLDYLLLPDGRKLTVKAARFHKRMVLV 60

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
           T + I +++ +  LR +++    +D  +  LEE  F+  DL  +  +D QG+  G     
Sbjct: 61  TTAEIKSMNESELLRGMEVSINAEDLPE--LEEGRFYVADLIGLPVYDEQGEQIGTFKDA 118

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIA 166
            + G+  +  I    +K +L+P  K  V E+NL E +I+++   
Sbjct: 119 LSTGSNDVYVIAVPGQKDYLLPALKKYVKEINLAEKRIVVELPE 162


>gi|319950997|ref|ZP_08024867.1| 16S rRNA-processing protein RimM [Dietzia cinnamea P4]
 gi|319435340|gb|EFV90590.1| 16S rRNA-processing protein RimM [Dietzia cinnamea P4]
          Length = 177

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 34/172 (19%), Positives = 73/172 (42%), Gaps = 10/172 (5%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND---------NRELRILKMYRKNK 58
           +++  +  +HG+ GE+ ++   ++P +                   +R++ +      + 
Sbjct: 3   LVVGRVVKSHGVRGELVVEVRTDSPEERFAPGARLTGRVGKGDRATDRDVTVEAARSHSG 62

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
           R +   +G+ +  +A  LR + L     +  D E  ++ + +  L  +   D  G   G+
Sbjct: 63  RLLVRLAGVSDRDTADALRGMLLLVDSAELPDPEDPDE-YHDHQLVGLRVLDTSGAPLGE 121

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           V  + +  AG +L I+ T     L+PF    V EV++     +IDP    L+
Sbjct: 122 VTEIVHTPAGELLGIRLTDGADALVPFVTEMVPEVDVPGGTCVIDPPEGLLD 173


>gi|75481545|sp|Q57L30|RIMM_SALCH RecName: Full=Ribosome maturation factor rimM
 gi|62128879|gb|AAX66582.1| 16S rRNA processing protein [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
          Length = 183

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 33/184 (17%), Positives = 77/184 (41%), Gaps = 19/184 (10%)

Query: 1   MVKLD-------KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELR 49
           M+          + V++  +G+++G+ G + + S   +   +  Y+ +        ++++
Sbjct: 1   MMSKQLAAQVPAEPVVLGKMGSSYGIRGWLRVFSSTEDAESIFDYLPWFIQKAGQWQQVQ 60

Query: 50  ILKMYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETF 109
           +      N+  I    G+D+  +A+ L + ++           LEE +++  DL   +  
Sbjct: 61  LESWKHHNQDLIIKLKGVDDRDAANLLTNCEIVVDSSQLPA--LEEGDYYWKDLMGCQVV 118

Query: 110 DRQGKYWGQVCGVYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILID 163
             +G   G+V  +   G+  +L IK  ++     K  L+PF     + +V+L    I +D
Sbjct: 119 TAEGYDLGKVIDMMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLATRTIEVD 178

Query: 164 PIAA 167
               
Sbjct: 179 WDPG 182


>gi|169827101|ref|YP_001697259.1| 16S rRNA-processing protein [Lysinibacillus sphaericus C3-41]
 gi|209573567|sp|B1HQI2|RIMM_LYSSC RecName: Full=Ribosome maturation factor rimM
 gi|168991589|gb|ACA39129.1| Probable 16S rRNA-processing protein [Lysinibacillus sphaericus
           C3-41]
          Length = 171

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 39/171 (22%), Positives = 72/171 (42%), Gaps = 8/171 (4%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-------YVLYSNDNRELRILKMYRKNK 58
           +   +  I  THG+ GEV I S  +   +          +         + I  + R   
Sbjct: 2   EWFNVGRIVNTHGIRGEVRILSTTDFEKERFAVGNKLAAFKKDDKKPTGVTIQSVRRHKN 61

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
             + TF G++NI+     ++  L   +    D+ LEE+EFF  ++        +G+  G 
Sbjct: 62  FILLTFEGMNNINLVEPFKEGLLKVTKDQMTDDLLEENEFFFHEIIGCTVVSEEGETIGV 121

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           V  +   GA  +  +K   +K   IP+ +  V ++++ E KI+I  +   L
Sbjct: 122 VNDILQTGANDVWVVKG-SKKEHYIPYIEDIVKDIDVDEKKIVIHVMEGLL 171


>gi|161502227|ref|YP_001569339.1| 16S rRNA-processing protein RimM [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|189040850|sp|A9MGT6|RIMM_SALAR RecName: Full=Ribosome maturation factor rimM
 gi|160863574|gb|ABX20197.1| hypothetical protein SARI_00251 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 183

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 32/172 (18%), Positives = 75/172 (43%), Gaps = 12/172 (6%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRFI 61
           + V++  +G+++G+ G + + S   +   +  Y  +     +  +++++      N+  I
Sbjct: 13  EPVVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKADQWQQVQLESWKHHNQDLI 72

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               G+D+  +A+ L + ++           LEE +++  DL   +    +G   G+V  
Sbjct: 73  IKLKGVDDRDAANLLTNCEIVVDSSQLPA--LEEGDYYWKDLMGCQVVTAEGYDLGKVID 130

Query: 122 VYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILIDPIAA 167
           +   G+  +L IK  ++     K  L+PF     + +V+L    I +D    
Sbjct: 131 MMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLATRTIEVDWDPG 182


>gi|205353712|ref|YP_002227513.1| 16S rRNA-processing protein RimM [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|259585651|sp|B5RD84|RIMM_SALG2 RecName: Full=Ribosome maturation factor rimM
 gi|205273493|emb|CAR38470.1| 16S rRNA processing protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|326628818|gb|EGE35161.1| 16S rRNA-processing protein RimM [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
          Length = 182

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 32/172 (18%), Positives = 74/172 (43%), Gaps = 12/172 (6%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRFI 61
           + V++  +G+++G+ G + + S   +   +  Y  +        +++++      N+  I
Sbjct: 12  EPVVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQQVQLESWKHHNQDLI 71

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               G+D+  +A+ L + ++           LEE +++  DL   +    +G   G+V  
Sbjct: 72  IKLKGVDDRDAANLLTNCEIVVDSSQLPA--LEEGDYYWKDLMGCQVVTAEGYDLGKVID 129

Query: 122 VYNFGAGSILEIKNTME-----KTFLIPFT-KFAVLEVNLQENKILIDPIAA 167
           +   G+  +L IK  ++     K  L+PF     + +V+L    I +D    
Sbjct: 130 MMETGSNDVLVIKANLKDAFGIKERLVPFLYGQVIKKVDLATRTIEVDWDPG 181


>gi|19553253|ref|NP_601255.1| 16S rRNA-processing protein RimM [Corynebacterium glutamicum ATCC
           13032]
 gi|62390889|ref|YP_226291.1| 16S rRNA-processing protein RimM [Corynebacterium glutamicum ATCC
           13032]
 gi|24418639|sp|Q8NNX5|RIMM_CORGL RecName: Full=Ribosome maturation factor rimM
 gi|21324822|dbj|BAB99445.1| RimM protein, required for 16S rRNA processing [Corynebacterium
           glutamicum ATCC 13032]
 gi|41326228|emb|CAF20390.1| RIMM PROTEIN (16S RRNA PROCESSING PROTEIN) [Corynebacterium
           glutamicum ATCC 13032]
          Length = 171

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 45/174 (25%), Positives = 80/174 (45%), Gaps = 9/174 (5%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNR-----ELRILKMYRK 56
           +  ++ + +  +  +HG+ GEV ++   ++P          N  +      L I      
Sbjct: 1   MSTEQELQIGKVVKSHGIRGEVVVELSTDDPDIRFAIGEVLNGKQAGKEHSLTIDAARMH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
             R +  F+ + +  +A  LR  + +A   + +D   +ED F++ +LE +      G+  
Sbjct: 61  QGRLLVKFAEVPDRTAADSLRGTRFFAAPLEDED---DEDGFYDHELEGLRVIHE-GEDI 116

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           G+V GV +  AG ILE++ T  K  LIPF    V EV+L+E    I P    L+
Sbjct: 117 GEVTGVMHGPAGEILEVRLTSGKETLIPFVHAIVPEVDLEEGTATITPPEGLLD 170


>gi|237729524|ref|ZP_04560005.1| 16S rRNA-processing protein [Citrobacter sp. 30_2]
 gi|226908130|gb|EEH94048.1| 16S rRNA-processing protein [Citrobacter sp. 30_2]
          Length = 185

 Score =  135 bits (339), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 31/184 (16%), Positives = 75/184 (40%), Gaps = 19/184 (10%)

Query: 1   MVKLD-------KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELR 49
           M+          + +++  +G+++G+ G + + S   +   +  Y  +        ++++
Sbjct: 3   MMSKQLAAQAPVEPIVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQQVQ 62

Query: 50  ILKMYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETF 109
           +      N+  I    G+D+  SA+ L + ++           LE+  ++  DL   +  
Sbjct: 63  LESWKHHNQDLIIKLKGVDDRDSANLLTNCEIVVDSSQLPA--LEDGSYYWKDLMGCQVV 120

Query: 110 DRQGKYWGQVCGVYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILID 163
             +G   G+V  +   G+  ++ IK  ++     K  L+PF     + +V+L    I +D
Sbjct: 121 TTEGYDLGKVVDMMETGSNDVIVIKANLKDAFGIKERLVPFLDGQVIKKVDLATRTIEVD 180

Query: 164 PIAA 167
               
Sbjct: 181 WDPG 184


>gi|169830843|ref|YP_001716825.1| 16S rRNA processing protein RimM [Candidatus Desulforudis
           audaxviator MP104C]
 gi|238688234|sp|B1I2N0|RIMM_DESAP RecName: Full=Ribosome maturation factor rimM
 gi|169637687|gb|ACA59193.1| 16S rRNA processing protein RimM [Candidatus Desulforudis
           audaxviator MP104C]
          Length = 170

 Score =  135 bits (339), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 36/168 (21%), Positives = 70/168 (41%), Gaps = 6/168 (3%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRIL----KMYRKNKRF 60
           ++L+L+  I  T G  G V +    + P    R      +   +R L    ++    +  
Sbjct: 3   EELILIGEIVNTQGHRGAVRVLPLTDFPERFRRLKSVYLEQGPVRRLVHIGRVSYHKRFV 62

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           I  F  I ++++A +L+  +L   R +     L +   +  D+     FD +G+Y G V 
Sbjct: 63  ILEFREIPDMNAAEKLKGAQLKIHRSEL--VPLPDGHHYVFDIVGSSVFDAEGEYLGVVE 120

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAG 168
            V   GA  +  +K+    + L+P  K  V +++L   +I +      
Sbjct: 121 DVLRTGANDVYVVKSGEGDSLLVPALKTVVRDIDLARRRITVVLPEGL 168


>gi|240137229|ref|YP_002961698.1| putative 16S rRNA processing protein [Methylobacterium extorquens
           AM1]
 gi|240007195|gb|ACS38421.1| putative 16S rRNA processing protein [Methylobacterium extorquens
           AM1]
          Length = 223

 Score =  135 bits (339), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 59/187 (31%), Positives = 86/187 (45%), Gaps = 13/187 (6%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYR----KNKRFI 61
           LVL+   G  HGL+GEV + S+ + P+ +  Y  L+S+D R L +  +           I
Sbjct: 44  LVLLGEFGRPHGLHGEVRLKSHTSEPLAIAGYGPLHSSDGRTLELANVRPAAGSSPDLLI 103

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               G+D+   A  L  + L   R+   + E +EDEFF TDL  +   D  G   G +  
Sbjct: 104 VRVKGVDDRSGAEALNRVTLAIARERLGEVE-DEDEFFLTDLIGLTVEDGAGTVIGTIVA 162

Query: 122 VYNFGAGSILEIKN-TMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQYD 180
           V NFG G +LEI+      T L+PFTK  V  +++   K++ DP            P   
Sbjct: 163 VPNFGGGDLLEIRPAAGGPTALLPFTKAFVPSLDIAGGKVVADPPDDLF------APPGP 216

Query: 181 CPLDSAG 187
            P D  G
Sbjct: 217 KPADDPG 223


>gi|197103581|ref|YP_002128958.1| 16S rRNA processing protein RimM [Phenylobacterium zucineum HLK1]
 gi|196477001|gb|ACG76529.1| 16S rRNA processing protein RimM [Phenylobacterium zucineum HLK1]
          Length = 167

 Score =  135 bits (339), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 50/165 (30%), Positives = 74/165 (44%), Gaps = 4/165 (2%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRE--LRILKMYRKNKRFIA 62
           D L+L+  +    G+ GEV + SY   P  L  Y     ++    L +L         + 
Sbjct: 3   DSLILVGRVAGAFGVRGEVRLTSYTAEPSALLDYRDLKREDGRPALTLLSGRPAKGGLVV 62

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
               ++    A  LR L LY  R    + E +E  F+ TDL  +     QG+  G+V  V
Sbjct: 63  RAQEVETREQAEALRGLNLYIPRDILPEPEEDE--FYVTDLIGLAVETPQGEPLGRVKNV 120

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAA 167
            +FGAG +LEI+      + +PFTK AV EV L E K++      
Sbjct: 121 QDFGAGDLLEIEPPEGAAWYLPFTKEAVPEVRLAEGKVVAVRPEE 165


>gi|229592397|ref|YP_002874516.1| 16S rRNA-processing protein RimM [Pseudomonas fluorescens SBW25]
 gi|259585649|sp|C3K1H0|RIMM_PSEFS RecName: Full=Ribosome maturation factor rimM
 gi|229364263|emb|CAY51980.1| 16S rRNA processing protein [Pseudomonas fluorescens SBW25]
          Length = 178

 Score =  135 bits (339), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 37/167 (22%), Positives = 85/167 (50%), Gaps = 10/167 (5%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDN----RELRILKMYRKNKRF 60
           D L+++  I + HG+ GEV + S+ +   +L +Y  ++       +++ ++     +K  
Sbjct: 9   DDLIVIGKIYSVHGVRGEVKVYSFTDPTENLLQYKTWTLKREGSVKQVELVSGRGSDKFL 68

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +A   G+D+   A  L   ++   R  F +  L + E++   LE ++  D+ G+ +G++ 
Sbjct: 69  VAKLKGLDDREEARLLAGYEICVPRNLFPE--LTDGEYYWYQLEGLKVIDQLGQLFGKID 126

Query: 121 GVYNFGAGSILEIKNT----MEKTFLIPFTKFAVLEVNLQENKILID 163
            +   GA  ++ +K       ++  L+P+TK  VL V+L+  ++ ++
Sbjct: 127 HLLETGANDVMVVKPCAGSLDDRERLLPYTKQCVLAVDLEAGEMKVE 173


>gi|312962852|ref|ZP_07777339.1| Ribosome maturation factor [Pseudomonas fluorescens WH6]
 gi|311282879|gb|EFQ61473.1| Ribosome maturation factor [Pseudomonas fluorescens WH6]
          Length = 178

 Score =  135 bits (339), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 36/167 (21%), Positives = 83/167 (49%), Gaps = 10/167 (5%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDN----RELRILKMYRKNKRF 60
           D L+++  I + HG+ GEV + S+ +   +L +Y  ++       +++ ++     +K  
Sbjct: 9   DDLIVIGKIYSVHGVRGEVKVYSFTDPTENLLQYKTWTLKREGSVKQVELVSGRGSDKFL 68

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +A   G+D+   A  L   ++   R  F +  L + E++   LE ++  D+ G+  G++ 
Sbjct: 69  VAKLKGLDDREEARLLAGYEICVPRNLFPE--LTDGEYYWYQLEGLKVIDQLGQLLGKID 126

Query: 121 GVYNFGAGSILEIKNT----MEKTFLIPFTKFAVLEVNLQENKILID 163
            +   GA  ++ +K       ++  L+P+T+  VL V+L   ++ ++
Sbjct: 127 HLLETGANDVMVVKPCAGSLDDRERLLPYTEQCVLAVDLAAGEMKVE 173


>gi|300811726|ref|ZP_07092200.1| 16S rRNA processing protein RimM [Lactobacillus delbrueckii subsp.
           bulgaricus PB2003/044-T3-4]
 gi|300497302|gb|EFK32350.1| 16S rRNA processing protein RimM [Lactobacillus delbrueckii subsp.
           bulgaricus PB2003/044-T3-4]
          Length = 167

 Score =  135 bits (339), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 37/167 (22%), Positives = 76/167 (45%), Gaps = 6/167 (3%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNR---YVLYSNDNRELRILKMYRKNKRFIA 62
               +  I  THGL GEV +    + P D  R    +   +D+RE+ +       + ++ 
Sbjct: 2   NYYNVGKIIATHGLKGEVKVALTTDFPEDRFRTGSRLYLGDDSREVTVAAGRPFKQFWLV 61

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMET-FDRQGKYWGQVCG 121
           TF+ I +I  A +L+  ++    +D    EL +  ++  DL   +   D  G+  G++  
Sbjct: 62  TFAEITDIDQAKKLKGTEILISEED--QGELPDGVYYYRDLLGCKVLDDESGEEIGELTD 119

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAG 168
           +   GA  I E+ +   K+F +P+    V  V++ + ++ ++ +   
Sbjct: 120 IEAPGANDIWEVTDEDGKSFWLPYIPQVVKSVDIDKKEVRVELMEGL 166


>gi|223044254|ref|ZP_03614291.1| 16S rRNA processing protein RimM [Staphylococcus capitis SK14]
 gi|222442404|gb|EEE48512.1| 16S rRNA processing protein RimM [Staphylococcus capitis SK14]
          Length = 167

 Score =  135 bits (339), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 43/168 (25%), Positives = 81/168 (48%), Gaps = 8/168 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNR-----YVLYSNDNRELRILKMYRKNKRFIA 62
           V +  I  THG+ GE+ + S ++      +      V ++N++ E  +          + 
Sbjct: 3   VEVGQIVNTHGIKGEIKVKSNSDFTETRFQPGENLIVKHNNEDIEYTVSSYRIHKGFHML 62

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F GI+NI+    L+   LY +R   +D EL+E EF+ +D+     FD      G+V  +
Sbjct: 63  KFEGINNINDIEHLKGDYLYQERDH-EDIELDEHEFYYSDIIGCTVFDDTDTPIGRVINI 121

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           +  GA  +  +K   +K +LIP+ +  V +++++   I I P+   L+
Sbjct: 122 FETGANDVWVVK--GDKEYLIPYIEDVVKDIDVEGRSIKITPMKGLLD 167


>gi|328885335|emb|CCA58574.1| 16S rRNA processing protein RimM [Streptomyces venezuelae ATCC
           10712]
          Length = 183

 Score =  135 bits (339), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 40/182 (21%), Positives = 82/182 (45%), Gaps = 5/182 (2%)

Query: 9   LMATIGTTHGLNGEVYIDSYANNPI-DLNRYVLYSNDN---RELRILKMYRKNKRFIATF 64
           ++A IG  HG+ GEV ++   + P   L    +   D      L I      + R +  F
Sbjct: 2   VVARIGRAHGIKGEVTVEVRTDEPELRLGPGAVLLTDPASAGPLTIETGRVHSGRLLLRF 61

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
            G+ + ++A  LR++ L A+    +  E EEDE+++  L +++     G   G++  + +
Sbjct: 62  EGVRDRNAAEALRNILLIAEVDPTELPE-EEDEYYDHQLMDLDVVLADGTEIGRITEISH 120

Query: 125 FGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQYDCPLD 184
             +  +  ++       +IPF +  V E++L+E + +IDP    +++        D   +
Sbjct: 121 LPSQDLFIVERPDGTELMIPFVESIVTEIDLEEQRAVIDPPPGLIDDRAEIVSSRDESGE 180

Query: 185 SA 186
             
Sbjct: 181 DE 182


>gi|298252294|ref|ZP_06976097.1| 16S rRNA processing protein RimM [Ktedonobacter racemifer DSM
           44963]
 gi|297546886|gb|EFH80754.1| 16S rRNA processing protein RimM [Ktedonobacter racemifer DSM
           44963]
          Length = 198

 Score =  135 bits (339), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 32/198 (16%), Positives = 75/198 (37%), Gaps = 11/198 (5%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDL---NRYVLYSNDN--RELRILKMYR 55
           M    +   +  I    G+ GE+ +    + P          + ++ +  +   I  +  
Sbjct: 3   MQNKTEWATIGKIVALFGVRGELKVLPLTDIPDRFTSLKAVHVSTDGHTFKRCIITSVRP 62

Query: 56  KNK-RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGK 114
                 +    GI + + A  LRD  L+    +    +L  D ++  D+  ++ +    +
Sbjct: 63  YKGDMLLVKLEGITSANDAEALRDQSLWIPESEL--AQLPPDSYYQHDILGLKVYTLSNQ 120

Query: 115 YWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNT-- 172
             GQ+  ++  G   +  ++    K  +IP  K  V ++++    + IDP+   L++   
Sbjct: 121 EVGQIVDLFPTGGNDVYVVRTPERKEVMIPAIKTVVHQIDVLRGVMYIDPLPGLLDDQAV 180

Query: 173 -TMKNPQYDCPLDSAGKK 189
               N +     D  G++
Sbjct: 181 LDNSNEEDKEGQDEFGEE 198


>gi|239944618|ref|ZP_04696555.1| 16S rRNA-processing protein [Streptomyces roseosporus NRRL 15998]
 gi|239991082|ref|ZP_04711746.1| 16S rRNA-processing protein [Streptomyces roseosporus NRRL 11379]
 gi|291448082|ref|ZP_06587472.1| 16S rRNA processing protein [Streptomyces roseosporus NRRL 15998]
 gi|291351029|gb|EFE77933.1| 16S rRNA processing protein [Streptomyces roseosporus NRRL 15998]
          Length = 203

 Score =  135 bits (339), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 38/191 (19%), Positives = 79/191 (41%), Gaps = 11/191 (5%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPI-DLNRYVLYSNDN---RELRILKMYRKNKRFIAT 63
           +++A IG  HG+ GEV ++   + P   L    + + +      L I      + R +  
Sbjct: 3   LVVARIGRAHGIKGEVTVEVRTDEPELRLGPGAVLATEPAATGPLTIETGRVHSGRLLLR 62

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F G+ +  +A  LR+  L A      +   EEDEF++  L +++     G   G++  + 
Sbjct: 63  FEGVRDRSAAEALRNTLLIADVDP-DELPEEEDEFYDHQLIDLDVVLADGTEIGRITEIS 121

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTM------KNP 177
           +  +  +  ++       +IPF +  V E++L+E + +I P    ++ +           
Sbjct: 122 HLPSQDLFIVERPDGSEVMIPFVEEIVTEIDLEEQRAVIAPPPGLIDESEAVIASSRDEE 181

Query: 178 QYDCPLDSAGK 188
             D   +    
Sbjct: 182 TGDAASEDDAS 192


>gi|253702082|ref|YP_003023271.1| 16S rRNA processing protein RimM [Geobacter sp. M21]
 gi|251776932|gb|ACT19513.1| 16S rRNA processing protein RimM [Geobacter sp. M21]
          Length = 172

 Score =  135 bits (339), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 36/174 (20%), Positives = 75/174 (43%), Gaps = 8/174 (4%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDN-----RELRILKMYRK 56
           +   K +L+  I  T G+ G++ +  +A +   +++       +         ++     
Sbjct: 1   MSGSKKLLIGKIQGTQGIKGQLRVIPFAGDASSISQLNEVFVKSPTGALEPFAVVSAKAH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
            KR I T    DNI+    L   ++YA R    +  L +DEF+ +DL  ++     G+  
Sbjct: 61  GKRVILTLRPFDNINQVLHLVGREIYADRVSLPE--LPDDEFYWSDLLGLQVATSDGEEL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           G++  +   G+  +  +K    +  LIP  +  VL ++L E ++ +      L+
Sbjct: 119 GELVDIIETGSNDVYVVK-KDGREVLIPALEDVVLSIDLAEGRMTVSLPEGLLD 171


>gi|225571998|ref|ZP_03780862.1| hypothetical protein RUMHYD_00292 [Blautia hydrogenotrophica DSM
           10507]
 gi|225040531|gb|EEG50777.1| hypothetical protein RUMHYD_00292 [Blautia hydrogenotrophica DSM
           10507]
          Length = 168

 Score =  134 bits (338), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 41/170 (24%), Positives = 74/170 (43%), Gaps = 6/170 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRE----LRILKMYRKNKR 59
           ++  + +  I +THG+ GEV +    N             D  +    L I  +    + 
Sbjct: 1   MEAFLQVGVISSTHGVRGEVKVFPTTNEKERFLDLDSVILDTGKERLTLEIEGVKFFKQF 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F G DNI+   + +   L+  R+      L EDE++  DL  M+     GKY+G++
Sbjct: 61  AILKFKGFDNINDIEKYKGKSLWIPREQ--AVPLSEDEYYIADLLGMDVVLEDGKYFGRL 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
             V   GA  +  ++    +  L+P  K  VL+V ++ N++ I  +   +
Sbjct: 119 EDVIETGANDVYVVRTEEGQEVLLPAIKECVLQVEVERNQMRIHLMKGLI 168


>gi|325273827|ref|ZP_08140012.1| 16S rRNA-processing protein RimM [Pseudomonas sp. TJI-51]
 gi|324101033|gb|EGB98694.1| 16S rRNA-processing protein RimM [Pseudomonas sp. TJI-51]
          Length = 178

 Score =  134 bits (338), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 31/169 (18%), Positives = 77/169 (45%), Gaps = 10/169 (5%)

Query: 3   KLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNK 58
           K D L+++  I + HG+ GEV + S+ +   +L  Y  ++       +++ ++      K
Sbjct: 7   KADDLIVVGKIFSVHGVRGEVKVYSFTDPIENLLDYPRWTLRHEGKVKQVELVSGRGSQK 66

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
             +    G+D+   A  L   ++   R    +   +E  ++   L  ++  ++    +G+
Sbjct: 67  GLVVKLKGLDDRDEARLLSGYEICIARSLLPNLAADE--YYWYQLVGLKVINQDEHLFGK 124

Query: 119 VCGVYNFGAGSILEIKNT----MEKTFLIPFTKFAVLEVNLQENKILID 163
           V  +   GA  ++ +K       ++  L+P+T+  VL ++L+   + ++
Sbjct: 125 VDHLLETGANDVMVVKPCAGSLDDRERLLPYTEQCVLAIDLEAGTMRVE 173


>gi|237746850|ref|ZP_04577330.1| ribosome maturation factor rimM [Oxalobacter formigenes HOxBLS]
 gi|229378201|gb|EEO28292.1| ribosome maturation factor rimM [Oxalobacter formigenes HOxBLS]
          Length = 179

 Score =  134 bits (338), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 43/165 (26%), Positives = 83/165 (50%), Gaps = 9/165 (5%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDL---NRYVLYSNDNRELRILKMYRKNKRFIA 62
            LV +  +G  +G+ G V I  Y+     L     + L S+ +RE+++L+   +    +A
Sbjct: 12  DLVEVGHVGGAYGIRGWVRIKPYSAGAEALLAVKEWWLDSSGSREVKVLQARWQGADVVA 71

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
             +G+ +  +A  LR   +   R+ F     +E E++  DL  +  F+RQG   G V G+
Sbjct: 72  CLAGVSDRDAAEALRGAVVRISRRHFPAP--DEGEYYWVDLIGLAVFNRQGDCLGTVKGL 129

Query: 123 YNFGAGSILEIKN----TMEKTFLIPFTKFAVLEVNLQENKILID 163
            + GA  +L+I+       ++  LIPF +  V +++++  K+ +D
Sbjct: 130 MDNGAHPVLQIETGMPEDKKRELLIPFVERHVGKIDIENRKMTVD 174


>gi|126698852|ref|YP_001087749.1| putative 16S rRNA processing protein [Clostridium difficile 630]
 gi|254974800|ref|ZP_05271272.1| putative 16S rRNA processing protein [Clostridium difficile
           QCD-66c26]
 gi|255092188|ref|ZP_05321666.1| putative 16S rRNA processing protein [Clostridium difficile CIP
           107932]
 gi|255306212|ref|ZP_05350384.1| putative 16S rRNA processing protein [Clostridium difficile ATCC
           43255]
 gi|255313927|ref|ZP_05355510.1| putative 16S rRNA processing protein [Clostridium difficile
           QCD-76w55]
 gi|255516606|ref|ZP_05384282.1| putative 16S rRNA processing protein [Clostridium difficile
           QCD-97b34]
 gi|255649706|ref|ZP_05396608.1| putative 16S rRNA processing protein [Clostridium difficile
           QCD-37x79]
 gi|260682862|ref|YP_003214147.1| putative 16S rRNA processing protein [Clostridium difficile CD196]
 gi|260686460|ref|YP_003217593.1| putative 16S rRNA processing protein [Clostridium difficile R20291]
 gi|306519819|ref|ZP_07406166.1| putative 16S rRNA processing protein [Clostridium difficile
           QCD-32g58]
 gi|123174578|sp|Q18BB6|RIMM_CLOD6 RecName: Full=Ribosome maturation factor rimM
 gi|115250289|emb|CAJ68111.1| 16S rRNA processing protein RimM [Clostridium difficile]
 gi|260209025|emb|CBA62124.1| putative 16S rRNA processing protein [Clostridium difficile CD196]
 gi|260212476|emb|CBE03385.1| putative 16S rRNA processing protein [Clostridium difficile R20291]
          Length = 171

 Score =  134 bits (338), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 52/173 (30%), Positives = 82/173 (47%), Gaps = 5/173 (2%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDL---NRYVLYSNDNRELRILKMYRKN 57
           M +      +  I  T GL GEV +    ++         + L  + N +L + K+  K 
Sbjct: 1   MKEKLTHFKVGQIVNTQGLKGEVRVYPLTDDIERFDELKDFYLGKDLNNKLAVEKVRYKG 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              I    GID+I  A +L++  +Y  R+D    ELEE EFF  D+  ME     GKY G
Sbjct: 61  SMVIMKIKGIDSIEKAEKLKNKFMYVSRED--SRELEEGEFFIADMIGMEVLTVDGKYVG 118

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
            +  V  + A  +  +K   +K F+IP  K  V  +++ E K++IDPI   ++
Sbjct: 119 ILEDVLQYSANDVYVVKGEEDKEFMIPAIKKFVPTIDIDERKMIIDPIKGMID 171


>gi|192360672|ref|YP_001981923.1| 16S rRNA-processing protein RimM [Cellvibrio japonicus Ueda107]
 gi|209573579|sp|B3PDH6|RIMM_CELJU RecName: Full=Ribosome maturation factor rimM
 gi|190686837|gb|ACE84515.1| 16S rRNA processing protein RimM [Cellvibrio japonicus Ueda107]
          Length = 178

 Score =  134 bits (338), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 40/172 (23%), Positives = 70/172 (40%), Gaps = 13/172 (7%)

Query: 3   KLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNR----ELRILKMYRKNK 58
           K   LV +  I   +G+ G V + SY     +L  Y  +    R    ++ I +      
Sbjct: 4   KSSNLVSVGRITAVYGIKGWVKVHSYTEPQDNLFEYHPWWVKTRHGVKQVEIDEARPHGD 63

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY--W 116
            ++A   G+D+   A       +  +R    +  LE+ E++   LE +  F   G     
Sbjct: 64  AYVAHIKGVDDRDLAMAYTAADIAVERDLLPE--LEDGEYYWNQLEGLSVFTVFGGEQRL 121

Query: 117 GQVCGVYNFGAGSILEIKNT----MEKTFLIPFTK-FAVLEVNLQENKILID 163
           G V  +   GA  +L ++       ++  LIP+     VL V+L   +IL+D
Sbjct: 122 GVVTKLLETGANDVLVVQGDAQSIDQRERLIPYVPGQFVLSVDLDSKRILVD 173


>gi|255100272|ref|ZP_05329249.1| putative 16S rRNA processing protein [Clostridium difficile
           QCD-63q42]
          Length = 171

 Score =  134 bits (338), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 52/173 (30%), Positives = 82/173 (47%), Gaps = 5/173 (2%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDL---NRYVLYSNDNRELRILKMYRKN 57
           M +      +  I  T GL GEV +    ++         + L  + N +L + K+  K 
Sbjct: 1   MKEKLTHFKVGQIVNTQGLKGEVRVYPLTDDIERFDELKDFYLGKDLNNKLAVEKVRYKG 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              I    GID+I  A +L++  +Y  R+D    ELEE EFF  D+  ME     GKY G
Sbjct: 61  SMVIMKIKGIDSIEKAEKLKNKFMYVARED--SRELEEGEFFIADMIGMEVLTVDGKYVG 118

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
            +  V  + A  +  +K   +K F+IP  K  V  +++ E K++IDPI   ++
Sbjct: 119 ILEDVLQYSANDVYVVKGEEDKEFMIPAIKKFVPTIDIDERKMIIDPIKGMID 171


>gi|127511997|ref|YP_001093194.1| 16S rRNA-processing protein [Shewanella loihica PV-4]
 gi|171855242|sp|A3QBT7|RIMM_SHELP RecName: Full=Ribosome maturation factor rimM
 gi|126637292|gb|ABO22935.1| 16S rRNA processing protein RimM [Shewanella loihica PV-4]
          Length = 176

 Score =  134 bits (338), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 46/173 (26%), Positives = 82/173 (47%), Gaps = 12/173 (6%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRK 56
           M    + V++  +G +HG+ G + I SY ++  D+  Y  +      + RE+++ +   +
Sbjct: 1   MSSHQEPVVLGKLGASHGIKGWLKITSYTDSVEDIFDYSPWLIKEQGEWREVKVAQWRYQ 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
            K  IA   G+     A  L + ++    +  K   L EDEF+  DL   E  + +G   
Sbjct: 61  GKAIIAALEGVTTRDQAQMLTNCEIAIPAEAMKA--LPEDEFYWRDLIGCEVVNTKGYKM 118

Query: 117 GQVCGVYNFGAGSILEIKNT-----MEKTFLIPFT-KFAVLEVNLQENKILID 163
           G+V  +   G+  +L +K        +   +IPF  +  +LEVNL E +IL+D
Sbjct: 119 GKVDQIVETGSNDVLLVKANAKDGFGKTERMIPFVTEQFILEVNLAEKQILVD 171


>gi|146329006|ref|YP_001209896.1| 16S rRNA processing protein RimM [Dichelobacter nodosus VCS1703A]
 gi|166985943|sp|A5EXZ2|RIMM_DICNV RecName: Full=Ribosome maturation factor rimM
 gi|146232476|gb|ABQ13454.1| 16S rRNA processing protein RimM [Dichelobacter nodosus VCS1703A]
          Length = 175

 Score =  134 bits (338), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 42/178 (23%), Positives = 80/178 (44%), Gaps = 8/178 (4%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRK 56
           M     L+ +  I   HG+ G V I S       +  Y ++     +  + L++L   R 
Sbjct: 1   MKAQPTLIALGRIIGVHGVRGWVKIHSECRPREAIFNYSVFQATRHHHAQTLKLLDARRS 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
            K  IA F+ I +  +A +L    L   R D    +L+  +++ TD+  +   +R G++ 
Sbjct: 61  GKSLIALFADICDRDAALQLNGFTLNVTRADLP--QLKNGQYYWTDVLGLTVINRSGEHL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKF-AVLEVNLQENKILIDPIAAGLNNTT 173
           G+VC ++  GA  +L I N   + +LIPF     +  ++ +   + +D   A  ++  
Sbjct: 119 GKVCDIFETGANDVLVI-NKDGQEYLIPFISERYIDRIDFENKYLYVDWQMAWTDDAD 175


>gi|291539679|emb|CBL12790.1| 16S rRNA processing protein RimM [Roseburia intestinalis XB6B4]
          Length = 194

 Score =  134 bits (338), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 38/179 (21%), Positives = 75/179 (41%), Gaps = 6/179 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRE----LRILKMYRKNKR 59
           ++ L+ +  I TTHG+ GEV +    ++     +      D  +    L I  +      
Sbjct: 18  MENLLQVGVITTTHGVRGEVKVFPTTDDAARFKKLKQVILDTGKEHLALEIAGVKFFKNM 77

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F G DNI+     R   LY  R++    +L+++E+F  DL  ++    +G+  G++
Sbjct: 78  VILKFKGYDNINDVEMFRKKSLYVTREN--AVKLKKNEYFIADLIGLKMISDEGEDLGEL 135

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQ 178
             V   GA  +  I        L+P  K  V +V+++   + +  +    +  + +   
Sbjct: 136 TDVLQTGANDVYVISKEGADDILLPAIKDCVKQVDIEGGTMQVHLLDGLRDLNSRREEA 194


>gi|291545205|emb|CBL18314.1| 16S rRNA processing protein RimM [Ruminococcus sp. 18P13]
          Length = 170

 Score =  134 bits (338), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 42/172 (24%), Positives = 73/172 (42%), Gaps = 5/172 (2%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYV-LYSNDNRELRILKMYRKNKRFIA 62
              L+ +  +   HGL G+V I  + ++   L  +  LY  D   + ++         + 
Sbjct: 2   QKNLLEIGKVVNIHGLRGDVKIQPWCDSAGFLCEFDTLYRADGTPMSVVSARAHKGMAVV 61

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMET-FDRQGKYWGQVCG 121
            F+GID    A  LR+  LY  R D    EL+ D +F  DL  ++      G  +G++  
Sbjct: 62  RFAGIDTPEQAEALRNTVLYMNRAD---VELDADTYFIRDLIGLQVLDADTGAVYGRLEE 118

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTT 173
           V   GA  +  I+    K  L P     V+E +L++  + I P+    ++  
Sbjct: 119 VLETGANDVYTIRTPEGKQLLFPAIGDVVVETDLEQGIMRIRPLEGLFDDAD 170


>gi|319649587|ref|ZP_08003743.1| 16S rRNA processing protein RimM [Bacillus sp. 2_A_57_CT2]
 gi|317398749|gb|EFV79431.1| 16S rRNA processing protein RimM [Bacillus sp. 2_A_57_CT2]
          Length = 173

 Score =  134 bits (338), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 41/174 (23%), Positives = 70/174 (40%), Gaps = 10/174 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR--------YVLYSNDNRELRILKMYR 55
           + K   +  I  THG+ GE  + S  +   +  +              D  EL +     
Sbjct: 1   MQKWFNVGKIVNTHGIKGEARVISKTDFAEERYKPGNKLYLFMPDTKGDPIELTVKTHRT 60

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
                + TF G +NI+   +++   L        D  LEEDEF+  ++         G  
Sbjct: 61  HKTFDLLTFEGYENINGIEKMKGGILKISEDQLGD--LEEDEFYYHEIIGCTVETLDGAE 118

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
            G++  + + GA  +  IK    K  LIP+ +  V EVN+++  + I+ I   L
Sbjct: 119 VGKIKEILSPGANDVWVIKAKGGKEILIPYIEDVVKEVNVKDKLVKINAIEGLL 172


>gi|57866698|ref|YP_188388.1| 16S rRNA-processing protein RimM [Staphylococcus epidermidis RP62A]
 gi|242242522|ref|ZP_04796967.1| 16S rRNA processing protein RimM [Staphylococcus epidermidis
           W23144]
 gi|67461258|sp|Q5HPV2|RIMM_STAEQ RecName: Full=Ribosome maturation factor rimM
 gi|57637356|gb|AAW54144.1| 16S rRNA processing protein RimM [Staphylococcus epidermidis RP62A]
 gi|242234030|gb|EES36342.1| 16S rRNA processing protein RimM [Staphylococcus epidermidis
           W23144]
          Length = 167

 Score =  134 bits (338), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 41/168 (24%), Positives = 76/168 (45%), Gaps = 8/168 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNR-----YVLYSNDNRELRILKMYRKNKRFIA 62
           V +  I  THG+ GEV + S ++      +      V ++N      +          + 
Sbjct: 3   VEVGQIVNTHGIKGEVKVKSNSDFTETRFQPGEQLLVKHNNTEIVYTVDSYRIHKGFHML 62

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F GI+NI+    L+   +Y +R   +D EL E E++ +D+     F       G+V  +
Sbjct: 63  RFEGINNINDIEHLKGDYIYQERDH-QDIELGEHEYYYSDIIGCTVFKDDDTPIGRVINI 121

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           +  GA  +  +K   EK +LIP+ +  V +++++   I I P+   L+
Sbjct: 122 FETGANDVWIVK--GEKEYLIPYIEDVVKDIDIENKTIKITPMEGLLD 167


>gi|120403181|ref|YP_953010.1| 16S rRNA-processing protein RimM [Mycobacterium vanbaalenii PYR-1]
 gi|166226458|sp|A1T754|RIMM_MYCVP RecName: Full=Ribosome maturation factor rimM
 gi|119955999|gb|ABM13004.1| 16S rRNA processing protein RimM [Mycobacterium vanbaalenii PYR-1]
          Length = 172

 Score =  134 bits (338), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 38/170 (22%), Positives = 68/170 (40%), Gaps = 8/170 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLN-------RYVLYSNDNRELRILKMYRKNKRF 60
           +++  +   HG+ GE+ +D   ++P                    RE  I  +     R 
Sbjct: 3   LVVGRVVKAHGVTGELAVDVRTDDPEGRFVAGAVLRGRPARGGAEREFVIESVRSHGDRM 62

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +    G+ +  +A  LR         +    E  ++ F++  LE M      G+  G V 
Sbjct: 63  LIRLQGVGDRDAADALRGTLFLVDSAELPPIEDPDE-FYDHQLEGMAVSTTGGQPVGTVA 121

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
            V +  AG +L +++      L+PF    V+ V+L +N I IDP    L+
Sbjct: 122 EVLHTAAGELLAVRDPDGAEVLVPFVSAIVVSVSLADNAIEIDPPEGLLD 171


>gi|163750614|ref|ZP_02157851.1| 16S rRNA-processing protein [Shewanella benthica KT99]
 gi|161329609|gb|EDQ00600.1| 16S rRNA-processing protein [Shewanella benthica KT99]
          Length = 176

 Score =  134 bits (338), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 43/173 (24%), Positives = 84/173 (48%), Gaps = 12/173 (6%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRK 56
           M    + V++  +G++HG+ G + I +Y ++   +  Y  +      + RE+++L+   +
Sbjct: 1   MSSKQEPVVLGKLGSSHGIKGWLKITTYTDSVEGIFDYSPWLIKEQGEWREVKVLQWRFQ 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
            K  +A+  G++    A  L + ++    Q  K   L EDEF+  DL   E  + +G   
Sbjct: 61  GKAVVASLEGVETRDQAQILTNCEIAVTPQQMK--TLPEDEFYWRDLIGCEVVNTKGYNM 118

Query: 117 GQVCGVYNFGAGSILEIKNT-----MEKTFLIPFT-KFAVLEVNLQENKILID 163
           G+V  +   G+  +L +K        +   +IPF  +  ++EVNL E +I +D
Sbjct: 119 GKVQEIVETGSNDVLLVKANAKDGFGKAERMIPFVTEQFIIEVNLAEKQITVD 171


>gi|170765933|ref|ZP_02900744.1| 16S rRNA processing protein RimM [Escherichia albertii TW07627]
 gi|170125079|gb|EDS94010.1| 16S rRNA processing protein RimM [Escherichia albertii TW07627]
          Length = 183

 Score =  134 bits (338), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 31/172 (18%), Positives = 74/172 (43%), Gaps = 12/172 (6%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRFI 61
             +++  +G+++G+ G + + S   +   +  Y  +        +++++      N+  I
Sbjct: 13  DPIVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQQVQLESWKHHNQDMI 72

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               G+D+  +A+ L + ++          +LEE +++  DL   +    +G   G+V  
Sbjct: 73  IKLKGVDDRDAANLLTNCEIVVDSSQLP--QLEEGDYYWKDLMGCQVVTTEGYDLGKVVD 130

Query: 122 VYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILIDPIAA 167
           +   G+  +L IK  ++     K  L+PF     + +V+L    I +D    
Sbjct: 131 MMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLATRLIEVDWDPG 182


>gi|71281652|ref|YP_270723.1| 16S rRNA-processing protein RimM [Colwellia psychrerythraea 34H]
 gi|109893008|sp|Q47WU9|RIMM_COLP3 RecName: Full=Ribosome maturation factor rimM
 gi|71147392|gb|AAZ27865.1| 16S rRNA processing protein RimM [Colwellia psychrerythraea 34H]
          Length = 176

 Score =  134 bits (338), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 40/177 (22%), Positives = 76/177 (42%), Gaps = 12/177 (6%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRK 56
           M   +K +++  +G  +G+ G + I S+ +    +  Y  +S    N+ + + I    + 
Sbjct: 1   MSTEEKKIILGKVGAVYGIKGWLKIHSFTDETEAILDYFPWSLKLGNNTQTVEITDWRKH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           NK  I   +GID+   A  L   ++        +  L ED+F+  DL  M     +G   
Sbjct: 61  NKVLIVKVAGIDDRDEAQALVGSEILTNEAALPE--LSEDDFYWRDLIGMSVVTNKGYDL 118

Query: 117 GQVCGVYNFGAGSILEIKNT-----MEKTFLIPFT-KFAVLEVNLQENKILIDPIAA 167
           G V  +   GA  +L +K        +K  LIP+  +  +  V+++  +I +D    
Sbjct: 119 GVVTDMMETGANDVLVVKANLKDGFSKKERLIPYLFEQVIESVSIENKQICVDWDPG 175


>gi|260775498|ref|ZP_05884395.1| 16S rRNA processing protein RimM [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260608679|gb|EEX34844.1| 16S rRNA processing protein RimM [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 182

 Score =  134 bits (337), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 38/173 (21%), Positives = 74/173 (42%), Gaps = 12/173 (6%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRF 60
            + +++   G T+G+ G + + SY +N   +  Y  +      +  E ++    R NK  
Sbjct: 11  SEKIVVGKFGATYGIRGWLKVFSYTDNTESIFDYAPWFINQKGEWVERKVESWKRHNKGL 70

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +    G+D    A  L + ++        +  L EDEF+  DL  M+    +G   G V 
Sbjct: 71  VVKLEGLDVREEAQLLTNFEIAIDPAVLPE--LPEDEFYWRDLIGMQVVTDKGYDLGTVS 128

Query: 121 GVYNFGAGSILEIKNT-----MEKTFLIPFTKFAVLE-VNLQENKILIDPIAA 167
            +   G+  +L +K        +K  LIPF +  V++ ++ +  +I +D    
Sbjct: 129 DMLETGSNDVLVVKANLKDAFGQKERLIPFLEEQVIKLIDREAQRIEVDWDPG 181


>gi|114567015|ref|YP_754169.1| 16S rRNA processing protein RimM [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
 gi|122317986|sp|Q0AWV6|RIMM_SYNWW RecName: Full=Ribosome maturation factor rimM
 gi|114337950|gb|ABI68798.1| 16S rRNA processing protein RimM [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
          Length = 172

 Score =  134 bits (337), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 34/174 (19%), Positives = 68/174 (39%), Gaps = 6/174 (3%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKN 57
           +  DKLV +  I  T+G  G + +    + P    +                +  +   N
Sbjct: 1   MNSDKLVAIGKIAGTYGYAGWLKVIPLTDFPERFYKLDKVILNQGGKLGTFLVDGLKAHN 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
             ++  FSGID +  A   ++  L     +     L E  F++  L+ +  +D +    G
Sbjct: 61  NFYLFKFSGIDTVEVAQGFQNGILQIDESEL--YPLPEGYFYHFQLQGLSVYDEEKGLLG 118

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN 171
           ++  +   GA  +  + +      LIP  K  +L V L+E ++ I  +   + +
Sbjct: 119 ELTDIIETGANDVYVVDSPQYGEILIPAIKDVILAVKLEEKRMEIKLLPGLIED 172


>gi|323493647|ref|ZP_08098768.1| 16S rRNA-processing protein RimM [Vibrio brasiliensis LMG 20546]
 gi|323312170|gb|EGA65313.1| 16S rRNA-processing protein RimM [Vibrio brasiliensis LMG 20546]
          Length = 182

 Score =  134 bits (337), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 36/173 (20%), Positives = 69/173 (39%), Gaps = 12/173 (6%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRF 60
           D  +++   G T+G+ G + + SY +N   +  Y  +         E ++    R NK  
Sbjct: 11  DDKIVVGKFGATYGIRGWLKVFSYTDNTESIFDYTPWFIKQGEKWVEYKVESWKRHNKGL 70

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +     +D    A  + + ++        +  L  DEF+  DL  M+    +G   G V 
Sbjct: 71  VVKLEDLDVREEAQLMTNFEISIDPAVLPE--LPSDEFYWRDLIGMQVVTDKGYDLGIVS 128

Query: 121 GVYNFGAGSILEIKNT-----MEKTFLIPFTKF-AVLEVNLQENKILIDPIAA 167
            +   G+  +L IK        +K  LIPF +   +  ++ +  +I +D    
Sbjct: 129 DMLETGSNDVLVIKANLKDAFGQKERLIPFLEEQVIKNIDREAQRIEVDWDPG 181


>gi|26988196|ref|NP_743621.1| 16S rRNA-processing protein RimM [Pseudomonas putida KT2440]
 gi|37999637|sp|Q88MV5|RIMM_PSEPK RecName: Full=Ribosome maturation factor rimM
 gi|24982933|gb|AAN67085.1|AE016337_8 16S rRNA processing protein RimM [Pseudomonas putida KT2440]
 gi|313500312|gb|ADR61678.1| RimM [Pseudomonas putida BIRD-1]
          Length = 178

 Score =  134 bits (337), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 31/169 (18%), Positives = 78/169 (46%), Gaps = 10/169 (5%)

Query: 3   KLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNK 58
           K D L+++  I + HG+ GEV + S+ +   +L  Y  ++       +++ ++      K
Sbjct: 7   KADDLIVVGKIFSVHGVRGEVKVYSFTDPIENLLDYPRWTLRHEGKVKQVELVSGRGSQK 66

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
             +    G+D+   A  L   ++   R    +   +E  ++   L  ++  ++  + +G+
Sbjct: 67  GLVVKLKGLDDRDEARLLSGYEICIPRSLLPNLAADE--YYWYQLVGLKVINQDEQLFGK 124

Query: 119 VCGVYNFGAGSILEIKNT----MEKTFLIPFTKFAVLEVNLQENKILID 163
           V  +   GA  ++ +K       ++  L+P+T+  VL ++L+   + ++
Sbjct: 125 VDHLLETGANDVMVVKPCAGSLDDRERLLPYTEQCVLAIDLEAGVMRVE 173


>gi|254509201|ref|ZP_05121298.1| 16S rRNA processing protein RimM [Vibrio parahaemolyticus 16]
 gi|219547859|gb|EED24887.1| 16S rRNA processing protein RimM [Vibrio parahaemolyticus 16]
          Length = 182

 Score =  134 bits (337), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 35/173 (20%), Positives = 70/173 (40%), Gaps = 12/173 (6%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRF 60
           +  +++  +G ++G+ G + + SY +N   +  Y  +         E ++    R NK  
Sbjct: 11  EDKIVVGKLGASYGIRGWLKVFSYTDNAESMFDYTPWFINQGGKWVEYKVESWKRHNKGL 70

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +    G+D    A  L + ++        +  L  DEF+  DL  M     +G   G V 
Sbjct: 71  VVKLEGLDVREDAQLLTNFEISIDPAVLPE--LPSDEFYWRDLIGMHVVTDKGYDLGTVS 128

Query: 121 GVYNFGAGSILEIKNT-----MEKTFLIPFTKF-AVLEVNLQENKILIDPIAA 167
            +   G+  +L +K        +K  LIPF +   +  ++ +  +I +D    
Sbjct: 129 DMLETGSNDVLVVKANLKDAFGQKERLIPFLEEQVIKHIDREAQRIEVDWDPG 181


>gi|210622536|ref|ZP_03293229.1| hypothetical protein CLOHIR_01177 [Clostridium hiranonis DSM 13275]
 gi|210154171|gb|EEA85177.1| hypothetical protein CLOHIR_01177 [Clostridium hiranonis DSM 13275]
          Length = 172

 Score =  134 bits (337), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 46/174 (26%), Positives = 77/174 (44%), Gaps = 5/174 (2%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDL---NRYVLYSNDNRELRILKMYRKN 57
           M K      +  I  T GL G+V +    ++         + +  +      +  +  K 
Sbjct: 1   MAKKVTHFKVGKIVKTQGLKGDVRVYPTTDDIYRFDYLEEFYVGKDRENPWEVEDVRYKG 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              I    GID +  A +L    +Y  R +    ELEE EFF  D+  M+ +   G+  G
Sbjct: 61  NLVIMKIKGIDRVEEAEKLVGKDIYVSRDE--SFELEEGEFFIADMIGMDVYTVSGEKVG 118

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN 171
            +  V  + A  +  IKN   K +LIP     V E++++E+K++IDPI   L++
Sbjct: 119 VLKEVLQYSANDVYVIKNEEGKEYLIPAVMKFVPEIDIEEDKMIIDPIKGMLDD 172


>gi|258508636|ref|YP_003171387.1| 16S rRNA-processing protein RimM [Lactobacillus rhamnosus GG]
 gi|258539813|ref|YP_003174312.1| 16S rRNA-processing protein RimM [Lactobacillus rhamnosus Lc 705]
 gi|257148563|emb|CAR87536.1| 16S rRNA processing protein rimM [Lactobacillus rhamnosus GG]
 gi|257151489|emb|CAR90461.1| 16S rRNA processing protein rimM [Lactobacillus rhamnosus Lc 705]
          Length = 172

 Score =  134 bits (337), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 33/174 (18%), Positives = 67/174 (38%), Gaps = 6/174 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNRELRILKMYRKNKR 59
           +     + TI  THG+ GEV +    + P    +      + +     L I  + +    
Sbjct: 1   MPDYYDIGTIVNTHGIRGEVRVLVTTDFPEQRFKVGNKVYVATTPKTALTINSVRQHKGL 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            + TF    +I+     +  KL       K   LEE  ++  D+  +   D  G+  G+V
Sbjct: 61  TMLTFKDYTDINQVLPFKGKKLQVTEAALKP--LEEGSYYYKDIIGLTVIDEHGQTLGKV 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTT 173
             + + G   +  I    +   L+PF K  V  ++L++ +  +      +++  
Sbjct: 119 SEILSPGPNDVWVIPRPGKSELLLPFLKSVVQTIDLEQKEAHVIVPEGLIDDAD 172


>gi|154503293|ref|ZP_02040353.1| hypothetical protein RUMGNA_01117 [Ruminococcus gnavus ATCC 29149]
 gi|153795960|gb|EDN78380.1| hypothetical protein RUMGNA_01117 [Ruminococcus gnavus ATCC 29149]
          Length = 172

 Score =  134 bits (337), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 40/173 (23%), Positives = 81/173 (46%), Gaps = 8/173 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRE----LRILKMYRKNKR 59
           +++ + +  I +THG+ GEV +    ++P    +      + ++    L +  +    + 
Sbjct: 1   MEQFLQVGVISSTHGIRGEVKVFPTTDDPNRFKKLKKVILETKKEKLSLEVQGVKFFKQF 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQG--KYWG 117
            I  F GIDNI+   + +   L+  R+D     LEEDE+F  DL  ME +  +   + +G
Sbjct: 61  VIVKFKGIDNINDIEQYKGCSLFVSRED--AVALEEDEYFIADLIGMEVYTDENPEELFG 118

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
            +  V   GA  +  +++      LIP  +  +L V+++  K+ +  +   L+
Sbjct: 119 TLKDVIETGANEVYLVESKTHGEVLIPAIRQCILSVDVKAQKMQVHLLNGLLD 171


>gi|294815372|ref|ZP_06774015.1| 16S rRNA-processing protein RimM [Streptomyces clavuligerus ATCC
           27064]
 gi|294327971|gb|EFG09614.1| 16S rRNA-processing protein RimM [Streptomyces clavuligerus ATCC
           27064]
          Length = 244

 Score =  134 bits (337), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 35/168 (20%), Positives = 75/168 (44%), Gaps = 5/168 (2%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPI-DLNRYVLYSNDN---RELRILKMYRKNKRFIAT 63
           +++  IG  HG+ GEV ++   + P   L    +   D      L I      + R +  
Sbjct: 28  LVVGRIGRAHGVKGEVSVEVRTDEPELRLGPGAVLLTDPPARGPLTIETGRVHSGRLLLR 87

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F+G+ + + A  LR+  L A   D +     +DE+++  L +++     G   G++  + 
Sbjct: 88  FAGVRDRNGAEALRETLLIADV-DPEASPEGDDEYYDHQLIDLDVVTVDGTEVGRITEIS 146

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN 171
           +  +  +  ++       +IPF    V  ++L+E + +IDP    +++
Sbjct: 147 HLPSQDLFIVERPDGTEVMIPFVTEIVTSIDLEEQRAVIDPPPGLIDD 194


>gi|251788623|ref|YP_003003344.1| 16S rRNA-processing protein RimM [Dickeya zeae Ech1591]
 gi|247537244|gb|ACT05865.1| 16S rRNA processing protein RimM [Dickeya zeae Ech1591]
          Length = 182

 Score =  134 bits (337), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 31/172 (18%), Positives = 74/172 (43%), Gaps = 12/172 (6%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND----NRELRILKMYRKNKRFI 61
             +++  +G+T+G+ G + + S   +   +  Y  +        + + I      N+  +
Sbjct: 12  NPIVLGKLGSTYGIKGWLRVFSSTEDAESIFDYQPWFIRNKGLWQPIEIESWRHHNQDLV 71

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               GID+  +A+ L + ++        +  L+E +++  DL   +     G   G+V  
Sbjct: 72  IKLKGIDDREAANLLTNCEIVVDSAQLPE--LDEGDYYWKDLIGCDVVTIGGYELGKVID 129

Query: 122 VYNFGAGSILEIKNTME-----KTFLIPF-TKFAVLEVNLQENKILIDPIAA 167
           +   G+  +L ++  ++     K  LIPF T+  +  ++L  ++I +D    
Sbjct: 130 MMETGSNDVLVVRANLKDAYGVKERLIPFLTEQVIKHIDLSTHRIEVDWDPG 181


>gi|77457247|ref|YP_346752.1| 16S rRNA-processing protein RimM [Pseudomonas fluorescens Pf0-1]
 gi|109893035|sp|Q3KHJ3|RIMM_PSEPF RecName: Full=Ribosome maturation factor rimM
 gi|77381250|gb|ABA72763.1| 16S rRNA processing protein [Pseudomonas fluorescens Pf0-1]
          Length = 178

 Score =  134 bits (337), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 34/169 (20%), Positives = 78/169 (46%), Gaps = 10/169 (5%)

Query: 3   KLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDN----RELRILKMYRKNK 58
           K D L+++  I + HG+ GEV + S+ +   +L  Y  ++       +++ ++      K
Sbjct: 7   KADDLIVVGKIFSVHGVRGEVKVFSFTDPIENLLGYRNWTLRREGVVKQVELVSGRSTQK 66

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
             +    G+D+   A  L   ++   R    D   +E  ++   LE +   ++  + +G+
Sbjct: 67  DLVVKLKGLDDRDEARLLSGYEICIPRSLLPDLTADE--YYWYQLEGLSVINQDEQLFGK 124

Query: 119 VCGVYNFGAGSILEIKNT----MEKTFLIPFTKFAVLEVNLQENKILID 163
           V  +   GA  +L +K       ++  L+P+T+  VL ++L+   + ++
Sbjct: 125 VDHLLETGANDVLVVKPCVGSLDDRERLLPYTEQCVLAIDLEAGVMRVE 173


>gi|73662837|ref|YP_301618.1| 16S rRNA-processing protein RimM [Staphylococcus saprophyticus
           subsp. saprophyticus ATCC 15305]
 gi|109893055|sp|Q49X25|RIMM_STAS1 RecName: Full=Ribosome maturation factor rimM
 gi|72495352|dbj|BAE18673.1| RimM protein required for 16S rRNA processing [Staphylococcus
           saprophyticus subsp. saprophyticus ATCC 15305]
          Length = 168

 Score =  134 bits (337), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 40/170 (23%), Positives = 76/170 (44%), Gaps = 9/170 (5%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNR------YVLYSNDNRELRILKMYRKNKRF 60
            V +  I  THG+ GE+ + S ++      +          + +  E  I          
Sbjct: 2   KVEIGKIVNTHGIKGEIKVKSNSDFTETRFQPGELVIIERKNKEPLEFTIASYRMHKGLH 61

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           + TF GI+NI+    L+   +  +R   ++ EL E EF+ +D+     FD      G+V 
Sbjct: 62  MLTFEGINNINDIEYLKGETIMQERDH-EEIELGEHEFYYSDIIGCTVFDDDDTPIGRVT 120

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
            ++  GA  +  +K   +K +LIP+    V +++++  +I I P+   L+
Sbjct: 121 EIFETGANDVWVVK--GDKEYLIPYIADVVKDIDVEGRRIQITPMEGLLD 168


>gi|302865889|ref|YP_003834526.1| 16S rRNA processing protein RimM [Micromonospora aurantiaca ATCC
           27029]
 gi|302568748|gb|ADL44950.1| 16S rRNA processing protein RimM [Micromonospora aurantiaca ATCC
           27029]
          Length = 179

 Score =  134 bits (337), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 40/178 (22%), Positives = 71/178 (39%), Gaps = 15/178 (8%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNR-----------YVLYSNDNR---ELRILK 52
           L+++  IG  HG+ GEV ++   + P                        R    L +  
Sbjct: 2   LLVVGRIGKPHGIRGEVTVEVRTDEPEARFAPGSVLTTEPGVVPSEPGAWRVPPTLTVES 61

Query: 53  MYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQ 112
                 R +  F G+     A  LR+  L     D    E + +EF +  L  +    R 
Sbjct: 62  ARWHQGRLLVAFEGVLERDVAEALRNTLLGVDSADVAPPE-DPEEFHDHQLVGLTVVTRD 120

Query: 113 GKYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           G++ G+V  + +  A  +L ++    +T L+PF K  V EV+L   ++++D     L+
Sbjct: 121 GEHVGEVARIDHAPASEMLVLRRPEGRTALVPFVKAIVPEVDLAGGRVVVDLPGGLLD 178


>gi|148549464|ref|YP_001269566.1| 16S rRNA-processing protein RimM [Pseudomonas putida F1]
 gi|166226468|sp|A5W8C2|RIMM_PSEP1 RecName: Full=Ribosome maturation factor rimM
 gi|148513522|gb|ABQ80382.1| 16S rRNA processing protein RimM [Pseudomonas putida F1]
          Length = 178

 Score =  134 bits (337), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 31/169 (18%), Positives = 78/169 (46%), Gaps = 10/169 (5%)

Query: 3   KLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNK 58
           K D L+++  I + HG+ GEV + S+ +   +L  Y  ++       +++ ++      K
Sbjct: 7   KADDLIVVGKIFSVHGVRGEVKVYSFTDPIENLLDYPRWTLRHEGKVKQVELVSGRGSQK 66

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
             +    G+D+   A  L   ++   R    +   +E  ++   L  ++  ++  + +G+
Sbjct: 67  GLVVKLKGLDDRDEARLLSGYEICIPRSLLPNLAADE--YYWYQLVGLKVINQDEQLFGK 124

Query: 119 VCGVYNFGAGSILEIKNT----MEKTFLIPFTKFAVLEVNLQENKILID 163
           V  +   GA  ++ +K       ++  L+P+T+  VL ++L+   + ++
Sbjct: 125 VDHMLETGANDVMVVKPCAGSLDDRERLLPYTEQCVLAIDLEAGVMRVE 173


>gi|301050478|ref|ZP_07197357.1| 16S rRNA processing protein RimM [Escherichia coli MS 185-1]
 gi|300297825|gb|EFJ54210.1| 16S rRNA processing protein RimM [Escherichia coli MS 185-1]
          Length = 183

 Score =  134 bits (337), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 32/184 (17%), Positives = 76/184 (41%), Gaps = 19/184 (10%)

Query: 1   MVKLD-------KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELR 49
           M+            +++  +G+++G+ G + + S   +   +  Y  +        ++++
Sbjct: 1   MMSKQLTAQASVDPIVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQQVQ 60

Query: 50  ILKMYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETF 109
           +      N+  I    G+D+  +A+ L + ++          +LEE +++  DL   +  
Sbjct: 61  LESWKHHNQDMIIKLKGVDDRDAANLLTNCEIVVDSSQLP--QLEEGDYYWKDLMGCQVV 118

Query: 110 DRQGKYWGQVCGVYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILID 163
             +G   G+V  +   G+  +L IK  ++     K  L+PF     + +V+L    I +D
Sbjct: 119 TTEGYDLGKVVDMMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLTTRSIEVD 178

Query: 164 PIAA 167
               
Sbjct: 179 WDPG 182


>gi|167623032|ref|YP_001673326.1| 16S rRNA-processing protein RimM [Shewanella halifaxensis HAW-EB4]
 gi|189040853|sp|B0TJ76|RIMM_SHEHH RecName: Full=Ribosome maturation factor rimM
 gi|167353054|gb|ABZ75667.1| 16S rRNA processing protein RimM [Shewanella halifaxensis HAW-EB4]
          Length = 176

 Score =  134 bits (337), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 38/173 (21%), Positives = 78/173 (45%), Gaps = 12/173 (6%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRK 56
           M    + V++  +G++ G+ G + I +Y ++   +  Y  +      + RE+++ +   +
Sbjct: 1   MSSKQEPVILGKLGSSFGIKGWLKITTYTDSVEGIFDYSPWLIKEQGEWREVKVAQWRFQ 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
            K  +A   G+     A  L + ++    +  +D  L EDEF+  DL   E  + +G   
Sbjct: 61  GKAVVACLEGVTTRDEAQALTNCEIAVPAEQMQD--LPEDEFYWRDLIGCEVINTKGYNM 118

Query: 117 GQVCGVYNFGAGSILEIKNT-----MEKTFLIPFT-KFAVLEVNLQENKILID 163
           G V  +   G+  +L +K        +   +IPF     + +V+L   +IL+D
Sbjct: 119 GTVQEIVETGSNDVLLVKANAKDGFGKAERMIPFVTDQFIQKVDLAAKQILVD 171


>gi|194364932|ref|YP_002027542.1| 16S rRNA-processing protein RimM [Stenotrophomonas maltophilia
           R551-3]
 gi|238693461|sp|B4SPH2|RIMM_STRM5 RecName: Full=Ribosome maturation factor rimM
 gi|194347736|gb|ACF50859.1| 16S rRNA processing protein RimM [Stenotrophomonas maltophilia
           R551-3]
          Length = 170

 Score =  134 bits (337), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 34/169 (20%), Positives = 75/169 (44%), Gaps = 10/169 (5%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY-----SNDNRELRILKMYR 55
           M   ++ +L+  I    G+ GE+ ++S+      + RY  +     +     L   +   
Sbjct: 1   MKDNERRILLGRIVGAFGVRGEIKLESWTEPRSAIFRYQPWILRSPNGQESTLEGARGRD 60

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
             K  +A F GI++  +   +   ++Y  R        +E  ++  DLE ++    +G  
Sbjct: 61  SGKHLVARFPGIEDRDTVEAMHGTEVYVARSALPPPNADE--YYWVDLEGLDVKTTEGVA 118

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFT-KFAVLEVNLQENKILID 163
            GQV  +++ GA  ++ ++   ++  +IPF     V  V+ + N +++D
Sbjct: 119 LGQVSHLFSTGANDVVVVR--GDRERMIPFVLPEFVKSVDFEANLVVVD 165


>gi|118469073|ref|YP_886777.1| 16S rRNA-processing protein RimM [Mycobacterium smegmatis str. MC2
           155]
 gi|166226453|sp|A0QV39|RIMM_MYCS2 RecName: Full=Ribosome maturation factor rimM
 gi|118170360|gb|ABK71256.1| 16S rRNA processing protein RimM [Mycobacterium smegmatis str. MC2
           155]
          Length = 173

 Score =  134 bits (337), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 39/172 (22%), Positives = 71/172 (41%), Gaps = 8/172 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLN------RYVLYSNDNRELRILKMYRKNKRFI 61
           +++  +   HG++GEV ++   ++P          R    S   RE  I  +     R +
Sbjct: 3   LVVGRVVKAHGISGEVVVEIRTDDPEARFAPGAVLRGRPRSGAEREYTIESVRAHGGRLL 62

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
              +G+ + + A ELR         +    +  ++ F++ +LE M          G+V  
Sbjct: 63  VRLAGVADRNGADELRGTVFLVDTAELPAIDDPDE-FYDHELEGMRVVTVDDAPVGKVAE 121

Query: 122 VYNFGAGSILEIK-NTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNT 172
           V +   G IL +K +   +  L+PF    V  V+ Q   I+IDP    L+  
Sbjct: 122 VLHTAGGEILAVKADEGGREILVPFVGAIVTSVSRQNATIVIDPPEGLLDLA 173


>gi|220928162|ref|YP_002505071.1| 16S rRNA-processing protein RimM [Clostridium cellulolyticum H10]
 gi|254797746|sp|B8I7T4|RIMM_CLOCE RecName: Full=Ribosome maturation factor rimM
 gi|219998490|gb|ACL75091.1| 16S rRNA processing protein RimM [Clostridium cellulolyticum H10]
          Length = 169

 Score =  134 bits (337), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 38/171 (22%), Positives = 79/171 (46%), Gaps = 6/171 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNR----ELRILKMYRKNKR 59
           + + +++  +  THG+ GE+   S  ++P    +      D      +  I  +    + 
Sbjct: 1   MLEYLIVGQLINTHGVKGELKATSQTDDPQRFKKLKWVYIDKNGSLEKYDINGVKFFKQF 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F G+D+I  A +L+   +   R +    +L E+ FF +D+  ++ +D   +  G++
Sbjct: 61  IIIKFQGVDSIEEAEKLKGFYIKVDRAN--AVKLPENSFFISDIIGLKVYDENNQLLGEL 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
             V   G+  +  ++++  K  LIP  K  V EV+++E KI +      L+
Sbjct: 119 KDVIQTGSNDVYVVRDSDSKEILIPALKSVVKEVSIEEGKISVILPKGLLD 169


>gi|116333580|ref|YP_795107.1| RimM protein, required for 16S rRNA processing [Lactobacillus
           brevis ATCC 367]
 gi|122269733|sp|Q03RU6|RIMM_LACBA RecName: Full=Ribosome maturation factor rimM
 gi|116098927|gb|ABJ64076.1| 16S rRNA processing protein RimM [Lactobacillus brevis ATCC 367]
          Length = 172

 Score =  134 bits (337), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 25/169 (14%), Positives = 65/169 (38%), Gaps = 7/169 (4%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNR-------YVLYSNDNRELRILKMYRKNKR 59
              + TI  THG+ GEV + +  + P            +         L +  + +    
Sbjct: 3   YYTVGTIVNTHGIKGEVRVVATTDFPESRFAVGSTLYAFQKDQATPVTLTVASVRQHKNF 62

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
           ++ +F G  +I+     +   L     + +  +L   E++   +  ++     G+  G++
Sbjct: 63  YLLSFEGKPSINDVEIFKQSTLKVTDNELESNDLRPGEYYYHQIVGLDAVTVDGENLGKI 122

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAG 168
             + + GA  +  +    +   L+P     +  V+L + K++++ +   
Sbjct: 123 KEILSPGANDVWVVARPGKSDLLLPKIDQVIKRVDLDQGKVIVELMEGL 171


>gi|117928766|ref|YP_873317.1| 16S rRNA processing protein RimM [Acidothermus cellulolyticus 11B]
 gi|171460818|sp|A0LV71|RIMM_ACIC1 RecName: Full=Ribosome maturation factor rimM
 gi|117649229|gb|ABK53331.1| 16S rRNA processing protein RimM [Acidothermus cellulolyticus 11B]
          Length = 176

 Score =  134 bits (337), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 40/165 (24%), Positives = 75/165 (45%), Gaps = 3/165 (1%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY--VLYSNDNRELRILKMYRKNKRFIATFS 65
           V +  I   HG++GEV +    ++P        VL ++    L + +    + R +  F+
Sbjct: 12  VAVGRITRAHGVHGEVGVQVRTDDPDRRFAAGAVLTTDTGVTLTVQRTRWHSGRLLVRFA 71

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNF 125
           GID+  +A +LR   L+A+  +    E  E+ +++  L  M      G+  G V  V + 
Sbjct: 72  GIDDRTTAEDLRGRVLFAEVDERVRPEDPEE-YYDYQLIGMRVETVTGQEIGVVREVLHL 130

Query: 126 GAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
               +L I+ + +    +PF    V EV++ + ++ IDP    L 
Sbjct: 131 PGQDVLAIERSADGDAFVPFVAALVPEVDVDQRRLRIDPPPGLLE 175


>gi|307244387|ref|ZP_07526498.1| 16S rRNA processing protein RimM [Peptostreptococcus stomatis DSM
           17678]
 gi|306492206|gb|EFM64248.1| 16S rRNA processing protein RimM [Peptostreptococcus stomatis DSM
           17678]
          Length = 172

 Score =  133 bits (336), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 42/174 (24%), Positives = 74/174 (42%), Gaps = 6/174 (3%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRIL---KMYRK 56
           M    +   +  I TT GL GE+ I  + +           +  ++RE + L    +   
Sbjct: 1   MTDKLEYFKLGKIVTTRGLKGEIKIYPHTDKIDRFKDLEYFFIGNDREKKYLVERAVTAS 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           N   +    G D I S   L    ++  R+     +L+EDEFF  D+  M+    +G+  
Sbjct: 61  NNSIVVKLKGYDTIESVQALIGKFIFVDREM--SYQLDEDEFFIADMIGMDVETIEGQKI 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           G++  V  + A  +  +K    K +LIP T   V +++ +   + I PI   L+
Sbjct: 119 GKLVDVLQYAANDVYVVKGEDSKEYLIPATYEIVPDIDTENRLMKIKPIPGLLD 172


>gi|330894532|gb|EGH27193.1| 16S rRNA-processing protein RimM [Pseudomonas syringae pv. mori
           str. 301020]
          Length = 179

 Score =  133 bits (336), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 36/168 (21%), Positives = 84/168 (50%), Gaps = 11/168 (6%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND-----NRELRILKMYRKNKR 59
           D L+++  I + HG+ GEV + S+ +   +L  Y  ++        ++L ++    ++K 
Sbjct: 9   DDLIVIGKIYSVHGVRGEVKVFSFTDPIGNLLDYKTWTLRREGSVEKQLELVSGRLQSKF 68

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +A   G+D+   A  L   ++   R  F D  L++ E++   LE ++  D+ G+  G++
Sbjct: 69  LVAKLKGLDDREEARLLSGYEICVPRNLFPD--LDDGEYYWYQLEGLKVIDQLGQLLGKI 126

Query: 120 CGVYNFGAGSILEIKNT----MEKTFLIPFTKFAVLEVNLQENKILID 163
             +   G+  ++ +K       ++  L+P+T+  VL +++   ++ +D
Sbjct: 127 DHLLETGSNDVMVVKPCAGSLDDRERLLPYTEQCVLAIDMAAGEMKVD 174


>gi|170723317|ref|YP_001751005.1| 16S rRNA-processing protein RimM [Pseudomonas putida W619]
 gi|229564325|sp|B1JDE4|RIMM_PSEPW RecName: Full=Ribosome maturation factor rimM
 gi|169761320|gb|ACA74636.1| 16S rRNA processing protein RimM [Pseudomonas putida W619]
          Length = 178

 Score =  133 bits (336), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 31/169 (18%), Positives = 78/169 (46%), Gaps = 10/169 (5%)

Query: 3   KLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNK 58
           K D L+++  I + HG+ GEV + S+ +   +L  Y  ++       +++ ++      K
Sbjct: 7   KADDLIVVGKIFSVHGVRGEVKVYSFTDPIENLLDYPRWTLRHEGKVKQVELVSGRGSQK 66

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
             +    G+D+   A  L   ++   R    +   +E  ++   L+ ++  ++  + +G+
Sbjct: 67  GLVVKLKGLDDRDEARLLSGFEICIPRSLLPNLAADE--YYWYQLQGLKVINQDEQLFGK 124

Query: 119 VCGVYNFGAGSILEIKNT----MEKTFLIPFTKFAVLEVNLQENKILID 163
           V  +   GA  ++ +K       ++  L+P+T   VL ++L+   + ++
Sbjct: 125 VDHLLETGANDVMVVKPCAGSLDDRERLLPYTAQCVLAIDLEAGVMRVE 173


>gi|114564083|ref|YP_751597.1| 16S rRNA-processing protein [Shewanella frigidimarina NCIMB 400]
 gi|122299044|sp|Q07Z06|RIMM_SHEFN RecName: Full=Ribosome maturation factor rimM
 gi|114335376|gb|ABI72758.1| 16S rRNA processing protein RimM [Shewanella frigidimarina NCIMB
           400]
          Length = 176

 Score =  133 bits (336), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 42/173 (24%), Positives = 80/173 (46%), Gaps = 12/173 (6%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND----NRELRILKMYRK 56
           M    +LV++  +G++HG+ G + I SY ++   +  Y  +        RE+++ +   +
Sbjct: 1   MSSNQELVVLGKLGSSHGIKGWLKITSYTDSVEGIFDYSPWLIKEQGVWREVKVAQWRFQ 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
            K  +A   G+     A  L + ++    +  KD  L++ EF++ DL   E  +  G   
Sbjct: 61  GKAVVAELEGVATREHAQMLTNCEIAIMPEQMKD--LDDSEFYHRDLIGCEVTNINGYNM 118

Query: 117 GQVCGVYNFGAGSILEIKNT-----MEKTFLIPFTKF-AVLEVNLQENKILID 163
           G V  +   G+  +L IK        +   +IPF     + +V+LQ  +IL+D
Sbjct: 119 GIVDQIVETGSNDVLLIKANAKDAFGKAERMIPFVPEQFIKQVDLQGKQILVD 171


>gi|88808142|ref|ZP_01123653.1| 16S rRNA-processing protein [Synechococcus sp. WH 7805]
 gi|88788181|gb|EAR19337.1| 16S rRNA-processing protein [Synechococcus sp. WH 7805]
          Length = 190

 Score =  133 bits (336), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 48/174 (27%), Positives = 74/174 (42%), Gaps = 11/174 (6%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND-----NRELRILKMYRK--N 57
           D  + +  +    GL GE+ ++  ++ P    +             RE+ +    ++   
Sbjct: 19  DHWLPVGKVVGAQGLRGELRVNPASDFPERFTQPGPRWLQTQGSPPREIELTSGRQQPGK 78

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETF-DRQGKYW 116
             FI  F GIDN  SA  L    L  +  D    +LEE EF   DL  +E    R+ +  
Sbjct: 79  SLFIVRFKGIDNRSSAEALVGQTLLVRADDRP--QLEEGEFHLLDLVGLEARLSREAEAI 136

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           G V  + + G   +LEI     +  L+PF +  V EVNLQ+  IL+ P    L 
Sbjct: 137 GTVTDLIS-GGNDLLEITRPDGRKLLVPFVEAIVPEVNLQDGWILLTPPPGLLE 189


>gi|166031987|ref|ZP_02234816.1| hypothetical protein DORFOR_01689 [Dorea formicigenerans ATCC
           27755]
 gi|166028440|gb|EDR47197.1| hypothetical protein DORFOR_01689 [Dorea formicigenerans ATCC
           27755]
          Length = 168

 Score =  133 bits (336), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 38/170 (22%), Positives = 71/170 (41%), Gaps = 6/170 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRE----LRILKMYRKNKR 59
           +++L+ +  I   HG+ GEV +    ++P+   +      D  +    L +  +    + 
Sbjct: 1   MEQLLQVGVITQPHGVRGEVKVFPTTDDPVRFKKLKKVILDTGKEKLDLEVEHVKFFKQF 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F   DNI+     +   L   R++     LEEDE+F  D+  M+     G  +G +
Sbjct: 61  VIVKFKEFDNINDIERYKRCPLLVTREN--AVPLEEDEYFVADMIGMKVITEDGTEFGTL 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
             V   GA  +  I +      L+P  K  VL V+++   I +  +   +
Sbjct: 119 SDVMETGANDVYVIDSKEHGEVLMPAIKECVLNVDMESGIITVHLMNGLI 168


>gi|30064007|ref|NP_838178.1| 16S rRNA-processing protein RimM [Shigella flexneri 2a str. 2457T]
 gi|56480152|ref|NP_708456.2| 16S rRNA-processing protein RimM [Shigella flexneri 2a str. 301]
 gi|89109409|ref|AP_003189.1| 16S rRNA processing protein [Escherichia coli str. K-12 substr.
           W3110]
 gi|90111466|ref|NP_417099.4| 16S rRNA processing protein [Escherichia coli str. K-12 substr.
           MG1655]
 gi|110642769|ref|YP_670499.1| 16S rRNA-processing protein RimM [Escherichia coli 536]
 gi|110806724|ref|YP_690244.1| 16S rRNA-processing protein RimM [Shigella flexneri 5 str. 8401]
 gi|157154813|ref|YP_001463927.1| 16S rRNA-processing protein RimM [Escherichia coli E24377A]
 gi|157162084|ref|YP_001459402.1| 16S rRNA-processing protein RimM [Escherichia coli HS]
 gi|161367544|ref|NP_289161.2| 16S rRNA-processing protein RimM [Escherichia coli O157:H7 EDL933]
 gi|161486146|ref|NP_755011.2| 16S rRNA-processing protein RimM [Escherichia coli CFT073]
 gi|161950061|ref|YP_404316.2| 16S rRNA-processing protein RimM [Shigella dysenteriae Sd197]
 gi|161984877|ref|YP_409099.2| 16S rRNA-processing protein RimM [Shigella boydii Sb227]
 gi|161986471|ref|YP_311617.2| 16S rRNA-processing protein RimM [Shigella sonnei Ss046]
 gi|162139719|ref|NP_311498.3| 16S rRNA-processing protein RimM [Escherichia coli O157:H7 str.
           Sakai]
 gi|170019115|ref|YP_001724069.1| 16S rRNA-processing protein RimM [Escherichia coli ATCC 8739]
 gi|170082212|ref|YP_001731532.1| 16S rRNA processing protein [Escherichia coli str. K-12 substr.
           DH10B]
 gi|188495797|ref|ZP_03003067.1| 16S rRNA processing protein RimM [Escherichia coli 53638]
 gi|195940202|ref|ZP_03085584.1| 16S rRNA-processing protein [Escherichia coli O157:H7 str. EC4024]
 gi|209920083|ref|YP_002294167.1| 16S rRNA-processing protein RimM [Escherichia coli SE11]
 gi|215487958|ref|YP_002330389.1| 16S rRNA-processing protein RimM [Escherichia coli O127:H6 str.
           E2348/69]
 gi|218555187|ref|YP_002388100.1| 16S rRNA-processing protein RimM [Escherichia coli IAI1]
 gi|218559528|ref|YP_002392441.1| 16S rRNA-processing protein RimM [Escherichia coli S88]
 gi|218690726|ref|YP_002398938.1| 16S rRNA-processing protein RimM [Escherichia coli ED1a]
 gi|218696232|ref|YP_002403899.1| 16S rRNA-processing protein RimM [Escherichia coli 55989]
 gi|218701120|ref|YP_002408749.1| 16S rRNA-processing protein RimM [Escherichia coli IAI39]
 gi|218706109|ref|YP_002413628.1| 16S rRNA-processing protein RimM [Escherichia coli UMN026]
 gi|238901768|ref|YP_002927564.1| 16S rRNA processing protein [Escherichia coli BW2952]
 gi|253772498|ref|YP_003035329.1| 16S rRNA-processing protein RimM [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254162578|ref|YP_003045686.1| 16S rRNA-processing protein RimM [Escherichia coli B str. REL606]
 gi|254794554|ref|YP_003079391.1| 16S rRNA-processing protein RimM [Escherichia coli O157:H7 str.
           TW14359]
 gi|256019573|ref|ZP_05433438.1| 16S rRNA-processing protein RimM [Shigella sp. D9]
 gi|256024865|ref|ZP_05438730.1| 16S rRNA-processing protein RimM [Escherichia sp. 4_1_40B]
 gi|260845289|ref|YP_003223067.1| 16S rRNA processing protein [Escherichia coli O103:H2 str. 12009]
 gi|260856697|ref|YP_003230588.1| 16S rRNA processing protein [Escherichia coli O26:H11 str. 11368]
 gi|260869289|ref|YP_003235691.1| 16S rRNA processing protein [Escherichia coli O111:H- str. 11128]
 gi|261227491|ref|ZP_05941772.1| 16S rRNA processing protein [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|293406115|ref|ZP_06650041.1| ribosome maturation factor rimM [Escherichia coli FVEC1412]
 gi|297517104|ref|ZP_06935490.1| 16S rRNA-processing protein RimM [Escherichia coli OP50]
 gi|298381848|ref|ZP_06991445.1| ribosome maturation factor rimM [Escherichia coli FVEC1302]
 gi|306812474|ref|ZP_07446672.1| 16S rRNA-processing protein RimM [Escherichia coli NC101]
 gi|307139329|ref|ZP_07498685.1| 16S rRNA-processing protein RimM [Escherichia coli H736]
 gi|307315080|ref|ZP_07594664.1| 16S rRNA processing protein RimM [Escherichia coli W]
 gi|309784648|ref|ZP_07679283.1| 16S rRNA processing protein RimM [Shigella dysenteriae 1617]
 gi|312965539|ref|ZP_07779770.1| 16S rRNA processing protein RimM [Escherichia coli 2362-75]
 gi|312973150|ref|ZP_07787323.1| 16S rRNA processing protein RimM [Escherichia coli 1827-70]
 gi|67472030|sp|P0A7X6|RIMM_ECOLI RecName: Full=Ribosome maturation factor rimM; AltName: Full=21K
 gi|67472031|sp|P0A7X7|RIMM_ECOL6 RecName: Full=Ribosome maturation factor rimM
 gi|67472032|sp|P0A7X8|RIMM_ECO57 RecName: Full=Ribosome maturation factor rimM
 gi|67472033|sp|P0A7X9|RIMM_SHIFL RecName: Full=Ribosome maturation factor rimM
 gi|122957241|sp|Q0T176|RIMM_SHIF8 RecName: Full=Ribosome maturation factor rimM
 gi|123343733|sp|Q0TEN1|RIMM_ECOL5 RecName: Full=Ribosome maturation factor rimM
 gi|166985944|sp|A7ZQ48|RIMM_ECO24 RecName: Full=Ribosome maturation factor rimM
 gi|166985955|sp|A8A3B5|RIMM_ECOHS RecName: Full=Ribosome maturation factor rimM
 gi|171704424|sp|A1AED9|RIMM_ECOK1 RecName: Full=Ribosome maturation factor rimM
 gi|189040838|sp|B1IVM5|RIMM_ECOLC RecName: Full=Ribosome maturation factor rimM
 gi|209573742|sp|Q1R8B7|RIMM_ECOUT RecName: Full=Ribosome maturation factor rimM
 gi|226694912|sp|B7MIU6|RIMM_ECO45 RecName: Full=Ribosome maturation factor rimM
 gi|226694913|sp|B7NSA7|RIMM_ECO7I RecName: Full=Ribosome maturation factor rimM
 gi|226734087|sp|B7M977|RIMM_ECO8A RecName: Full=Ribosome maturation factor rimM
 gi|226734088|sp|B7N6J4|RIMM_ECOLU RecName: Full=Ribosome maturation factor rimM
 gi|229564321|sp|B1XBT0|RIMM_ECODH RecName: Full=Ribosome maturation factor rimM
 gi|238058951|sp|B6I630|RIMM_ECOSE RecName: Full=Ribosome maturation factor rimM
 gi|254797747|sp|B7UH57|RIMM_ECO27 RecName: Full=Ribosome maturation factor rimM
 gi|254797748|sp|B7LDJ7|RIMM_ECO55 RecName: Full=Ribosome maturation factor rimM
 gi|254797749|sp|B7MYA1|RIMM_ECO81 RecName: Full=Ribosome maturation factor rimM
 gi|259585643|sp|C4ZYM6|RIMM_ECOBW RecName: Full=Ribosome maturation factor rimM
 gi|30042263|gb|AAP17988.1| hypothetical protein S2845 [Shigella flexneri 2a str. 2457T]
 gi|56383703|gb|AAN44163.2| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301]
 gi|85675479|dbj|BAA16493.2| 16S rRNA processing protein [Escherichia coli str. K12 substr.
           W3110]
 gi|87082136|gb|AAC75657.2| 16S rRNA processing protein [Escherichia coli str. K-12 substr.
           MG1655]
 gi|110344361|gb|ABG70598.1| 16S rRNA processing protein RimM [Escherichia coli 536]
 gi|110616272|gb|ABF04939.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401]
 gi|157067764|gb|ABV07019.1| 16S rRNA processing protein RimM [Escherichia coli HS]
 gi|157076843|gb|ABV16551.1| 16S rRNA processing protein RimM [Escherichia coli E24377A]
 gi|169754043|gb|ACA76742.1| 16S rRNA processing protein RimM [Escherichia coli ATCC 8739]
 gi|169890047|gb|ACB03754.1| 16S rRNA processing protein [Escherichia coli str. K-12 substr.
           DH10B]
 gi|188490996|gb|EDU66099.1| 16S rRNA processing protein RimM [Escherichia coli 53638]
 gi|209913342|dbj|BAG78416.1| 16S rRNA processing protein [Escherichia coli SE11]
 gi|215266030|emb|CAS10445.1| 16S rRNA processing protein [Escherichia coli O127:H6 str.
           E2348/69]
 gi|218352964|emb|CAU98764.1| 16S rRNA processing protein [Escherichia coli 55989]
 gi|218361955|emb|CAQ99556.1| 16S rRNA processing protein [Escherichia coli IAI1]
 gi|218366297|emb|CAR04048.1| 16S rRNA processing protein [Escherichia coli S88]
 gi|218371106|emb|CAR18934.1| 16S rRNA processing protein [Escherichia coli IAI39]
 gi|218428290|emb|CAR09067.1| 16S rRNA processing protein [Escherichia coli ED1a]
 gi|218433206|emb|CAR14104.1| 16S rRNA processing protein [Escherichia coli UMN026]
 gi|222034310|emb|CAP77051.1| 16S rRNA-processing protein rimM [Escherichia coli LF82]
 gi|238859735|gb|ACR61733.1| 16S rRNA processing protein [Escherichia coli BW2952]
 gi|242378203|emb|CAQ32978.1| ribosome maturation protein [Escherichia coli BL21(DE3)]
 gi|253323542|gb|ACT28144.1| 16S rRNA processing protein RimM [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253974479|gb|ACT40150.1| 16S rRNA-processing protein [Escherichia coli B str. REL606]
 gi|253978646|gb|ACT44316.1| 16S rRNA-processing protein [Escherichia coli BL21(DE3)]
 gi|254593954|gb|ACT73315.1| 16S rRNA processing protein [Escherichia coli O157:H7 str. TW14359]
 gi|257755346|dbj|BAI26848.1| 16S rRNA processing protein [Escherichia coli O26:H11 str. 11368]
 gi|257760436|dbj|BAI31933.1| 16S rRNA processing protein [Escherichia coli O103:H2 str. 12009]
 gi|257765645|dbj|BAI37140.1| 16S rRNA processing protein [Escherichia coli O111:H- str. 11128]
 gi|260448318|gb|ACX38740.1| 16S rRNA processing protein RimM [Escherichia coli DH1]
 gi|281179654|dbj|BAI55984.1| 16S rRNA processing protein [Escherichia coli SE15]
 gi|284922554|emb|CBG35641.1| 16S rRNA processing protein [Escherichia coli 042]
 gi|291426121|gb|EFE99153.1| ribosome maturation factor rimM [Escherichia coli FVEC1412]
 gi|298276988|gb|EFI18504.1| ribosome maturation factor rimM [Escherichia coli FVEC1302]
 gi|305854512|gb|EFM54950.1| 16S rRNA-processing protein RimM [Escherichia coli NC101]
 gi|306905509|gb|EFN36043.1| 16S rRNA processing protein RimM [Escherichia coli W]
 gi|307554621|gb|ADN47396.1| 16S rRNA processing protein [Escherichia coli ABU 83972]
 gi|307625842|gb|ADN70146.1| 16S rRNA-processing protein RimM [Escherichia coli UM146]
 gi|308927545|gb|EFP73017.1| 16S rRNA processing protein RimM [Shigella dysenteriae 1617]
 gi|309702988|emb|CBJ02319.1| 16S rRNA processing protein [Escherichia coli ETEC H10407]
 gi|310333092|gb|EFQ00306.1| 16S rRNA processing protein RimM [Escherichia coli 1827-70]
 gi|312289787|gb|EFR17676.1| 16S rRNA processing protein RimM [Escherichia coli 2362-75]
 gi|312947180|gb|ADR28007.1| 16S rRNA-processing protein RimM [Escherichia coli O83:H1 str. NRG
           857C]
 gi|313648286|gb|EFS12730.1| 16S rRNA processing protein RimM [Shigella flexneri 2a str. 2457T]
 gi|315061922|gb|ADT76249.1| 16S rRNA processing protein [Escherichia coli W]
 gi|315137226|dbj|BAJ44385.1| 16S rRNA processing protein RimM [Escherichia coli DH1]
 gi|315615306|gb|EFU95941.1| 16S rRNA processing protein RimM [Escherichia coli 3431]
 gi|320640790|gb|EFX10288.1| 16S rRNA-processing protein RimM [Escherichia coli O157:H7 str.
           G5101]
 gi|320646135|gb|EFX15080.1| 16S rRNA-processing protein RimM [Escherichia coli O157:H- str.
           493-89]
 gi|320651432|gb|EFX19833.1| 16S rRNA-processing protein RimM [Escherichia coli O157:H- str. H
           2687]
 gi|320657037|gb|EFX24860.1| 16S rRNA-processing protein RimM [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320662701|gb|EFX30045.1| 16S rRNA-processing protein RimM [Escherichia coli O55:H7 str. USDA
           5905]
 gi|320667518|gb|EFX34442.1| 16S rRNA-processing protein RimM [Escherichia coli O157:H7 str.
           LSU-61]
 gi|323156262|gb|EFZ42421.1| 16S rRNA processing protein RimM [Escherichia coli EPECa14]
 gi|323159127|gb|EFZ45120.1| 16S rRNA processing protein RimM [Escherichia coli E128010]
 gi|323167731|gb|EFZ53426.1| 16S rRNA processing protein RimM [Shigella sonnei 53G]
 gi|323173075|gb|EFZ58706.1| 16S rRNA processing protein RimM [Escherichia coli LT-68]
 gi|323177266|gb|EFZ62854.1| 16S rRNA processing protein RimM [Escherichia coli 1180]
 gi|323184517|gb|EFZ69891.1| 16S rRNA processing protein RimM [Escherichia coli 1357]
 gi|323188400|gb|EFZ73689.1| 16S rRNA processing protein RimM [Escherichia coli RN587/1]
 gi|323377498|gb|ADX49766.1| 16S rRNA processing protein RimM [Escherichia coli KO11]
 gi|332088116|gb|EGI93241.1| 16S rRNA processing protein RimM [Shigella boydii 5216-82]
 gi|332089239|gb|EGI94346.1| 16S rRNA processing protein RimM [Shigella dysenteriae 155-74]
 gi|332344477|gb|AEE57811.1| 16S rRNA processing protein RimM [Escherichia coli UMNK88]
 gi|332754032|gb|EGJ84404.1| 16S rRNA processing protein RimM [Shigella flexneri K-671]
 gi|332755633|gb|EGJ85996.1| 16S rRNA processing protein RimM [Shigella flexneri 2747-71]
 gi|332765586|gb|EGJ95799.1| 16S rRNA processing protein RimM [Shigella flexneri 2930-71]
 gi|332999383|gb|EGK18968.1| 16S rRNA processing protein RimM [Shigella flexneri VA-6]
 gi|333000792|gb|EGK20366.1| 16S rRNA processing protein RimM [Shigella flexneri K-218]
 gi|333000980|gb|EGK20550.1| 16S rRNA processing protein RimM [Shigella flexneri K-272]
 gi|333015516|gb|EGK34855.1| 16S rRNA processing protein RimM [Shigella flexneri K-227]
 gi|333015852|gb|EGK35188.1| 16S rRNA processing protein RimM [Shigella flexneri K-304]
          Length = 182

 Score =  133 bits (336), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 31/172 (18%), Positives = 74/172 (43%), Gaps = 12/172 (6%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRFI 61
             +++  +G+++G+ G + + S   +   +  Y  +        +++++      N+  I
Sbjct: 12  DPIVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQQVQLESWKHHNQDMI 71

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               G+D+  +A+ L + ++          +LEE +++  DL   +    +G   G+V  
Sbjct: 72  IKLKGVDDRDAANLLTNCEIVVDSSQLP--QLEEGDYYWKDLMGCQVVTTEGYDLGKVVD 129

Query: 122 VYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILIDPIAA 167
           +   G+  +L IK  ++     K  L+PF     + +V+L    I +D    
Sbjct: 130 MMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLTTRSIEVDWDPG 181


>gi|239928687|ref|ZP_04685640.1| 16S rRNA-processing protein [Streptomyces ghanaensis ATCC 14672]
 gi|291437011|ref|ZP_06576401.1| 16S rRNA processing protein [Streptomyces ghanaensis ATCC 14672]
 gi|291339906|gb|EFE66862.1| 16S rRNA processing protein [Streptomyces ghanaensis ATCC 14672]
          Length = 188

 Score =  133 bits (336), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 35/186 (18%), Positives = 79/186 (42%), Gaps = 5/186 (2%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNR----YVLYSNDNRELRILKMYRKNKRFIAT 63
           +++A IG  HG+ GEV ++   + P                   L I      + R +  
Sbjct: 3   LVVARIGRAHGIKGEVTVEVRTDEPELRLAPGAVLATEPASAGPLTIETGRVHSGRLLLR 62

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F G+ + ++A  LR+  L A+     +   +EDE+++  L +++     G+  G++  + 
Sbjct: 63  FEGVRDRNAAEALRNTLLIAEVDPE-ERPEDEDEYYDHQLIDLDVVTADGEQVGRITEIS 121

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQYDCPL 183
           +     +  ++        +PF +  V E++L E + +I P    +++  +++   D   
Sbjct: 122 HLPTQDLFVVERPDGSEVFVPFVEEIVAEIDLVEQRAVITPPPGLIDDRAVRDEAADGHG 181

Query: 184 DSAGKK 189
            S   +
Sbjct: 182 ASPRDE 187


>gi|152971458|ref|YP_001336567.1| 16S rRNA-processing protein RimM [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|166226446|sp|A6TCL6|RIMM_KLEP7 RecName: Full=Ribosome maturation factor rimM
 gi|150956307|gb|ABR78337.1| 16S rRNA-processing protein [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
          Length = 182

 Score =  133 bits (336), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 31/172 (18%), Positives = 72/172 (41%), Gaps = 12/172 (6%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRFI 61
             +++  +G+++G+ G + + S   +   +  Y  +        + + +      N+  I
Sbjct: 12  DPIVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWLIQKAGQWQVVELESWRHHNQDII 71

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               G+D+  +A+ L + ++        +  LEE +++  DL   +    +G   G+V  
Sbjct: 72  IKLKGVDDRDAANLLTNCEIIVDSSQLPE--LEEGDYYWKDLMGCQVVTTEGYSLGKVID 129

Query: 122 VYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILIDPIAA 167
           +   G+  +L IK  ++     K  L+PF     + +V+L    I +D    
Sbjct: 130 MMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLTTRTIEVDWDPG 181


>gi|187730041|ref|YP_001881398.1| 16S rRNA-processing protein RimM [Shigella boydii CDC 3083-94]
 gi|218547873|ref|YP_002381664.1| 16S rRNA-processing protein RimM [Escherichia fergusonii ATCC
           35469]
 gi|226734089|sp|B7LUW5|RIMM_ESCF3 RecName: Full=Ribosome maturation factor rimM
 gi|238691732|sp|B2TYN0|RIMM_SHIB3 RecName: Full=Ribosome maturation factor rimM
 gi|187427033|gb|ACD06307.1| 16S rRNA processing protein RimM [Shigella boydii CDC 3083-94]
 gi|218355414|emb|CAQ88023.1| 16S rRNA processing protein [Escherichia fergusonii ATCC 35469]
          Length = 182

 Score =  133 bits (336), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 31/172 (18%), Positives = 74/172 (43%), Gaps = 12/172 (6%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRFI 61
             +++  +G+++G+ G + + S   +   +  Y  +        +++++      N+  I
Sbjct: 12  DPIVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQQVQLESWKHHNQDMI 71

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               G+D+  +A+ L + ++          +LEE +++  DL   +    +G   G+V  
Sbjct: 72  IKLKGVDDRDAANLLTNCEIVVDSSQLP--QLEEGDYYWKDLMGCQVVTTEGYDLGKVID 129

Query: 122 VYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILIDPIAA 167
           +   G+  +L IK  ++     K  L+PF     + +V+L    I +D    
Sbjct: 130 MMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLTTRSIEVDWDPG 181


>gi|315648167|ref|ZP_07901268.1| 16S rRNA processing protein RimM [Paenibacillus vortex V453]
 gi|315276813|gb|EFU40156.1| 16S rRNA processing protein RimM [Paenibacillus vortex V453]
          Length = 173

 Score =  133 bits (336), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 31/173 (17%), Positives = 63/173 (36%), Gaps = 10/173 (5%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYV------LYSNDNRELRILKMYRKNK 58
           +KL  +  I  THG+ GEV +  + +                      E  +        
Sbjct: 3   EKLFTVGKIVNTHGIRGEVKVMPHTDFADQRFAVKSKLFIVPDKGSMIEATVDTSRFHKN 62

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMET--FDRQGKYW 116
            ++  F  +  I+ A + +   L  K      EEL ++E++  ++   +    D   +  
Sbjct: 63  MYVLKFKELHGINDAEKYKGSLLKIKADL--QEELPDNEYYFHEIIGCKVLTDDEPAEEL 120

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           G +  +   GA  +  +K    K  L+P     VL+V+ +   + +  +   L
Sbjct: 121 GTISEILTPGANDVWVVKTPQGKEVLLPAIPDVVLDVDKEAKLVRVHLMEGLL 173


>gi|119774027|ref|YP_926767.1| 16S rRNA-processing protein RimM [Shewanella amazonensis SB2B]
 gi|171704647|sp|A1S3Z1|RIMM_SHEAM RecName: Full=Ribosome maturation factor rimM
 gi|119766527|gb|ABL99097.1| 16S rRNA processing protein RimM [Shewanella amazonensis SB2B]
          Length = 176

 Score =  133 bits (336), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 42/173 (24%), Positives = 80/173 (46%), Gaps = 12/173 (6%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRK 56
           M    + V++  IG+T+G+ G + I +Y ++   +  Y  +      + RE+++ +    
Sbjct: 1   MSSNQQPVVVGKIGSTYGVKGWMKITAYTDSVEGIFDYSPWFLKEHGEWREVKVSQWRFH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
            K  +A   G+ N   A  L + ++    +   +  L EDEF+  DL   E  + +G   
Sbjct: 61  GKAVVAELEGVSNREQAQMLTNCEIGILAEQMPE--LPEDEFYWRDLIGCEVLNTKGYNL 118

Query: 117 GQVCGVYNFGAGSILEIKNT-----MEKTFLIPFT-KFAVLEVNLQENKILID 163
           G+V  +   G+  +L +K        +   +IP+     VLEV L E +I++D
Sbjct: 119 GKVDQILETGSNDVLMVKANAKDAFGKTERMIPYLPDQFVLEVKLSEKQIIVD 171


>gi|257878613|ref|ZP_05658266.1| ribosome maturation factor rimM [Enterococcus faecium 1,230,933]
 gi|257883127|ref|ZP_05662780.1| ribosome maturation factor rimM [Enterococcus faecium 1,231,502]
 gi|257891874|ref|ZP_05671527.1| ribosome maturation factor rimM [Enterococcus faecium 1,231,410]
 gi|257894444|ref|ZP_05674097.1| ribosome maturation factor rimM [Enterococcus faecium 1,231,408]
 gi|260559326|ref|ZP_05831508.1| ribosome maturation factor rimM [Enterococcus faecium C68]
 gi|261208002|ref|ZP_05922680.1| ribosome maturation factor rimM [Enterococcus faecium TC 6]
 gi|289566902|ref|ZP_06447309.1| 16S rRNA processing protein RimM [Enterococcus faecium D344SRF]
 gi|293563834|ref|ZP_06678267.1| 16S rRNA processing protein RimM [Enterococcus faecium E1162]
 gi|293567277|ref|ZP_06678631.1| 16S rRNA processing protein RimM [Enterococcus faecium E1071]
 gi|294615593|ref|ZP_06695449.1| 16S rRNA processing protein RimM [Enterococcus faecium E1636]
 gi|294619817|ref|ZP_06699207.1| 16S rRNA processing protein RimM [Enterococcus faecium E1679]
 gi|294622897|ref|ZP_06701810.1| 16S rRNA processing protein RimM [Enterococcus faecium U0317]
 gi|314938073|ref|ZP_07845381.1| 16S rRNA processing protein RimM [Enterococcus faecium TX0133a04]
 gi|314943595|ref|ZP_07850352.1| 16S rRNA processing protein RimM [Enterococcus faecium TX0133C]
 gi|314949232|ref|ZP_07852581.1| 16S rRNA processing protein RimM [Enterococcus faecium TX0082]
 gi|314952618|ref|ZP_07855610.1| 16S rRNA processing protein RimM [Enterococcus faecium TX0133A]
 gi|314992466|ref|ZP_07857888.1| 16S rRNA processing protein RimM [Enterococcus faecium TX0133B]
 gi|314997371|ref|ZP_07862327.1| 16S rRNA processing protein RimM [Enterococcus faecium TX0133a01]
 gi|257812841|gb|EEV41599.1| ribosome maturation factor rimM [Enterococcus faecium 1,230,933]
 gi|257818785|gb|EEV46113.1| ribosome maturation factor rimM [Enterococcus faecium 1,231,502]
 gi|257828234|gb|EEV54860.1| ribosome maturation factor rimM [Enterococcus faecium 1,231,410]
 gi|257830823|gb|EEV57430.1| ribosome maturation factor rimM [Enterococcus faecium 1,231,408]
 gi|260074686|gb|EEW63006.1| ribosome maturation factor rimM [Enterococcus faecium C68]
 gi|260077760|gb|EEW65473.1| ribosome maturation factor rimM [Enterococcus faecium TC 6]
 gi|289161308|gb|EFD09201.1| 16S rRNA processing protein RimM [Enterococcus faecium D344SRF]
 gi|291590026|gb|EFF21820.1| 16S rRNA processing protein RimM [Enterococcus faecium E1071]
 gi|291591536|gb|EFF23189.1| 16S rRNA processing protein RimM [Enterococcus faecium E1636]
 gi|291593950|gb|EFF25434.1| 16S rRNA processing protein RimM [Enterococcus faecium E1679]
 gi|291597669|gb|EFF28822.1| 16S rRNA processing protein RimM [Enterococcus faecium U0317]
 gi|291604204|gb|EFF33705.1| 16S rRNA processing protein RimM [Enterococcus faecium E1162]
 gi|313588558|gb|EFR67403.1| 16S rRNA processing protein RimM [Enterococcus faecium TX0133a01]
 gi|313593008|gb|EFR71853.1| 16S rRNA processing protein RimM [Enterococcus faecium TX0133B]
 gi|313595286|gb|EFR74131.1| 16S rRNA processing protein RimM [Enterococcus faecium TX0133A]
 gi|313597713|gb|EFR76558.1| 16S rRNA processing protein RimM [Enterococcus faecium TX0133C]
 gi|313642562|gb|EFS07142.1| 16S rRNA processing protein RimM [Enterococcus faecium TX0133a04]
 gi|313644373|gb|EFS08953.1| 16S rRNA processing protein RimM [Enterococcus faecium TX0082]
          Length = 173

 Score =  133 bits (336), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 31/176 (17%), Positives = 72/176 (40%), Gaps = 9/176 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR------YVLYSNDNRELRILKMYRKN 57
           + + + +  I  T G+ GEV + S  + P +  +               EL +    +  
Sbjct: 1   MTEYLNVGKIVNTQGIKGEVRVISTTDFPEERYKKGTVLTLFQDGKAPVELTVKSHRKHK 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              + +F G  +I+   + RD  L   + +    +L E+EF+  ++  +      G   G
Sbjct: 61  NFDLLSFEGHPSINDVEKYRDGILKVSKDN--SVDLAENEFYYHEIIGLHV-LEDGTELG 117

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTT 173
           +V  + + GA  +  ++   +   L+P+    V EV+L+   + ++     +++  
Sbjct: 118 KVKEILSPGANDVWVVQRPKKADILLPYIASVVKEVDLEAGVVRVEIPEGLIDDED 173


>gi|167758977|ref|ZP_02431104.1| hypothetical protein CLOSCI_01323 [Clostridium scindens ATCC 35704]
 gi|167663384|gb|EDS07514.1| hypothetical protein CLOSCI_01323 [Clostridium scindens ATCC 35704]
          Length = 168

 Score =  133 bits (336), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 44/169 (26%), Positives = 76/169 (44%), Gaps = 6/169 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRE----LRILKMYRKNKR 59
           +++L+ +  I +THG+ GEV +    ++            D  +    L I  +    + 
Sbjct: 1   MEELLQVGVITSTHGIRGEVKVFPTTDDAKRFRELKDVMLDTGKETLSLEIEGVKFFKQF 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F GIDNI+     +   L+  R+D    ELEEDE+F  D+  M+    +G+ +G +
Sbjct: 61  VILKFKGIDNINDVERYKRCPLFVNRED--AVELEEDEYFIADMIGMKVITDEGEEFGTL 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAG 168
             V   GA  +  I+       LIP  K  +L+V++    + I  +A  
Sbjct: 119 KDVMETGANDVYVIRRADGGEVLIPAIKECILDVDIPGRLMKIHVMAGL 167


>gi|71733889|ref|YP_273613.1| 16S rRNA-processing protein RimM [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|257487157|ref|ZP_05641198.1| 16S rRNA-processing protein RimM [Pseudomonas syringae pv. tabaci
           ATCC 11528]
 gi|289625895|ref|ZP_06458849.1| 16S rRNA-processing protein RimM [Pseudomonas syringae pv. aesculi
           str. NCPPB3681]
 gi|289646207|ref|ZP_06477550.1| 16S rRNA-processing protein RimM [Pseudomonas syringae pv. aesculi
           str. 2250]
 gi|298488275|ref|ZP_07006308.1| 16S rRNA processing protein RimM [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|109893032|sp|Q48LV9|RIMM_PSE14 RecName: Full=Ribosome maturation factor rimM
 gi|71554442|gb|AAZ33653.1| 16S rRNA processing protein RimM [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|298157214|gb|EFH98301.1| 16S rRNA processing protein RimM [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|320323177|gb|EFW79266.1| 16S rRNA-processing protein RimM [Pseudomonas syringae pv. glycinea
           str. B076]
 gi|320329552|gb|EFW85541.1| 16S rRNA-processing protein RimM [Pseudomonas syringae pv. glycinea
           str. race 4]
 gi|330867525|gb|EGH02234.1| 16S rRNA-processing protein RimM [Pseudomonas syringae pv. aesculi
           str. 0893_23]
 gi|330874829|gb|EGH08978.1| 16S rRNA-processing protein RimM [Pseudomonas syringae pv. glycinea
           str. race 4]
 gi|330985049|gb|EGH83152.1| 16S rRNA-processing protein RimM [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331009222|gb|EGH89278.1| 16S rRNA-processing protein RimM [Pseudomonas syringae pv. tabaci
           ATCC 11528]
          Length = 179

 Score =  133 bits (336), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 35/168 (20%), Positives = 84/168 (50%), Gaps = 11/168 (6%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND-----NRELRILKMYRKNKR 59
           D L+++  I + HG+ GEV + S+ +   +L  Y  ++        +++ ++    ++K 
Sbjct: 9   DDLIVIGKIYSVHGVRGEVKVFSFTDPIGNLLDYKTWTLRREGSVEKQVELVSGRLQSKF 68

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +A   G+D+   A  L   ++   R  F D  L++ E++   LE ++  D+ G+  G++
Sbjct: 69  LVAKLKGLDDREEARLLSGYEICVPRNLFPD--LDDGEYYWYQLEGLKVIDQLGQLLGKI 126

Query: 120 CGVYNFGAGSILEIKNT----MEKTFLIPFTKFAVLEVNLQENKILID 163
             +   G+  ++ +K       ++  L+P+T+  VL +++   ++ +D
Sbjct: 127 DHLLETGSNDVMVVKPCAGSLDDRERLLPYTEQCVLAIDMAAGEMKVD 174


>gi|331664173|ref|ZP_08365082.1| 16S rRNA processing protein RimM [Escherichia coli TA143]
 gi|331058630|gb|EGI30608.1| 16S rRNA processing protein RimM [Escherichia coli TA143]
          Length = 183

 Score =  133 bits (336), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 31/172 (18%), Positives = 74/172 (43%), Gaps = 12/172 (6%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRFI 61
             +++  +G+++G+ G + + S   +   +  Y  +        +++++      N+  I
Sbjct: 13  DPIVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQQVQLESWKHHNQDMI 72

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               G+D+  +A+ L + ++          +LEE +++  DL   +    +G   G+V  
Sbjct: 73  IKLKGVDDRDAANLLTNCEIVVDSSQLP--QLEEGDYYWKDLMGCQVVTTEGYDLGKVVD 130

Query: 122 VYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILIDPIAA 167
           +   G+  +L IK  ++     K  L+PF     + +V+L    I +D    
Sbjct: 131 MMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLTTRLIEVDWDPG 182


>gi|293556485|ref|ZP_06675059.1| 16S rRNA processing protein RimM [Enterococcus faecium E1039]
 gi|291601364|gb|EFF31642.1| 16S rRNA processing protein RimM [Enterococcus faecium E1039]
          Length = 173

 Score =  133 bits (336), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 31/176 (17%), Positives = 72/176 (40%), Gaps = 9/176 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR------YVLYSNDNRELRILKMYRKN 57
           + + + +  I  T G+ GEV + S  + P +  +               EL +    +  
Sbjct: 1   MTEYLNVGKIVNTQGIKGEVRVISTTDFPEERYKKGTVLTLFQDGKAPVELTVKSHRKHK 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              + +F G  +I+   + RD  L   + +    +L E+EF+  ++  +      G   G
Sbjct: 61  NFDLLSFEGHPSINDVEKYRDGILKVSKDN--SVDLAENEFYYHEIIGLHV-LEDGTELG 117

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTT 173
           +V  + + GA  +  ++   +   L+P+    V EV+L+   + ++     +++  
Sbjct: 118 KVKEILSPGANDVWVVQRPEKADILLPYIASVVKEVDLEAGVVRVEIPEGLIDDED 173


>gi|262043854|ref|ZP_06016943.1| 16S rRNA processing protein RimM [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|330013032|ref|ZP_08307554.1| 16S rRNA processing protein RimM [Klebsiella sp. MS 92-3]
 gi|259038788|gb|EEW39970.1| 16S rRNA processing protein RimM [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|328533618|gb|EGF60332.1| 16S rRNA processing protein RimM [Klebsiella sp. MS 92-3]
          Length = 183

 Score =  133 bits (336), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 31/172 (18%), Positives = 72/172 (41%), Gaps = 12/172 (6%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRFI 61
             +++  +G+++G+ G + + S   +   +  Y  +        + + +      N+  I
Sbjct: 13  DPIVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWLIQKAGQWQVVELESWRHHNQDII 72

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               G+D+  +A+ L + ++        +  LEE +++  DL   +    +G   G+V  
Sbjct: 73  IKLKGVDDRDAANLLTNCEIIVDSSQLPE--LEEGDYYWKDLMGCQVVTTEGYSLGKVID 130

Query: 122 VYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILIDPIAA 167
           +   G+  +L IK  ++     K  L+PF     + +V+L    I +D    
Sbjct: 131 MMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLTTRTIEVDWDPG 182


>gi|56479500|ref|YP_161089.1| 16S rRNA processing protein [Aromatoleum aromaticum EbN1]
 gi|67461302|sp|Q5NXM6|RIMM_AZOSE RecName: Full=Ribosome maturation factor rimM
 gi|56315543|emb|CAI10188.1| 16S rRNA processing protein [Aromatoleum aromaticum EbN1]
          Length = 168

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 31/166 (18%), Positives = 73/166 (43%), Gaps = 12/166 (7%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS---------NDNRELRILKMYRKN 57
           ++++  I    G+ G V +  + ++P+       +          +  + + +       
Sbjct: 1   MIVLGRIVAPFGVKGWVKVHPFGDDPLSWGEMPQWWLADDADAPESAWQPVTLAGFKEHG 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              +A F G D+ ++A  L+   + A R+     +++E  ++  DL  +   ++  +  G
Sbjct: 61  AGLVAAFVGHDDRNAAEALQGRFIGAPREALPKPDVDE--YYWGDLIGLAVVNQADEALG 118

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
            V  + + GA  +L++++  +   LIPF    VL+V+L    I +D
Sbjct: 119 TVEALMSTGAHDVLQVRDGDD-ERLIPFVAAYVLDVDLAARTIRVD 163


>gi|332686530|ref|YP_004456304.1| 16S rRNA processing protein RimM [Melissococcus plutonius ATCC
           35311]
 gi|332370539|dbj|BAK21495.1| 16S rRNA processing protein RimM [Melissococcus plutonius ATCC
           35311]
          Length = 175

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 34/174 (19%), Positives = 68/174 (39%), Gaps = 8/174 (4%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNR------YVLYSNDNRELRILKMYRKNKR 59
           + + +  I  T G+ GEV + S  + P +  +            +  EL I    +    
Sbjct: 4   EYLNVGKIVNTQGIKGEVRVISQTDFPEERYKRGAKLTLFNKDKEPIELVIKSHRKHKNF 63

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I +F    +I+     RD  L  K+    D  L E+EF+  ++  +   D QG+  G +
Sbjct: 64  DILSFENHPSINDVENYRDGILKVKKSQLSD--LPENEFYYHEIIGLTVIDDQGQKIGHI 121

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTT 173
             + + GA  +  +K       L+P+    +  V+L    + +      +++  
Sbjct: 122 KEILSPGANDVWVVKQNDGTELLLPYIDSVIQSVDLTNKSVQVIIPEGLIDDEN 175


>gi|117624830|ref|YP_853743.1| 16S rRNA-processing protein [Escherichia coli APEC O1]
 gi|170681223|ref|YP_001744791.1| 16S rRNA-processing protein RimM [Escherichia coli SMS-3-5]
 gi|187775815|ref|ZP_02798472.2| 16S rRNA processing protein RimM [Escherichia coli O157:H7 str.
           EC4196]
 gi|189009961|ref|ZP_02803593.2| 16S rRNA processing protein RimM [Escherichia coli O157:H7 str.
           EC4076]
 gi|189402631|ref|ZP_02783684.2| 16S rRNA processing protein RimM [Escherichia coli O157:H7 str.
           EC4401]
 gi|189403179|ref|ZP_02793703.2| 16S rRNA processing protein RimM [Escherichia coli O157:H7 str.
           EC4486]
 gi|189404126|ref|ZP_02787407.2| 16S rRNA processing protein RimM [Escherichia coli O157:H7 str.
           EC4501]
 gi|189405285|ref|ZP_02814517.2| 16S rRNA processing protein RimM [Escherichia coli O157:H7 str.
           EC869]
 gi|189406162|ref|ZP_02826732.2| 16S rRNA processing protein RimM [Escherichia coli O157:H7 str.
           EC508]
 gi|191169052|ref|ZP_03030815.1| 16S rRNA processing protein RimM [Escherichia coli B7A]
 gi|191174576|ref|ZP_03036071.1| 16S rRNA processing protein RimM [Escherichia coli F11]
 gi|193064059|ref|ZP_03045144.1| 16S rRNA processing protein RimM [Escherichia coli E22]
 gi|193071700|ref|ZP_03052601.1| 16S rRNA processing protein RimM [Escherichia coli E110019]
 gi|194430174|ref|ZP_03062675.1| 16S rRNA processing protein RimM [Escherichia coli B171]
 gi|194435112|ref|ZP_03067348.1| 16S rRNA processing protein RimM [Shigella dysenteriae 1012]
 gi|194439326|ref|ZP_03071404.1| 16S rRNA processing protein RimM [Escherichia coli 101-1]
 gi|208807311|ref|ZP_03249648.1| 16S rRNA processing protein RimM [Escherichia coli O157:H7 str.
           EC4206]
 gi|208812607|ref|ZP_03253936.1| 16S rRNA processing protein RimM [Escherichia coli O157:H7 str.
           EC4045]
 gi|208821784|ref|ZP_03262104.1| 16S rRNA processing protein RimM [Escherichia coli O157:H7 str.
           EC4042]
 gi|209396490|ref|YP_002272079.1| 16S rRNA processing protein RimM [Escherichia coli O157:H7 str.
           EC4115]
 gi|217327249|ref|ZP_03443332.1| 16S rRNA processing protein RimM [Escherichia coli O157:H7 str.
           TW14588]
 gi|227888174|ref|ZP_04005979.1| 16S rRNA-processing protein [Escherichia coli 83972]
 gi|261255685|ref|ZP_05948218.1| 16S rRNA-processing protein RimM [Escherichia coli O157:H7 str.
           FRIK966]
 gi|291283880|ref|YP_003500698.1| 16S rRNA-processing protein rimM [Escherichia coli O55:H7 str.
           CB9615]
 gi|300819919|ref|ZP_07100102.1| 16S rRNA processing protein RimM [Escherichia coli MS 107-1]
 gi|300825116|ref|ZP_07105209.1| 16S rRNA processing protein RimM [Escherichia coli MS 119-7]
 gi|300900206|ref|ZP_07118394.1| 16S rRNA processing protein RimM [Escherichia coli MS 198-1]
 gi|300921152|ref|ZP_07137531.1| 16S rRNA processing protein RimM [Escherichia coli MS 115-1]
 gi|300925600|ref|ZP_07141470.1| 16S rRNA processing protein RimM [Escherichia coli MS 182-1]
 gi|300930667|ref|ZP_07146053.1| 16S rRNA processing protein RimM [Escherichia coli MS 187-1]
 gi|300940946|ref|ZP_07155470.1| 16S rRNA processing protein RimM [Escherichia coli MS 21-1]
 gi|300949003|ref|ZP_07163056.1| 16S rRNA processing protein RimM [Escherichia coli MS 116-1]
 gi|300957392|ref|ZP_07169606.1| 16S rRNA processing protein RimM [Escherichia coli MS 175-1]
 gi|300986822|ref|ZP_07177811.1| 16S rRNA processing protein RimM [Escherichia coli MS 45-1]
 gi|300990722|ref|ZP_07179307.1| 16S rRNA processing protein RimM [Escherichia coli MS 200-1]
 gi|301026376|ref|ZP_07189822.1| 16S rRNA processing protein RimM [Escherichia coli MS 69-1]
 gi|301326727|ref|ZP_07220041.1| 16S rRNA processing protein RimM [Escherichia coli MS 78-1]
 gi|301644050|ref|ZP_07244066.1| 16S rRNA processing protein RimM [Escherichia coli MS 146-1]
 gi|309794119|ref|ZP_07688543.1| 16S rRNA processing protein RimM [Escherichia coli MS 145-7]
 gi|331658756|ref|ZP_08359698.1| 16S rRNA processing protein RimM [Escherichia coli TA206]
 gi|331669358|ref|ZP_08370204.1| 16S rRNA processing protein RimM [Escherichia coli TA271]
 gi|331684264|ref|ZP_08384856.1| 16S rRNA processing protein RimM [Escherichia coli H299]
 gi|209573578|sp|B1LPB5|RIMM_ECOSM RecName: Full=Ribosome maturation factor rimM
 gi|238058950|sp|B5Z227|RIMM_ECO5E RecName: Full=Ribosome maturation factor rimM
 gi|115513954|gb|ABJ02029.1| 16S rRNA processing protein [Escherichia coli APEC O1]
 gi|170518941|gb|ACB17119.1| 16S rRNA processing protein RimM [Escherichia coli SMS-3-5]
 gi|187770590|gb|EDU34434.1| 16S rRNA processing protein RimM [Escherichia coli O157:H7 str.
           EC4196]
 gi|189003397|gb|EDU72383.1| 16S rRNA processing protein RimM [Escherichia coli O157:H7 str.
           EC4076]
 gi|189354552|gb|EDU72971.1| 16S rRNA processing protein RimM [Escherichia coli O157:H7 str.
           EC4401]
 gi|189362106|gb|EDU80525.1| 16S rRNA processing protein RimM [Escherichia coli O157:H7 str.
           EC4486]
 gi|189367231|gb|EDU85647.1| 16S rRNA processing protein RimM [Escherichia coli O157:H7 str.
           EC4501]
 gi|189370850|gb|EDU89266.1| 16S rRNA processing protein RimM [Escherichia coli O157:H7 str.
           EC869]
 gi|189376158|gb|EDU94574.1| 16S rRNA processing protein RimM [Escherichia coli O157:H7 str.
           EC508]
 gi|190900893|gb|EDV60679.1| 16S rRNA processing protein RimM [Escherichia coli B7A]
 gi|190905149|gb|EDV64793.1| 16S rRNA processing protein RimM [Escherichia coli F11]
 gi|192929294|gb|EDV82903.1| 16S rRNA processing protein RimM [Escherichia coli E22]
 gi|192954995|gb|EDV85497.1| 16S rRNA processing protein RimM [Escherichia coli E110019]
 gi|194411799|gb|EDX28120.1| 16S rRNA processing protein RimM [Escherichia coli B171]
 gi|194416643|gb|EDX32776.1| 16S rRNA processing protein RimM [Shigella dysenteriae 1012]
 gi|194421688|gb|EDX37697.1| 16S rRNA processing protein RimM [Escherichia coli 101-1]
 gi|208727112|gb|EDZ76713.1| 16S rRNA processing protein RimM [Escherichia coli O157:H7 str.
           EC4206]
 gi|208733884|gb|EDZ82571.1| 16S rRNA processing protein RimM [Escherichia coli O157:H7 str.
           EC4045]
 gi|208741907|gb|EDZ89589.1| 16S rRNA processing protein RimM [Escherichia coli O157:H7 str.
           EC4042]
 gi|209157890|gb|ACI35323.1| 16S rRNA processing protein RimM [Escherichia coli O157:H7 str.
           EC4115]
 gi|217319616|gb|EEC28041.1| 16S rRNA processing protein RimM [Escherichia coli O157:H7 str.
           TW14588]
 gi|227834814|gb|EEJ45280.1| 16S rRNA-processing protein [Escherichia coli 83972]
 gi|290763753|gb|ADD57714.1| 16S rRNA-processing protein rimM [Escherichia coli O55:H7 str.
           CB9615]
 gi|294491107|gb|ADE89863.1| 16S rRNA processing protein RimM [Escherichia coli IHE3034]
 gi|300305690|gb|EFJ60210.1| 16S rRNA processing protein RimM [Escherichia coli MS 200-1]
 gi|300315827|gb|EFJ65611.1| 16S rRNA processing protein RimM [Escherichia coli MS 175-1]
 gi|300356263|gb|EFJ72133.1| 16S rRNA processing protein RimM [Escherichia coli MS 198-1]
 gi|300395562|gb|EFJ79100.1| 16S rRNA processing protein RimM [Escherichia coli MS 69-1]
 gi|300407874|gb|EFJ91412.1| 16S rRNA processing protein RimM [Escherichia coli MS 45-1]
 gi|300411902|gb|EFJ95212.1| 16S rRNA processing protein RimM [Escherichia coli MS 115-1]
 gi|300418295|gb|EFK01606.1| 16S rRNA processing protein RimM [Escherichia coli MS 182-1]
 gi|300451530|gb|EFK15150.1| 16S rRNA processing protein RimM [Escherichia coli MS 116-1]
 gi|300454270|gb|EFK17763.1| 16S rRNA processing protein RimM [Escherichia coli MS 21-1]
 gi|300461464|gb|EFK24957.1| 16S rRNA processing protein RimM [Escherichia coli MS 187-1]
 gi|300522388|gb|EFK43457.1| 16S rRNA processing protein RimM [Escherichia coli MS 119-7]
 gi|300527507|gb|EFK48569.1| 16S rRNA processing protein RimM [Escherichia coli MS 107-1]
 gi|300846587|gb|EFK74347.1| 16S rRNA processing protein RimM [Escherichia coli MS 78-1]
 gi|301077595|gb|EFK92401.1| 16S rRNA processing protein RimM [Escherichia coli MS 146-1]
 gi|308122024|gb|EFO59286.1| 16S rRNA processing protein RimM [Escherichia coli MS 145-7]
 gi|315284816|gb|EFU44261.1| 16S rRNA processing protein RimM [Escherichia coli MS 110-3]
 gi|315290951|gb|EFU50316.1| 16S rRNA processing protein RimM [Escherichia coli MS 153-1]
 gi|315298673|gb|EFU57927.1| 16S rRNA processing protein RimM [Escherichia coli MS 16-3]
 gi|320177025|gb|EFW52046.1| 16S rRNA processing protein RimM [Shigella dysenteriae CDC 74-1112]
 gi|320182478|gb|EFW57372.1| 16S rRNA processing protein RimM [Shigella boydii ATCC 9905]
 gi|320188943|gb|EFW63602.1| 16S rRNA processing protein RimM [Escherichia coli O157:H7 str.
           EC1212]
 gi|320194772|gb|EFW69401.1| 16S rRNA processing protein RimM [Escherichia coli WV_060327]
 gi|320198381|gb|EFW72983.1| 16S rRNA processing protein RimM [Escherichia coli EC4100B]
 gi|324005824|gb|EGB75043.1| 16S rRNA processing protein RimM [Escherichia coli MS 57-2]
 gi|324012446|gb|EGB81665.1| 16S rRNA processing protein RimM [Escherichia coli MS 60-1]
 gi|324016588|gb|EGB85807.1| 16S rRNA processing protein RimM [Escherichia coli MS 117-3]
 gi|326344360|gb|EGD68118.1| 16S rRNA processing protein RimM [Escherichia coli O157:H7 str.
           1125]
 gi|326347729|gb|EGD71446.1| 16S rRNA processing protein RimM [Escherichia coli O157:H7 str.
           1044]
 gi|330912371|gb|EGH40881.1| 16S rRNA processing protein RimM [Escherichia coli AA86]
 gi|331053338|gb|EGI25367.1| 16S rRNA processing protein RimM [Escherichia coli TA206]
 gi|331063026|gb|EGI34939.1| 16S rRNA processing protein RimM [Escherichia coli TA271]
 gi|331077879|gb|EGI49085.1| 16S rRNA processing protein RimM [Escherichia coli H299]
          Length = 183

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 31/172 (18%), Positives = 74/172 (43%), Gaps = 12/172 (6%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRFI 61
             +++  +G+++G+ G + + S   +   +  Y  +        +++++      N+  I
Sbjct: 13  DPIVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQQVQLESWKHHNQDMI 72

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               G+D+  +A+ L + ++          +LEE +++  DL   +    +G   G+V  
Sbjct: 73  IKLKGVDDRDAANLLTNCEIVVDSSQLP--QLEEGDYYWKDLMGCQVVTTEGYDLGKVVD 130

Query: 122 VYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILIDPIAA 167
           +   G+  +L IK  ++     K  L+PF     + +V+L    I +D    
Sbjct: 131 MMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLTTRSIEVDWDPG 182


>gi|291087694|ref|ZP_06347205.2| 16S rRNA processing protein RimM [Clostridium sp. M62/1]
 gi|291074191|gb|EFE11555.1| 16S rRNA processing protein RimM [Clostridium sp. M62/1]
          Length = 170

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 34/171 (19%), Positives = 70/171 (40%), Gaps = 6/171 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRE----LRILKMYRKNKR 59
           +++ + +  I + HG+ GEV +    ++     +      D  +    L + ++      
Sbjct: 1   MEQFLRVGVITSPHGVRGEVKVFPTTDDINRFKKLKEVFLDTGKEKILLHVEQVKFFKGM 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F    +I+     R   L   R   K  +L  +E F  DL  +     +G+ +G V
Sbjct: 61  AILKFKEFGSINEVEPFRKKDLLVSRD--KAVKLAPNENFIVDLIGLTVVTDEGEEFGTV 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
             +    A  +  I+    K +L P  K  +L+V+L+  ++L+  +   L+
Sbjct: 119 KDILQTAANDVYVIEGKDHKEYLFPSIKECILDVDLEAGRVLVHIMDGLLD 169


>gi|255655266|ref|ZP_05400675.1| putative 16S rRNA processing protein [Clostridium difficile
           QCD-23m63]
 gi|296451251|ref|ZP_06892991.1| 16S rRNA processing protein RimM [Clostridium difficile NAP08]
 gi|296880397|ref|ZP_06904360.1| 16S rRNA processing protein RimM [Clostridium difficile NAP07]
 gi|296259857|gb|EFH06712.1| 16S rRNA processing protein RimM [Clostridium difficile NAP08]
 gi|296428638|gb|EFH14522.1| 16S rRNA processing protein RimM [Clostridium difficile NAP07]
          Length = 171

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 51/173 (29%), Positives = 82/173 (47%), Gaps = 5/173 (2%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDL---NRYVLYSNDNRELRILKMYRKN 57
           M +      +  I  T GL GEV +    ++         + L  + N +L + K+  K 
Sbjct: 1   MKEKLTHFKVGQIVNTQGLKGEVRVYPLTDDIERFDELKDFYLGKDLNNKLSVEKVRYKG 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              I    GID+I  A +L++  +Y  R+D    ELEE EFF  D+  +E     GKY G
Sbjct: 61  SMVIMKIKGIDSIEKAEKLKNKFMYVSRED--SRELEEGEFFIADMIGIEVLTVDGKYVG 118

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
            +  V  + A  +  +K   +K F+IP  K  V  +++ E K++IDPI   ++
Sbjct: 119 ILEDVLQYSANDVYVVKGEEDKEFMIPAIKKFVPTIDIDERKMIIDPIKGMID 171


>gi|296104278|ref|YP_003614424.1| 16S rRNA-processing protein RimM [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295058737|gb|ADF63475.1| 16S rRNA-processing protein RimM [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 179

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 33/180 (18%), Positives = 74/180 (41%), Gaps = 15/180 (8%)

Query: 1   MVKLD---KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKM 53
           M+      + +++  +G+ +G+ G + + S   +   +  Y  +         E+ +   
Sbjct: 1   MMSNKAPVEPIVLGKMGSCYGIRGWLRVFSSTEDADSIFNYQPWFIQKGGKWEEVELESW 60

Query: 54  YRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQG 113
              N+  I    G+D+  +A+ L + ++        +  LEE +++  DL   +    +G
Sbjct: 61  RHHNQDIIIKLKGVDDRDAANALTNCEIVVDSSQLPE--LEEGDYYWKDLMGCQVVTTEG 118

Query: 114 KYWGQVCGVYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILIDPIAA 167
              G+V  +   G+  +L IK  ++     K  L+PF     + +V+L    I +D    
Sbjct: 119 YSLGKVIDMMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLATQTIEVDWDPG 178


>gi|291542203|emb|CBL15313.1| 16S rRNA processing protein RimM [Ruminococcus bromii L2-63]
          Length = 171

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 47/173 (27%), Positives = 77/173 (44%), Gaps = 6/173 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDL--NRYVLYSNDNRELRILKMYRKNKRFI 61
             + +    I  THG+ GEV ID + ++P  L   + +    +  E   +K        +
Sbjct: 2   KKQFLDSGKIVGTHGIKGEVRIDPWCDSPEFLCAFKKLWLDENGTEFIEVKSRPHKNIAL 61

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDR-QGKYWGQVC 120
           A   G+D I +A + R   +Y  R D     L E   F  DL  +E  D   G+ +G++ 
Sbjct: 62  AKIKGVDTIEAAEKYRGKVVYINRDD---INLAEGVHFVQDLIGLEVKDAGNGRVYGKIS 118

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTT 173
            V   GA  + EIK+   KT+L P     V E+N+ +  +LI P+    ++  
Sbjct: 119 DVLRTGANDVYEIKDADGKTYLAPVIDDVVKEINVNDGYVLIVPMKGIFDDED 171


>gi|317057389|ref|YP_004105856.1| 16S rRNA processing protein RimM [Ruminococcus albus 7]
 gi|315449658|gb|ADU23222.1| 16S rRNA processing protein RimM [Ruminococcus albus 7]
          Length = 172

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 42/173 (24%), Positives = 78/173 (45%), Gaps = 5/173 (2%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYV-LYSNDNRELRILKMYRKNKRFIA 62
           ++KL+    I +  GL GEV +  + + P  L  +  LY      + + +   +    + 
Sbjct: 1   MNKLLEAGKIVSVFGLKGEVKVQPWCDTPDFLCEFDTLYYKSGTPVEVERARVQKNIVVM 60

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFD-RQGKYWGQVCG 121
              G+D++  A ++R+  LY  R+D    EL ED +F  DL  ++  D   GK +G +  
Sbjct: 61  KIKGVDSVEEAQKIRNRVLYLDRED---VELGEDTYFVQDLIGLKVIDLNSGKEYGVLTE 117

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTM 174
           V   GA  +  IK+   K + IP     + E +++   + I P+    ++   
Sbjct: 118 VSETGANDVYHIKSESGKMYYIPAIPSVIAETDVEGGVMKITPLEGLFDDAEE 170


>gi|104783232|ref|YP_609730.1| 16S rRNA-processing protein RimM [Pseudomonas entomophila L48]
 gi|122402143|sp|Q1I5Y9|RIMM_PSEE4 RecName: Full=Ribosome maturation factor rimM
 gi|95112219|emb|CAK16946.1| 16S rRNA processing protein [Pseudomonas entomophila L48]
          Length = 178

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 32/169 (18%), Positives = 76/169 (44%), Gaps = 10/169 (5%)

Query: 3   KLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNK 58
           K D L+++  I + HG+ GEV + S+ +   +L  Y  ++       +++ ++      K
Sbjct: 7   KADDLIVVGKIFSVHGVRGEVKVYSFTDPIENLLDYPRWTLRHEGKVKQVELVSGRGSQK 66

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
             +    G+D+   A  L   ++   R    +   +E  ++   L  ++  ++    +G+
Sbjct: 67  GLVVKLKGLDDRDEARLLSGHEICISRSLLPNLATDE--YYWYQLVGLKVINQDEHLFGK 124

Query: 119 VCGVYNFGAGSILEIKNT----MEKTFLIPFTKFAVLEVNLQENKILID 163
           +  +   GA  +L +K       ++  L+P+T   VL V+L+   + ++
Sbjct: 125 IDHLLETGANDVLVVKPCAGSLDDRERLLPYTGQCVLAVDLEAGVMRVE 173


>gi|319407794|emb|CBI81445.1| Ribosome maturation factor rimM [Bartonella sp. 1-1C]
          Length = 171

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 56/172 (32%), Positives = 95/172 (55%), Gaps = 3/172 (1%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND-NRELRILKMYRKNKRFIA 62
           + K V +A IG  HG+NG+V +   ++NP  L  Y ++ ++  R   ++    +    I 
Sbjct: 1   MKKKVYLAIIGAAHGINGDVVVKVLSSNPESLKSYSVFYDETERSYEVVTFRVQKNNAII 60

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F GI+   +A  LR +KLY +R    D+ L+EDEF+  DL  +  ++   ++ G+V G 
Sbjct: 61  HFKGIEERSAAESLRGIKLYVERNQLADD-LDEDEFYQIDLIGLCVYNCAKQFLGKVSGF 119

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPI-AAGLNNTT 173
           +NFGAG ++EI+    K  LI F+K AV E+ +    +++DPI A   ++  
Sbjct: 120 FNFGAGDLIEIQLVSGKKVLISFSKAAVPEICVASGFLIVDPIAAGLFHDQE 171


>gi|295097176|emb|CBK86266.1| 16S rRNA processing protein RimM [Enterobacter cloacae subsp.
           cloacae NCTC 9394]
          Length = 179

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 34/180 (18%), Positives = 74/180 (41%), Gaps = 15/180 (8%)

Query: 1   MVKLD---KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKM 53
           M+      + +++  +G+ +G+ G + + S   +   +  Y  +         E+ +   
Sbjct: 1   MMSNKAPVEPIVLGKMGSCYGIRGWLRVFSSTEDADSIFNYQPWFIQKAGKWEEVELESW 60

Query: 54  YRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQG 113
              N+  I    GID+  +A+ L + ++          +LEE +++  DL   +    +G
Sbjct: 61  RHHNQDIIIKLKGIDDRDAANALTNCEIVVDSSQLP--QLEEGDYYWKDLMGCQVVTTEG 118

Query: 114 KYWGQVCGVYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILIDPIAA 167
              G+V  +   G+  +L IK  ++     K  L+PF     + +V+L    I +D    
Sbjct: 119 YSLGKVIDMMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLTTQTIEVDWDPG 178


>gi|209573735|sp|A9WP46|RIMM_RENSM RecName: Full=Ribosome maturation factor rimM
          Length = 175

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 33/174 (18%), Positives = 63/174 (36%), Gaps = 5/174 (2%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNR----YVLYSNDNRELRILKMYRKNKRFIAT 63
           V +  IG  HG+ GEV ++   + P +       +         L +          +  
Sbjct: 3   VHVGRIGKPHGIRGEVTVEVLTDTPQERFSAGAVFSTEPTSAGPLTVETARWNKDILLLG 62

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F  +++ + A  LR  +L  +      +E E D ++  +L  +E      +  G+V  + 
Sbjct: 63  FEEVNDRNRAETLRGTRLIFETDSVASDESESDSWYEHELIGLEA-RVGDQTVGKVSALN 121

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNP 177
              A  +L I     +  L+PF    V EV++    I + P     +       
Sbjct: 122 PMPAQDLLVITTAAGEEVLVPFVAEIVPEVDIAAGFIRLVPPGGLFDINRKDAE 175


>gi|257884158|ref|ZP_05663811.1| ribosome maturation factor rimM [Enterococcus faecium 1,231,501]
 gi|257819996|gb|EEV47144.1| ribosome maturation factor rimM [Enterococcus faecium 1,231,501]
          Length = 173

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 31/176 (17%), Positives = 72/176 (40%), Gaps = 9/176 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR------YVLYSNDNRELRILKMYRKN 57
           + + + +  I  T G+ GEV + S  + P +  +               EL +    +  
Sbjct: 1   MTEYLNVGKIVNTQGIKGEVRVISTTDFPEERYKKGTVLTLFQDGKAPVELTVKSHRKHK 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              + +F G  +I+   + RD  L   + +    +L E+EF+  ++  +      G   G
Sbjct: 61  NFDLLSFEGHPSINDVEKYRDGILKVSKDN--SVDLAENEFYYHEIIGLRV-LEDGTELG 117

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTT 173
           +V  + + GA  +  ++   +   L+P+    V EV+L+   + ++     +++  
Sbjct: 118 KVKEILSPGANDVWVVQRPKKADILLPYIASVVKEVDLEAGVVRVEIPEGLIDDED 173


>gi|288550296|ref|ZP_05969897.2| 16S rRNA processing protein RimM [Enterobacter cancerogenus ATCC
           35316]
 gi|288315695|gb|EFC54633.1| 16S rRNA processing protein RimM [Enterobacter cancerogenus ATCC
           35316]
          Length = 179

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 33/180 (18%), Positives = 74/180 (41%), Gaps = 15/180 (8%)

Query: 1   MVKLD---KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKM 53
           M+      + +++  +G+ +G+ G + + S   +   +  Y  +         E+ +   
Sbjct: 1   MMSNKAPVEPIVLGKMGSCYGIRGWLRVFSSTEDADSIFNYQPWFIQKAGKWEEVELESW 60

Query: 54  YRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQG 113
              N+  I    G+D+  +A+ L + ++          +LEE +++  DL   +    +G
Sbjct: 61  RHHNQDIIIKLKGVDDRDAANALTNCEIVVDSSQLP--QLEEGDYYWKDLMGCQVVTTEG 118

Query: 114 KYWGQVCGVYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILIDPIAA 167
              G+V  +   G+  +L IK  ++     K  L+PF     + +V+L    I +D    
Sbjct: 119 YSLGKVIDMMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLTTQTIEVDWDPG 178


>gi|74318392|ref|YP_316132.1| 16S rRNA processing protein RimM [Thiobacillus denitrificans ATCC
           25259]
 gi|109893066|sp|Q3SGC3|RIMM_THIDA RecName: Full=Ribosome maturation factor rimM
 gi|74057887|gb|AAZ98327.1| 16S rRNA processing protein RimM [Thiobacillus denitrificans ATCC
           25259]
          Length = 189

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 37/163 (22%), Positives = 74/163 (45%), Gaps = 8/163 (4%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNP---IDLNRYVLYSNDNRELRILKMYR-KNKRF 60
           +  V+M  +    G+ G V +  ++ +P   +D   + +   + +    ++  +   K  
Sbjct: 26  EAWVVMGRVSAPFGVKGWVKVQPFSEDPGTLMDFESWRVGRGEQQAQYAVEAVQDHGKSL 85

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +A   GID+  +A  LR  ++   +        EE+EF+ +DL  +   +R+G   G+V 
Sbjct: 86  VAKLVGIDDRDAAFALRGQEVSVAKSALPPP--EENEFYWSDLIGLTVMNREGVELGKVD 143

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
            +   GA  +L +K    +  LIPF    V +V+L    + +D
Sbjct: 144 SLMESGAHDLLVVK--GRREHLIPFVAAFVGKVDLAGGTVEVD 184


>gi|294139728|ref|YP_003555706.1| 16S rRNA processing protein RimM [Shewanella violacea DSS12]
 gi|293326197|dbj|BAJ00928.1| 16S rRNA processing protein RimM [Shewanella violacea DSS12]
          Length = 177

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 42/173 (24%), Positives = 84/173 (48%), Gaps = 12/173 (6%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRK 56
           M    + V++  +G++HG+ G + I +Y ++   +  Y  +      + RE+++L+   +
Sbjct: 2   MSSKQEPVVLGKLGSSHGIKGWLKITTYTDSVEGIFDYSPWLIKEQGEWREVKVLQWRFQ 61

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
            K  +A+  G++    A  L + ++    Q  +   L EDEF+  DL   E  + +G   
Sbjct: 62  GKAVVASLEGVETRDQAQMLTNCEIAVTLQQME--TLPEDEFYWRDLIGCEVVNTKGYNM 119

Query: 117 GQVCGVYNFGAGSILEIKNT-----MEKTFLIPFT-KFAVLEVNLQENKILID 163
           G+V  +   G+  +L +K        +   +IPF  +  ++EVNL E +I +D
Sbjct: 120 GKVQEIVETGSNDVLLVKANAKDGFGKAERMIPFVTEQFIIEVNLTEKQITVD 172


>gi|186682347|ref|YP_001865543.1| 16S rRNA-processing protein RimM [Nostoc punctiforme PCC 73102]
 gi|209573584|sp|B2J3X9|RIMM_NOSP7 RecName: Full=Ribosome maturation factor rimM
 gi|186464799|gb|ACC80600.1| 16S rRNA processing protein RimM [Nostoc punctiforme PCC 73102]
          Length = 235

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 47/184 (25%), Positives = 83/184 (45%), Gaps = 19/184 (10%)

Query: 3   KLDKLVLMATIGTTHGLNGEVYIDSYANNPIDL----NRYVLYSN--DNRELRILKMYR- 55
            LD  + +  I +  GL+GE+ +   ++ P        R++L+ +  + + +++L     
Sbjct: 52  NLDNWLEIGKIVSPQGLSGELKVYPVSDFPERFEVPGKRWLLHLDGTEPQPIQLLTGRYI 111

Query: 56  -KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDR-QG 113
                ++   +G++N   A  LR  KL     D    +L EDE+   DL  +E F +  G
Sbjct: 112 SNKNLYVIKLAGVENCDQAEALRGCKLMVPASDRP--QLAEDEYHVLDLIGLEVFMQASG 169

Query: 114 KYWGQVCGVYNFGAGSILEIK-------NTMEKTFLIPFTKFAVLEVNLQENKILIDPIA 166
           +  G V  +   G   +LE+K       +  +KT LIPF +     V+L+ N+I I P  
Sbjct: 170 ELVGTVVDIIPAG-NDLLEVKLHPSFTTDKKQKTVLIPFVEAIAPVVDLKSNRIEITPPP 228

Query: 167 AGLN 170
             L 
Sbjct: 229 GLLE 232


>gi|92115130|ref|YP_575058.1| 16S rRNA processing protein RimM [Chromohalobacter salexigens DSM
           3043]
 gi|122419171|sp|Q1QT49|RIMM_CHRSD RecName: Full=Ribosome maturation factor rimM
 gi|91798220|gb|ABE60359.1| 16S rRNA processing protein RimM [Chromohalobacter salexigens DSM
           3043]
          Length = 184

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 31/168 (18%), Positives = 73/168 (43%), Gaps = 11/168 (6%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRKNKRF 60
           D+ V++  + + +G+ G + + SY +    +  +  +      + R  ++ +     K  
Sbjct: 14  DEHVVLGRLTSPYGVKGWLKVYSYTSPIEGIFEHAEWVLSKRGERRACKLSQGRPHGKGL 73

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +A+  GI +   A +     +   +Q      L   +++   LE +      G+  GQV 
Sbjct: 74  VASLEGISSRELAEQWAGADILLPKQALPA--LAPGDYYWYQLEGLRVETLDGECLGQVN 131

Query: 121 GVYNFGAGSILEIKNT----MEKTFLIPFT-KFAVLEVNLQENKILID 163
            ++  GA  +L I+ +     E+  L+PF     + +V+L   ++++D
Sbjct: 132 YLFETGANDVLVIRPSEASLDERERLLPFLPDDVIRQVDLDAGRMIVD 179


>gi|317493966|ref|ZP_07952383.1| 16S rRNA processing protein RimM [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316918293|gb|EFV39635.1| 16S rRNA processing protein RimM [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 180

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 31/178 (17%), Positives = 77/178 (43%), Gaps = 13/178 (7%)

Query: 1   MVK-LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYR 55
           M K L   V++  +G+++G+ G + + S   +   +  Y  +        + + +    R
Sbjct: 4   MSKQLTNPVVLGKLGSSYGIRGWLRVFSSTEDAESIFEYQPWFIQQAGQWQHVELESWKR 63

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
            N+  +    G+D+  +A+ L + ++  +     +  LE+ +++  DL   +     G  
Sbjct: 64  HNQDLVIKIKGVDDRDAANALTNREIVVEESQLPE--LEDGDYYWKDLMGCQVVTTAGYE 121

Query: 116 WGQVCGVYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILIDPIAA 167
            G++  +   G+  ++ +K  ++     K  LIPF     + +V+L  + + +D    
Sbjct: 122 LGKIIDMMETGSNDVMVVKANLKDAFGIKERLIPFLDGQVIKKVDLATHIVEVDWDPG 179


>gi|313202053|ref|YP_004040711.1| 16S rRNA processing protein rimm [Methylovorus sp. MP688]
 gi|312441369|gb|ADQ85475.1| 16S rRNA processing protein RimM [Methylovorus sp. MP688]
          Length = 161

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 36/158 (22%), Positives = 68/158 (43%), Gaps = 6/158 (3%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRKNKRFIATFS 65
           M  +   +G+ G + I         L  Y  +        +E  +       K  +    
Sbjct: 1   MGRVVAPYGIYGWLKIQPDTETIDSLFDYDNWWLGRDPKWQEYPVEAAKVHGKTLLVKLV 60

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNF 125
           GID+  +A   +  ++   R+   +   EE E++ +DL  +   + Q   +G V  V+  
Sbjct: 61  GIDDRDAAFAAKGKQVSVPREQLPEA--EEGEYYWSDLIGLRVSNLQQVDFGTVVDVFET 118

Query: 126 GAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
           GA  ++ +K+   +  L+PFT  AV EVN++   +L+D
Sbjct: 119 GANDVVVVKDDAGRERLVPFTAEAVPEVNVEAGTMLVD 156


>gi|253990677|ref|YP_003042033.1| 16S rRNA-processing protein RimM [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253782127|emb|CAQ85291.1| 16s rrna processing protein rimm [Photorhabdus asymbiotica]
          Length = 185

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 29/183 (15%), Positives = 73/183 (39%), Gaps = 18/183 (9%)

Query: 1   MVKLDKL------VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRI 50
           M K          +++  +G+ +G+ G + + S   +  ++  Y  +        + + +
Sbjct: 4   MSKQANFELPVKPIVLGKLGSAYGIRGWLRVFSSTEHAENIFEYQPWFIQRAGRWQHIEL 63

Query: 51  LKMYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFD 110
                 N+  +    GID+  +A+ L + ++    +   +  L+  +++  DL   +  +
Sbjct: 64  EAWKHHNQDMVIKIKGIDDRDAANLLTNCEIIVDSEQLPE--LDAGDYYWKDLMGCQVVN 121

Query: 111 RQGKYWGQVCGVYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILIDP 164
             G   G +  +   G+  ++ +K  ++     K  LIPF     + +V+L    I +D 
Sbjct: 122 TAGYSLGTISDMMETGSNDVMVVKANLKDAFGIKERLIPFLDGQVIKKVDLATKTIEVDW 181

Query: 165 IAA 167
              
Sbjct: 182 DPG 184


>gi|238896054|ref|YP_002920790.1| 16S rRNA-processing protein RimM [Klebsiella pneumoniae NTUH-K2044]
 gi|238548372|dbj|BAH64723.1| 16S rRNA-processing protein [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
          Length = 185

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 31/172 (18%), Positives = 72/172 (41%), Gaps = 12/172 (6%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRFI 61
             +++  +G+++G+ G + + S   +   +  Y  +        + + +      N+  I
Sbjct: 15  DPIVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWLIQKAGQWQVVELESWRHHNQDII 74

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               G+D+  +A+ L + ++        +  LEE +++  DL   +    +G   G+V  
Sbjct: 75  IKLKGVDDRDAANLLTNCEIIVDSSQLPE--LEEGDYYWKDLMGCQVVTTEGYSLGKVID 132

Query: 122 VYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILIDPIAA 167
           +   G+  +L IK  ++     K  L+PF     + +V+L    I +D    
Sbjct: 133 MMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLTTRTIEVDWDPG 184


>gi|153813991|ref|ZP_01966659.1| hypothetical protein RUMTOR_00198 [Ruminococcus torques ATCC 27756]
 gi|317501514|ref|ZP_07959712.1| 16S rRNA-processing protein [Lachnospiraceae bacterium 8_1_57FAA]
 gi|331088011|ref|ZP_08336933.1| 16S rRNA processing protein RimM [Lachnospiraceae bacterium
           3_1_46FAA]
 gi|145848387|gb|EDK25305.1| hypothetical protein RUMTOR_00198 [Ruminococcus torques ATCC 27756]
 gi|316897143|gb|EFV19216.1| 16S rRNA-processing protein [Lachnospiraceae bacterium 8_1_57FAA]
 gi|330409159|gb|EGG88614.1| 16S rRNA processing protein RimM [Lachnospiraceae bacterium
           3_1_46FAA]
          Length = 168

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 40/170 (23%), Positives = 80/170 (47%), Gaps = 7/170 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYV--LYSNDNRELRIL--KMYRKNKR 59
           +++ + +  I +THG+ GEV +    ++P    +    +     R++ +    +    + 
Sbjct: 1   MEQFLQVGAITSTHGIRGEVKVFPTTDDPARFKKLKKVILDTGKRQIDMEIQSVRFFKQF 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F GIDNI+   + +   L+  R++     LEE+E++  DL  ME F  +G ++G V
Sbjct: 61  VIVKFKGIDNINDVEQYKGSSLFVSREN--AVSLEENEYYIADLIGMEVFTEEG-HFGIV 117

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
             V   GA  +  I + +    L+P  K  +  V+++  K+ I  +   +
Sbjct: 118 KDVMETGANEVYIIDSDVHGEVLVPAIKQCIENVDVENGKMQIRLLEGLI 167


>gi|91211942|ref|YP_541928.1| 16S rRNA-processing protein RimM [Escherichia coli UTI89]
 gi|237706804|ref|ZP_04537285.1| 16S rRNA-processing protein [Escherichia sp. 3_2_53FAA]
 gi|254037684|ref|ZP_04871742.1| ribosome maturation factor rimM [Escherichia sp. 1_1_43]
 gi|293411997|ref|ZP_06654720.1| 16S rRNA processing protein RimM [Escherichia coli B354]
 gi|293415879|ref|ZP_06658519.1| 16S rRNA processing protein RimM [Escherichia coli B185]
 gi|293448958|ref|ZP_06663379.1| 16S rRNA processing protein RimM [Escherichia coli B088]
 gi|331643324|ref|ZP_08344455.1| 16S rRNA processing protein RimM [Escherichia coli H736]
 gi|331648350|ref|ZP_08349438.1| 16S rRNA processing protein RimM [Escherichia coli M605]
 gi|331654065|ref|ZP_08355065.1| 16S rRNA processing protein RimM [Escherichia coli M718]
 gi|331674049|ref|ZP_08374811.1| 16S rRNA processing protein RimM [Escherichia coli TA280]
 gi|331678599|ref|ZP_08379273.1| 16S rRNA processing protein RimM [Escherichia coli H591]
 gi|332280697|ref|ZP_08393110.1| ribosome maturation factor rimM [Shigella sp. D9]
 gi|109893048|sp|Q31XD7|RIMM_SHIBS RecName: Full=Ribosome maturation factor rimM
 gi|109893049|sp|Q32CY0|RIMM_SHIDS RecName: Full=Ribosome maturation factor rimM
 gi|109893050|sp|Q3YYN0|RIMM_SHISS RecName: Full=Ribosome maturation factor rimM
 gi|25364897|pir||G91062 hypothetical protein ECs3471 [imported] - Escherichia coli  (strain
           O157:H7, substrain RIMD 0509952)
 gi|25364899|pir||C85907 hypothetical protein yfjA [imported] - Escherichia coli  (strain
           O157:H7, substrain EDL933)
 gi|12517030|gb|AAG57719.1|AE005490_14 orf, hypothetical protein [Escherichia coli O157:H7 str. EDL933]
 gi|26109377|gb|AAN81579.1|AE016764_261 16S rRNA processing protein rimM [Escherichia coli CFT073]
 gi|13362942|dbj|BAB36894.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai]
 gi|73856675|gb|AAZ89382.1| conserved hypothetical protein [Shigella sonnei Ss046]
 gi|81242115|gb|ABB62825.1| conserved hypothetical protein [Shigella dysenteriae Sd197]
 gi|81246563|gb|ABB67271.1| conserved hypothetical protein [Shigella boydii Sb227]
 gi|91073516|gb|ABE08397.1| 16S rRNA processing protein RimM [Escherichia coli UTI89]
 gi|209762548|gb|ACI79586.1| hypothetical protein ECs3471 [Escherichia coli]
 gi|209762550|gb|ACI79587.1| hypothetical protein ECs3471 [Escherichia coli]
 gi|209762552|gb|ACI79588.1| hypothetical protein ECs3471 [Escherichia coli]
 gi|209762554|gb|ACI79589.1| hypothetical protein ECs3471 [Escherichia coli]
 gi|209762556|gb|ACI79590.1| hypothetical protein ECs3471 [Escherichia coli]
 gi|226839308|gb|EEH71329.1| ribosome maturation factor rimM [Escherichia sp. 1_1_43]
 gi|226899844|gb|EEH86103.1| 16S rRNA-processing protein [Escherichia sp. 3_2_53FAA]
 gi|291322048|gb|EFE61477.1| 16S rRNA processing protein RimM [Escherichia coli B088]
 gi|291432068|gb|EFF05050.1| 16S rRNA processing protein RimM [Escherichia coli B185]
 gi|291468768|gb|EFF11259.1| 16S rRNA processing protein RimM [Escherichia coli B354]
 gi|323935678|gb|EGB31995.1| 16S rRNA processing protein RimM [Escherichia coli E1520]
 gi|323941374|gb|EGB37558.1| 16S rRNA processing protein RimM [Escherichia coli E482]
 gi|323946265|gb|EGB42298.1| 16S rRNA processing protein RimM [Escherichia coli H120]
 gi|323951193|gb|EGB47069.1| 16S rRNA processing protein RimM [Escherichia coli H252]
 gi|323957025|gb|EGB52751.1| 16S rRNA processing protein RimM [Escherichia coli H263]
 gi|323960534|gb|EGB56163.1| 16S rRNA processing protein RimM [Escherichia coli H489]
 gi|323963917|gb|EGB59410.1| 16S rRNA processing protein RimM [Escherichia coli M863]
 gi|323971449|gb|EGB66685.1| 16S rRNA processing protein RimM [Escherichia coli TA007]
 gi|323978483|gb|EGB73566.1| 16S rRNA processing protein RimM [Escherichia coli TW10509]
 gi|324111244|gb|EGC05226.1| 16S rRNA processing protein RimM [Escherichia fergusonii B253]
 gi|324120065|gb|EGC13941.1| 16S rRNA processing protein RimM [Escherichia coli E1167]
 gi|331036795|gb|EGI09019.1| 16S rRNA processing protein RimM [Escherichia coli H736]
 gi|331042097|gb|EGI14239.1| 16S rRNA processing protein RimM [Escherichia coli M605]
 gi|331047447|gb|EGI19524.1| 16S rRNA processing protein RimM [Escherichia coli M718]
 gi|331068788|gb|EGI40181.1| 16S rRNA processing protein RimM [Escherichia coli TA280]
 gi|331073429|gb|EGI44750.1| 16S rRNA processing protein RimM [Escherichia coli H591]
 gi|332103049|gb|EGJ06395.1| ribosome maturation factor rimM [Shigella sp. D9]
          Length = 185

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 31/172 (18%), Positives = 74/172 (43%), Gaps = 12/172 (6%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRFI 61
             +++  +G+++G+ G + + S   +   +  Y  +        +++++      N+  I
Sbjct: 15  DPIVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQQVQLESWKHHNQDMI 74

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               G+D+  +A+ L + ++          +LEE +++  DL   +    +G   G+V  
Sbjct: 75  IKLKGVDDRDAANLLTNCEIVVDSSQLP--QLEEGDYYWKDLMGCQVVTTEGYDLGKVVD 132

Query: 122 VYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILIDPIAA 167
           +   G+  +L IK  ++     K  L+PF     + +V+L    I +D    
Sbjct: 133 MMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLTTRSIEVDWDPG 184


>gi|218528699|ref|YP_002419515.1| 16S rRNA-processing protein RimM [Methylobacterium chloromethanicum
           CM4]
 gi|254797755|sp|B7KZ57|RIMM_METC4 RecName: Full=Ribosome maturation factor rimM
 gi|218521002|gb|ACK81587.1| 16S rRNA processing protein RimM [Methylobacterium chloromethanicum
           CM4]
          Length = 223

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 58/187 (31%), Positives = 86/187 (45%), Gaps = 13/187 (6%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYR----KNKRFI 61
           LVL+   G  HGL+GEV + S+ + P+ +  Y  L+++D R L +  +           I
Sbjct: 44  LVLLGEFGRPHGLHGEVRLKSHTSEPLAIAGYGPLHASDGRTLELANVRPAAGSSPDLLI 103

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               G+D+   A  L  + L   R+   + E +EDEFF TDL  +   D  G   G +  
Sbjct: 104 VRVKGVDDRTGAEALNRVTLAIARERLGEVE-DEDEFFLTDLIGLTVEDGAGTVIGTIVA 162

Query: 122 VYNFGAGSILEIKN-TMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQYD 180
           V NFG G +LEI+      T L+PFTK  V  +++   K++ DP            P   
Sbjct: 163 VPNFGGGDLLEIRPAAGGPTALLPFTKAFVPSLDIAGGKVVADPPDDLF------APPGP 216

Query: 181 CPLDSAG 187
            P D  G
Sbjct: 217 KPADDPG 223


>gi|86606190|ref|YP_474953.1| 16S rRNA-processing protein RimM [Synechococcus sp. JA-3-3Ab]
 gi|109893059|sp|Q2JUD0|RIMM_SYNJA RecName: Full=Ribosome maturation factor rimM
 gi|86554732|gb|ABC99690.1| 16S rRNA processing protein RimM [Synechococcus sp. JA-3-3Ab]
          Length = 186

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 35/172 (20%), Positives = 72/172 (41%), Gaps = 12/172 (6%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLN----RYVLYSNDNRELRIL----KMYRKNK 58
            +L+  +   HGL G + +  +++ P  L     R++   +D   L       + +    
Sbjct: 9   WLLVGQVVAAHGLRGWLRVKCWSDFPERLTEPGPRWLQRDSDPEPLLHPLIEGQFFPAKG 68

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
            ++    GI +  +A      K+           LE +E+  +DL  +  + + G+  G 
Sbjct: 69  LYLVRLEGIPDRTAAEAWVGAKVLVPASQ--RLPLEPEEYHYSDLIGLAVYHQ-GRLLGH 125

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           V  ++  G   +LEI    ++  LIPF K  V  V+L++ ++ + P    + 
Sbjct: 126 VSAIWAAG-QDVLEIATPDKRQVLIPFVKALVPVVDLEKGELQVQPPPGLVE 176


>gi|254559240|ref|YP_003066335.1| 16S rRNA processing protein [Methylobacterium extorquens DM4]
 gi|254266518|emb|CAX22282.1| putative 16S rRNA processing protein [Methylobacterium extorquens
           DM4]
          Length = 223

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 58/187 (31%), Positives = 85/187 (45%), Gaps = 13/187 (6%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYR----KNKRFI 61
           LVL+   G  HGL+GEV + S+ + P+ +  Y  L+++D R L +  +           I
Sbjct: 44  LVLLGEFGRPHGLHGEVRLKSHTSEPLAIAGYGPLHASDGRTLELANVRPAAGSSPDLLI 103

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               G+D+   A  L  + L   R+   + E +EDEFF TDL  +   D  G   G +  
Sbjct: 104 VRVKGVDDRTGAEALNRVTLAIARERLGEVE-DEDEFFLTDLIGLTVEDGAGTVIGTIVA 162

Query: 122 VYNFGAGSILEIKN-TMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQYD 180
           V NFG G +LEI       T L+PFTK  V  +++   K++ DP            P   
Sbjct: 163 VPNFGGGDLLEICPAAGGPTALLPFTKAFVPSLDIAGGKVVADPPDDLF------APPGP 216

Query: 181 CPLDSAG 187
            P D  G
Sbjct: 217 KPADDPG 223


>gi|254292891|ref|YP_003058914.1| 16S rRNA processing protein RimM [Hirschia baltica ATCC 49814]
 gi|254041422|gb|ACT58217.1| 16S rRNA processing protein RimM [Hirschia baltica ATCC 49814]
          Length = 193

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 41/185 (22%), Positives = 76/185 (41%), Gaps = 8/185 (4%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRI--LKMYRKNKRFIAT 63
            LV++A IG  HG+ G V + S+     D   Y    ++N ++             F+  
Sbjct: 11  DLVVVAQIGGAHGVRGHVRVRSFTVVAEDCFAYGPLLDENGDVIFTAKSYQENKDGFVVW 70

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
                       ++ + L+  R    + E +E  F+  DL   +     G+  GQV  V+
Sbjct: 71  PVENRQREEWMAMKGVLLHVPRNALPEPEEDE--FYFEDLIGSKVVHEDGRELGQVLNVH 128

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN----TTMKNPQY 179
           NFGA  +LE+K+     +++PFT   + +V+++   +   P    L +        + + 
Sbjct: 129 NFGADDLLELKSPHGTDYMLPFTLEIIPKVDVKAQLLTAKPEEQYLPDALRIDEPDDDEA 188

Query: 180 DCPLD 184
           D   D
Sbjct: 189 DTSED 193


>gi|325496324|gb|EGC94183.1| 16S rRNA-processing protein RimM [Escherichia fergusonii ECD227]
          Length = 185

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 31/172 (18%), Positives = 74/172 (43%), Gaps = 12/172 (6%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRFI 61
             +++  +G+++G+ G + + S   +   +  Y  +        +++++      N+  I
Sbjct: 15  DPIVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQQVQLESWKHHNQDMI 74

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               G+D+  +A+ L + ++          +LEE +++  DL   +    +G   G+V  
Sbjct: 75  IKLKGVDDRDAANLLTNCEIVVDSSQLP--QLEEGDYYWKDLMGCQVVTTEGYDLGKVID 132

Query: 122 VYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILIDPIAA 167
           +   G+  +L IK  ++     K  L+PF     + +V+L    I +D    
Sbjct: 133 MMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLTTRSIEVDWDPG 184


>gi|300718046|ref|YP_003742849.1| 16S rRNA-processing protein [Erwinia billingiae Eb661]
 gi|299063882|emb|CAX61002.1| 16S rRNA-processing protein [Erwinia billingiae Eb661]
          Length = 185

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 32/186 (17%), Positives = 73/186 (39%), Gaps = 21/186 (11%)

Query: 1   MVKLD---------KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRE 47
           MV +            +++  +G+ +G+ G + + S   +   +  Y  +        + 
Sbjct: 1   MVNMSKQLAARSPANPLILGKMGSAYGIRGWLKVFSSTEDAESIFDYQPWFIQRAGQWQL 60

Query: 48  LRILKMYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEME 107
           + +    R N+  I    GID+  +A  L + ++    +   +  L+  +++  DL   +
Sbjct: 61  VELEGWKRHNQDMIIKVKGIDDRDTAGLLTNCEIVVDSEQLPE--LDGGDYYWKDLIGCQ 118

Query: 108 TFDRQGKYWGQVCGVYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKIL 161
               +G   G+V  +   G+  +L ++  ++     K  LIPF     +  V+L    I 
Sbjct: 119 VVTTEGYELGKVTELMETGSNDVLVVQANLKDAFGAKERLIPFLDGQVIKNVDLTTGTIE 178

Query: 162 IDPIAA 167
           +D    
Sbjct: 179 VDWDPG 184


>gi|315658472|ref|ZP_07911344.1| 16S rRNA processing protein RimM [Staphylococcus lugdunensis
           M23590]
 gi|315496801|gb|EFU85124.1| 16S rRNA processing protein RimM [Staphylococcus lugdunensis
           M23590]
          Length = 173

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 43/168 (25%), Positives = 77/168 (45%), Gaps = 9/168 (5%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYV-----LYSNDNRELRILKMYRKNKRFIA 62
           V +  I  THG+ GEV + S+++      +        ++NDN EL +          + 
Sbjct: 10  VEVGQIVNTHGIKGEVKVKSHSDFTDTRFQPGEVLTLKHNNDNVELTVTSYRIHKGFHML 69

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F G DNI+     +   LY +R   +  EL E EF+ +D+     F+      G+V  +
Sbjct: 70  KFEGFDNINDVESFKGDYLYQERDH-EGIELAEHEFYYSDIIGCTVFN-GEIPIGRVINI 127

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
              GA  +  +K   +K ++IP+    V +V+++   I+I P+   L+
Sbjct: 128 IETGANDVWVVK--GDKEYMIPYIADVVKDVDIENKMIMITPLEGLLD 173


>gi|312115619|ref|YP_004013215.1| 16S rRNA processing protein RimM [Rhodomicrobium vannielii ATCC
           17100]
 gi|311220748|gb|ADP72116.1| 16S rRNA processing protein RimM [Rhodomicrobium vannielii ATCC
           17100]
          Length = 193

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 52/191 (27%), Positives = 82/191 (42%), Gaps = 9/191 (4%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS--NDNRELRILKMY-RKN 57
           M   +  VL+  IG  HGL GEV I ++   P D+  Y   S  +  R   I  M     
Sbjct: 1   MT--EDKVLLGRIGGAHGLRGEVKIATFTAAPEDITAYGPLSSADGTRTFVITGMRAASP 58

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              IA   G+ +   A  L  ++LY  R      E +++ F+ +DL  +     +G   G
Sbjct: 59  GSVIARLKGVADRTQAEALNGIELYVPRDSLPPPEEDDE-FYYSDLIGLAAVSPEGAAVG 117

Query: 118 QVCGVYNFGAGSILEIKNTMEKT-FLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKN 176
           +V GV+NFGAG ++E++   E+   LIPF    V  V+L   ++ +   A          
Sbjct: 118 KVIGVHNFGAGDLIEVRFGDERQPVLIPFDNAHVPHVDLGAGRVTVIRPA--FEGADASE 175

Query: 177 PQYDCPLDSAG 187
                   ++G
Sbjct: 176 RGAKSADGASG 186


>gi|167032081|ref|YP_001667312.1| 16S rRNA-processing protein RimM [Pseudomonas putida GB-1]
 gi|189040848|sp|B0KRI2|RIMM_PSEPG RecName: Full=Ribosome maturation factor rimM
 gi|166858569|gb|ABY96976.1| 16S rRNA processing protein RimM [Pseudomonas putida GB-1]
          Length = 178

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 30/169 (17%), Positives = 76/169 (44%), Gaps = 10/169 (5%)

Query: 3   KLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNK 58
           K D L+++  I + HG+ GEV + S+ +   +L  Y  ++       +++ ++      K
Sbjct: 7   KADDLIVVGKIFSVHGVRGEVKVYSFTDPIENLLDYPRWTLRHEGKVKQVELVSGRGSQK 66

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
             +    G+++   A  L   ++   R    +   +E  ++   L  ++  ++    +G+
Sbjct: 67  GLVVKLKGLEDRDEARLLSGYEICIARSLLPNLAADE--YYWYQLVGLKVINQDEHLFGK 124

Query: 119 VCGVYNFGAGSILEIKNT----MEKTFLIPFTKFAVLEVNLQENKILID 163
           V  +   GA  ++ +K       ++  L+P+T   VL ++L+   + ++
Sbjct: 125 VDHLLETGANDVMVVKPCAGSLDDRERLLPYTAQCVLAIDLEAGVMRVE 173


>gi|268609627|ref|ZP_06143354.1| putative 16S rRNA processing protein [Ruminococcus flavefaciens
           FD-1]
          Length = 167

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 46/170 (27%), Positives = 75/170 (44%), Gaps = 7/170 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNR--ELRILKMYRKNKRFI 61
             + +    I TTHG+ GEV I  Y ++P  L  +          E+ I +        I
Sbjct: 2   KKEYLEAGKIVTTHGIRGEVKIMPYTDSPELLAEFDRLFIGKNRDEVIITRSRVFKNTVI 61

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFD-RQGKYWGQVC 120
           A   G+D   +A +LR+  LY  R D +   L++D +F  DL  +E  D    K +G++ 
Sbjct: 62  AKIEGVDTPEAAEKLRNKVLYMHRDDLE---LDDDTYFIQDLIGLEVRDADTDKVYGKIA 118

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
            V   GA  +  IK    + +LIP     V+  ++  N + I P+    +
Sbjct: 119 DVLETGANDVYVIKGED-REYLIPAIADVVVSTDIDNNLMTIRPLDGLFD 167


>gi|161579573|ref|NP_928569.2| 16S rRNA-processing protein [Photorhabdus luminescens subsp.
           laumondii TTO1]
          Length = 182

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 31/172 (18%), Positives = 72/172 (41%), Gaps = 12/172 (6%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRFI 61
             +++  +G+T+G+ G + + S   +  D+  Y  +        + + +      N+  I
Sbjct: 12  NPIVLGKLGSTYGIRGWLRVFSSTEHAEDIFAYQPWFIQRAGRWQHIELEAWKHHNQDMI 71

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               GID++ +A+ L + ++    +   +  L+  +++  DL   +     G   G V  
Sbjct: 72  IKIKGIDDLDAANSLTNCEIIVDSEQLPE--LDTGDYYWKDLIGCQVISTAGYNLGTVND 129

Query: 122 VYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILIDPIAA 167
           +   G+  ++ +K  ++     K  LIPF     + +V+L    I +D    
Sbjct: 130 MMETGSNDVMVVKANLKDAFGVKERLIPFLDGQVIKKVDLATKTIEVDWDPG 181


>gi|188585997|ref|YP_001917542.1| 16S rRNA processing protein RimM [Natranaerobius thermophilus
           JW/NM-WN-LF]
 gi|229564324|sp|B2A2N9|RIMM_NATTJ RecName: Full=Ribosome maturation factor rimM
 gi|179350684|gb|ACB84954.1| 16S rRNA processing protein RimM [Natranaerobius thermophilus
           JW/NM-WN-LF]
          Length = 179

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 39/176 (22%), Positives = 70/176 (39%), Gaps = 10/176 (5%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSN-------DNRELRILKMYRKNK 58
            LV +  I  THG+ GE+ + S  +     N              D     I   +    
Sbjct: 6   DLVYVGKIVGTHGVKGELKVISLTDIENRFNELDRVYLVNEQDHYDPIIAHIESSFTHKN 65

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
             I  FS  D+I+      D  +   R++    +LEEDE++   +  +     + ++ G 
Sbjct: 66  MEIVKFSEWDDINQVEGFHDWYIKIPREERP--QLEEDEYYFDQITGLSVVTVEDEFLGT 123

Query: 119 VCGVYNFGAGSILEI-KNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTT 173
           V  +Y  G+  + E+ K   +K  LIP     V +++L E  +++D     L+   
Sbjct: 124 VTNIYQTGSNDVYEVSKEQDDKPILIPALYEVVKKIDLDEQIMIVDLPEGLLDEEE 179


>gi|147678055|ref|YP_001212270.1| RimM protein, required for 16S rRNA processing [Pelotomaculum
           thermopropionicum SI]
 gi|189040846|sp|A5D1J5|RIMM_PELTS RecName: Full=Ribosome maturation factor rimM
 gi|146274152|dbj|BAF59901.1| RimM protein, required for 16S rRNA processing [Pelotomaculum
           thermopropionicum SI]
          Length = 170

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 40/168 (23%), Positives = 70/168 (41%), Gaps = 7/168 (4%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLN---RYVLYSNDNRELRIL-KMYRKNKRF 60
           +  + +  I  T G  G V +    + P       R  +     R    + ++Y      
Sbjct: 3   ESYIRIGKILKTQGNRGAVRVLPLTDYPERFKNMSRVQVSLKGFRTFFTVGEVYHHKNFI 62

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           I  F  I+++ +A +L+   L   R +     L ED F+  D+  ++ +D  G+  G+V 
Sbjct: 63  IIKFKEIESMAAAEKLKGAFLEVGRDEL--VPLPEDRFYIFDIIGLKVYDTGGRNLGRVT 120

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAG 168
            V   GA  +  + +T  K  LIP  K  V  VNL E K++++     
Sbjct: 121 DVLQTGANDVYVV-DTGGKPLLIPALKQVVKSVNLTEGKMVVELPEGL 167


>gi|48474795|sp|Q7N799|RIMM_PHOLL RecName: Full=Ribosome maturation factor rimM
 gi|36784652|emb|CAE13552.1| 16S rRNA processing protein [Photorhabdus luminescens subsp.
           laumondii TTO1]
          Length = 185

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 31/172 (18%), Positives = 72/172 (41%), Gaps = 12/172 (6%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRFI 61
             +++  +G+T+G+ G + + S   +  D+  Y  +        + + +      N+  I
Sbjct: 15  NPIVLGKLGSTYGIRGWLRVFSSTEHAEDIFAYQPWFIQRAGRWQHIELEAWKHHNQDMI 74

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               GID++ +A+ L + ++    +   +  L+  +++  DL   +     G   G V  
Sbjct: 75  IKIKGIDDLDAANSLTNCEIIVDSEQLPE--LDTGDYYWKDLIGCQVISTAGYNLGTVND 132

Query: 122 VYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILIDPIAA 167
           +   G+  ++ +K  ++     K  LIPF     + +V+L    I +D    
Sbjct: 133 MMETGSNDVMVVKANLKDAFGVKERLIPFLDGQVIKKVDLATKTIEVDWDPG 184


>gi|254821201|ref|ZP_05226202.1| 16S rRNA-processing protein RimM [Mycobacterium intracellulare ATCC
           13950]
          Length = 171

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 35/170 (20%), Positives = 65/170 (38%), Gaps = 9/170 (5%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNR-------YVLYSNDNRELRILKMYRKNKRF 60
           + +  +   HG+ GE+ ++   ++P                    R+  +        R 
Sbjct: 3   LTVGRVVKAHGIGGEIVVEIRTDDPDARFATGNALRGKASRGGGERDFVVESAREHGGRL 62

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +   +GI +  +A  LR         D    + E D +++ +LE +      G+  G V 
Sbjct: 63  LVRLAGISDRDAADALRGTLFVVDSDDLPPID-EADTYYDHELEGLHVRTITGRDVGVVA 121

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
            V +  AG +L ++       L+PF    V  V+L +  I IDP    L+
Sbjct: 122 EVLHTAAGELLAVRRESG-EALVPFVTAIVTSVSLDDGTIEIDPPEGLLD 170


>gi|108798935|ref|YP_639132.1| 16S rRNA-processing protein RimM [Mycobacterium sp. MCS]
 gi|119868050|ref|YP_938002.1| 16S rRNA-processing protein [Mycobacterium sp. KMS]
 gi|126434535|ref|YP_001070226.1| 16S rRNA-processing protein RimM [Mycobacterium sp. JLS]
 gi|123178993|sp|Q1BAK8|RIMM_MYCSS RecName: Full=Ribosome maturation factor rimM
 gi|166226454|sp|A3PXV8|RIMM_MYCSJ RecName: Full=Ribosome maturation factor rimM
 gi|166226455|sp|A1UEF4|RIMM_MYCSK RecName: Full=Ribosome maturation factor rimM
 gi|108769354|gb|ABG08076.1| 16S rRNA processing protein RimM [Mycobacterium sp. MCS]
 gi|119694139|gb|ABL91212.1| 16S rRNA processing protein RimM [Mycobacterium sp. KMS]
 gi|126234335|gb|ABN97735.1| 16S rRNA processing protein RimM [Mycobacterium sp. JLS]
          Length = 173

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 33/172 (19%), Positives = 63/172 (36%), Gaps = 8/172 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLN-------RYVLYSNDNRELRILKMYRKNKRF 60
           +++  +   HG+ GE+ ++   ++P                    R   +  +     R 
Sbjct: 3   LVIGRVAKAHGVTGELVVEVRTDDPDARFVPGARLRGRAPRGGAERAFVVESVRPHGGRL 62

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +    G+ +  +A  LR         D    E  ++ +++  LE +      G   G V 
Sbjct: 63  LLRLDGVADRTAADALRGTVFLVDSADLPPIEEPDE-YYDHQLEGLLVRTVDGVDVGTVA 121

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNT 172
            V +  AG +L +K       L+PF    V  V+L +  + IDP    L+  
Sbjct: 122 EVLHTAAGELLSVKTPEGAEILVPFVTAIVPRVSLADGLVEIDPPEGLLDLE 173


>gi|319899440|ref|YP_004159537.1| 16S rRNA-processing protein rimM [Bartonella clarridgeiae 73]
 gi|319403408|emb|CBI76976.1| putative 16S rRNA-processing protein rimM [Bartonella clarridgeiae
           73]
          Length = 171

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 56/172 (32%), Positives = 91/172 (52%), Gaps = 2/172 (1%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND-NRELRILKMYRKNKRFIA 62
           + K V +A I   HG+ G+V++ + +  P  L  Y +  ++  R   I+    +    I 
Sbjct: 1   MKKKVYLAIITAAHGIKGDVFVKTLSAEPQRLKSYSVLYDETGRAYEIVTFRVQKNNAIV 60

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F GI+    A  L+ +KLY +R    D+ L EDEF+  DL     +D   +  G+V G 
Sbjct: 61  HFKGIEERSVAESLKGIKLYVERSQLADD-LVEDEFYQIDLIGFCVYDCADQLLGKVSGF 119

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTM 174
           +NFGAG +LE++    K  LI F+K AV ++ +    +++DPIAAGL++   
Sbjct: 120 FNFGAGDLLEVRLASRKKVLISFSKAAVPKICVDSGFMIVDPIAAGLSHDQE 171


>gi|325681250|ref|ZP_08160780.1| 16S rRNA processing protein RimM [Ruminococcus albus 8]
 gi|324107172|gb|EGC01458.1| 16S rRNA processing protein RimM [Ruminococcus albus 8]
          Length = 172

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 43/173 (24%), Positives = 77/173 (44%), Gaps = 5/173 (2%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYV-LYSNDNRELRILKMYRKNKRFIA 62
           + KL+    I +  GL GEV + ++ + P  L  +  LY      + I +   +    + 
Sbjct: 1   MQKLLEAGKIVSVFGLKGEVKVQAWCDTPDFLCEFDTLYYKSGTPVEIERSRVQKNIVVM 60

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFD-RQGKYWGQVCG 121
              GID +  A ++R+  LY  R D    EL+E+ +F  DL  ++  D   G+ +G +  
Sbjct: 61  KIKGIDTVEEAQKIRNRVLYIDRDD---VELDENTYFVQDLVGLKVVDLDSGREYGTLTE 117

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTM 174
           V   GA  +  IK+   K + IP     V E +++   + I P+    ++   
Sbjct: 118 VSETGANDVYHIKSADGKMYYIPAIPSVVAETDIEGGVMKITPLEGLFDDAEE 170


>gi|296171461|ref|ZP_06852747.1| 16S rRNA processing protein RimM [Mycobacterium parascrofulaceum
           ATCC BAA-614]
 gi|295894147|gb|EFG73907.1| 16S rRNA processing protein RimM [Mycobacterium parascrofulaceum
           ATCC BAA-614]
          Length = 173

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 33/172 (19%), Positives = 62/172 (36%), Gaps = 8/172 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVL-------YSNDNRELRILKMYRKNKRF 60
           + +  +   HG+ GEV ++   ++P                    R+  +        R 
Sbjct: 3   LTVGRVAKAHGIGGEVVVEIRTDDPGARFAPGNTLRGRASRGGGERDFVVESAREHGGRL 62

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +   +G+ +  SA  LR         D    +  +  +++  LE +      G   G V 
Sbjct: 63  LLRLAGVTDRDSADALRGTVFVVDSDDLPPIDEPDT-YYDHQLEGLHVRTVAGHDVGVVA 121

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNT 172
            V +  AG +L ++       L+PF    V  V+L +  + IDP    L+  
Sbjct: 122 EVLHTAAGELLAVRRGDGGEALVPFVGAIVTSVSLDDRVVEIDPPEGLLDLA 173


>gi|326803874|ref|YP_004321692.1| 16S rRNA processing protein RimM [Aerococcus urinae
           ACS-120-V-Col10a]
 gi|326650986|gb|AEA01169.1| 16S rRNA processing protein RimM [Aerococcus urinae
           ACS-120-V-Col10a]
          Length = 179

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 35/175 (20%), Positives = 75/175 (42%), Gaps = 8/175 (4%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNR------YVLYSNDNRELRILKMYRKNKR 59
           +   +  I  T GL GEV + +  + P    +         + N    + ++   +    
Sbjct: 4   EFYRVGKIVNTQGLKGEVRVIATTDFPEKRFQPGSQLVIFDHKNIEAWVEVVSHRQHKNF 63

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I +F G+ +I+     + +++    ++   ++L E EFF   +  +  +D  GK  G+V
Sbjct: 64  HILSFKGMTSINDVEGFKGMEIMVAAKERHSDDLAEGEFFYDQIIGLVVYDLTGKELGKV 123

Query: 120 CGVYNFGAGSILEIKN--TMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNT 172
             +   G   +  I+     +K  LIP+    V  ++L + KI+ID +   +++ 
Sbjct: 124 KTITQLGPNDVWTIQRNQPGKKDVLIPYIDDVVKSIDLDDKKIVIDALEGLIDDE 178


>gi|109893051|sp|Q2NVK3|RIMM_SODGM RecName: Full=Ribosome maturation factor rimM
 gi|84779045|dbj|BAE73822.1| 16S rRNA processing protein RimM [Sodalis glossinidius str.
           'morsitans']
          Length = 185

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 34/186 (18%), Positives = 74/186 (39%), Gaps = 21/186 (11%)

Query: 1   MVKLD---------KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSN----DNRE 47
           MVK+          + V++  +G+ +G+ G + + S       +  Y  +      + + 
Sbjct: 1   MVKMSKQLRIAAPVEPVVVGKMGSAYGIRGWLRVFSSTEEAESIFDYQPWFIKRAREWQP 60

Query: 48  LRILKMYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEME 107
           + +    R N+  I     I++  +A+ L + ++        D  L+  E++  DL   +
Sbjct: 61  IGLESWKRHNQDLIIKVRDIEDREAATLLTNCEIVVDASQLPD--LDSGEYYWKDLLGCQ 118

Query: 108 TFDRQGKYWGQVCGVYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKIL 161
                G   G+V  +   G+  +L +K  ++     +  LIPF     +  V+L  + I 
Sbjct: 119 VVTVGGYQLGEVIDLMETGSNDVLVVKANLKDAFGIQERLIPFLDGKVIKNVDLAAHIIE 178

Query: 162 IDPIAA 167
           +D    
Sbjct: 179 VDWDPG 184


>gi|229829007|ref|ZP_04455076.1| hypothetical protein GCWU000342_01092 [Shuttleworthia satelles DSM
           14600]
 gi|229792170|gb|EEP28284.1| hypothetical protein GCWU000342_01092 [Shuttleworthia satelles DSM
           14600]
          Length = 172

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 41/173 (23%), Positives = 70/173 (40%), Gaps = 8/173 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR------YVLYSNDNRELRILKMYRKN 57
           +     +  I +THGL GEV +          +       Y        EL I+ +    
Sbjct: 1   MQDYFQVGVITSTHGLKGEVKVYPTTEESRRFDDLCGQKVYAGRDGSLEELTIVSVRYFK 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
           K+ I  F+  +NI   S LR  +L   R+      LEE E++  DL  ++     G+  G
Sbjct: 61  KQVILRFAEKNNIDEVSSLRQARLLISREQ--ALPLEEGEYYVADLLGLKVVADDGRELG 118

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
            +  V   GA  +  I    +   +IP  +  VL+ +L+  +IL+  +    +
Sbjct: 119 ILTDVLTTGANDVYVIGRQGQSDLMIPAIRQCVLKTDLEAGEILVHLLPGLED 171


>gi|163850096|ref|YP_001638139.1| 16S rRNA processing protein RimM [Methylobacterium extorquens PA1]
 gi|209573569|sp|A9W0G2|RIMM_METEP RecName: Full=Ribosome maturation factor rimM
 gi|163661701|gb|ABY29068.1| 16S rRNA processing protein RimM [Methylobacterium extorquens PA1]
          Length = 223

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 58/187 (31%), Positives = 85/187 (45%), Gaps = 13/187 (6%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYR----KNKRFI 61
           LVL+   G  HGL+GEV + S+ + P+ +  Y  L+++D R L +  +           I
Sbjct: 44  LVLLGEFGRPHGLHGEVRLKSHTSEPLAIAGYGPLHASDGRTLELANVRPAAGSSPDLLI 103

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               G+D+   A  L  + L   R+     E +EDEFF TDL  +   D  G   G +  
Sbjct: 104 VRVKGVDDRTGAEALNRVTLAIARERLGKVE-DEDEFFLTDLIGLTVEDGAGTVIGTIVA 162

Query: 122 VYNFGAGSILEIKN-TMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQYD 180
           V NFG G +LEI+      T L+PFTK  V  +++   K++ DP            P   
Sbjct: 163 VPNFGGGDLLEIRPAAGGPTALLPFTKAFVPSLDIAGGKVVADPPDDLF------APPGP 216

Query: 181 CPLDSAG 187
            P D  G
Sbjct: 217 KPADDPG 223


>gi|312194951|ref|YP_004015012.1| 16S rRNA processing protein RimM [Frankia sp. EuI1c]
 gi|311226287|gb|ADP79142.1| 16S rRNA processing protein RimM [Frankia sp. EuI1c]
          Length = 178

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 35/178 (19%), Positives = 69/178 (38%), Gaps = 9/178 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR---YVLYSNDNRELRILKMYRKNKRF 60
           + + +++  IG  HG+ G+V ++   + P         +  S    +L I      + R 
Sbjct: 1   MGEAIVVGRIGKPHGVRGDVTVEVRTDLPDRRFAPGSKLDRSGGGPDLVIEDSRWHSGRL 60

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQ------DFKDEELEEDEFFNTDLEEMETFDRQGK 114
           +  F G+ +   A  LR + L           D  + +   + +++ DL  +      G 
Sbjct: 61  LVRFEGVADRTGAESLRGVVLTIDADLAGDAVDPDEADEGGEFWWDRDLVGLRAVTPDGS 120

Query: 115 YWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNT 172
             G+V  V +  AG +L I        L+PF +  V  V+     +++D     L+  
Sbjct: 121 PLGEVTDVVHTAAGELLAIGTPTGGEHLVPFVREIVPTVDRAGGLLVVDAPPGLLDLD 178


>gi|260654908|ref|ZP_05860396.1| 16S rRNA processing protein RimM [Jonquetella anthropi E3_33 E1]
 gi|260630410|gb|EEX48604.1| 16S rRNA processing protein RimM [Jonquetella anthropi E3_33 E1]
          Length = 172

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 37/174 (21%), Positives = 69/174 (39%), Gaps = 9/174 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLN---RYVLYSNDNR----ELRILKMYRK 56
           ++  V++A +   HG+ G V +    + P       R   Y +        L+ +   R 
Sbjct: 1   MEDRVVIAKVVGPHGVKGAVRVAPLTDFPERFETMTRVRFYRDGEEVGQYPLKNVGELRS 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
             + I    G+ +   A  LR   +     +     L E +++  DL  ++  D  G+  
Sbjct: 61  KGQIILELGGLSDAAEAEALRGCFICVPPDEM--VPLPEGQYWIRDLVGLQAKDETGEVL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           G V  V   GA  I EI+    K  L+PF    + +V+L   +++I  +    +
Sbjct: 119 GVVRDVLTTGASDIFEIEGLDGKKHLVPFVDQFIRQVSLDRRELVISMMEGLWD 172


>gi|23098990|ref|NP_692456.1| 16S rRNA processing protein [Oceanobacillus iheyensis HTE831]
 gi|33301526|sp|Q8EQZ8|RIMM_OCEIH RecName: Full=Ribosome maturation factor rimM
 gi|22777218|dbj|BAC13491.1| 16S rRNA processing protein [Oceanobacillus iheyensis HTE831]
          Length = 170

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 33/165 (20%), Positives = 68/165 (41%), Gaps = 6/165 (3%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLNR----YVLYSNDNRELRILKMYRKNKRFIATFS 65
           +  I  THG+ GEV +    +     +     Y+  + + + L I          +  F 
Sbjct: 8   IGKIVNTHGIRGEVKVVRITDFEDRFDPGNTVYLQDNKEYKPLVIATHRVHKGFDLLQFK 67

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNF 125
           G  NI+     + L L          +LEED ++  ++   +    +G+  G+V  + + 
Sbjct: 68  GYGNINEVEAFKGLMLSIDEDQL--TDLEEDAYYYHEIVGCKVVTSEGEELGKVKEILSP 125

Query: 126 GAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           GA  +  ++    K  LIP+ +  V +V+++   I +  +   L+
Sbjct: 126 GANDVWVVQRMNAKDLLIPYIEQVVKQVDIENKIIKVQLMEGMLD 170


>gi|242277677|ref|YP_002989806.1| 16S rRNA processing protein RimM [Desulfovibrio salexigens DSM
           2638]
 gi|242120571|gb|ACS78267.1| 16S rRNA processing protein RimM [Desulfovibrio salexigens DSM
           2638]
          Length = 185

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 37/170 (21%), Positives = 71/170 (41%), Gaps = 7/170 (4%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS-----NDNRELRILKMYRKNKRF 60
           +++++A +   HGL GEV I+S+A++P   +              R   +    +   R 
Sbjct: 2   EMLVVAEVVKPHGLRGEVCIESHADSPFLFDEVPCLYLAKKGQKPRRFVVRSSRKHKGRV 61

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           + TF G+++   A  LR +++  +  D  +   +E   +  +LE M      G   G + 
Sbjct: 62  LLTFKGVEDRDQAENLRGMEILVREADLPESGDDE--VYMYELEGMSVELEDGTVVGTIS 119

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
                       I +   K  L P  +  VL V+L   K++++P    L+
Sbjct: 120 NFILAPGQETWVISSAEGKEILFPAVEEFVLSVDLDAEKVVVEPPEGLLD 169


>gi|241889523|ref|ZP_04776822.1| 16S rRNA processing protein RimM [Gemella haemolysans ATCC 10379]
 gi|241863830|gb|EER68213.1| 16S rRNA processing protein RimM [Gemella haemolysans ATCC 10379]
          Length = 169

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 39/169 (23%), Positives = 75/169 (44%), Gaps = 8/169 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYV---LYSNDN---RELRILKMYRKNKRFI 61
           + +  I  TH L GEV + S  +      +     L +  N   +E+ +          +
Sbjct: 3   LKVGKIVNTHSLKGEVKVISSTDFEEQRFKKGSELLITRGNQVVKEVVVESYRTHKNNLL 62

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
             F GID I  A + ++L++     +    ELEE+EF+  ++   + FD   K  G++  
Sbjct: 63  VKFVGIDTIEEAEKFKNLQIKIDSDNI--GELEENEFYFHEIIGCKVFDENNKILGEIAE 120

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           +   GA  +  IK    K  LIP+ +  V ++++   +I I+ +   ++
Sbjct: 121 ILTPGANDVWVIKAETGKEILIPYIEDVVKKIDVTNKRIDIEVMEGLID 169


>gi|330895931|gb|EGH28215.1| 16S rRNA-processing protein RimM [Pseudomonas syringae pv. japonica
           str. M301072PT]
 gi|330950743|gb|EGH51003.1| 16S rRNA-processing protein RimM [Pseudomonas syringae Cit 7]
 gi|330975466|gb|EGH75532.1| 16S rRNA-processing protein RimM [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 179

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 34/168 (20%), Positives = 84/168 (50%), Gaps = 11/168 (6%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND-----NRELRILKMYRKNKR 59
           D L+++  I + HG+ GEV + S+ +   +L  Y  ++       ++++ ++    ++K 
Sbjct: 9   DDLIVIGKIYSVHGVRGEVKVYSFTDPIGNLLDYKTWTLRREGSVDKQVELVSGRLQSKF 68

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +    G+D+   A  L   ++   R  F D  L++ E++   LE ++  D+ G+  G++
Sbjct: 69  LVTKLKGLDDREEARLLSGYEICVPRNLFPD--LDDGEYYWYQLEGLKVIDQLGQLLGKI 126

Query: 120 CGVYNFGAGSILEIKNT----MEKTFLIPFTKFAVLEVNLQENKILID 163
             +   G+  ++ +K       ++  L+P+T+  VL +++   ++ +D
Sbjct: 127 DHLLETGSNDVMVVKPCAGSLDDRERLLPYTEQCVLAIDMAAGEMKVD 174


>gi|322382563|ref|ZP_08056443.1| 16S rRNA processing-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
 gi|321153479|gb|EFX45884.1| 16S rRNA processing-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
          Length = 169

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 32/170 (18%), Positives = 64/170 (37%), Gaps = 8/170 (4%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRY------VLYSNDNRELRILKMYRKNKRF 60
           +  +  I  THGL GE+ I  + +   +          V        + I         F
Sbjct: 1   MYTVGAIANTHGLRGELKIIPHTDFAEERFAPGSKLMAVDLKGKEMPVEIASARLHKNAF 60

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           I  F    +I+    L+   L  + +    ++LEE E++  ++     F   G+  G + 
Sbjct: 61  IVKFKQFHHINEVEPLKGGLLKVEEKYL--QKLEEGEYYFHEILGCTAFTMDGEELGTIK 118

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
            +   GA  +  +     K  L+P+ +  V EV++    + +  +   L+
Sbjct: 119 DILTPGANHVWVVSGPKYKQILLPYIEDVVKEVDVDNKIVRVKLLEGLLD 168


>gi|218887969|ref|YP_002437290.1| 16S rRNA processing protein RimM [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218758923|gb|ACL09822.1| 16S rRNA processing protein RimM [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 210

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 38/193 (19%), Positives = 70/193 (36%), Gaps = 9/193 (4%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDL---NRYVLYSNDNRELRILKMYRKNK 58
           +  D  + +  +G  HGL GEV +D +A +P  L             R   +  + R   
Sbjct: 1   MSDDSFIEIGLVGRPHGLRGEVGVDFWAESPDLLRGTLWLRPGRGAPRPHTVAAVRRHQG 60

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETF-DRQGKYWG 117
           R +  F GI +  +A  LR + +   +    +   +E   +  +L  +       G   G
Sbjct: 61  RPLVLFEGIADRSAAETLRGMHVLVPKDRLPEPAEDE--VYLHELLGLRVLLHDTGAALG 118

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN---NTTM 174
            +  V   G   +  I+    K  L+P  +  V  ++L   ++ I P    +        
Sbjct: 119 TLDDVQMPGGQEVWSIRTADGKEVLLPAVEEFVASIDLDAREVRITPPPGLMELYLEAPE 178

Query: 175 KNPQYDCPLDSAG 187
           K+       D+ G
Sbjct: 179 KSAARKPDADATG 191


>gi|284032645|ref|YP_003382576.1| 16S rRNA processing protein RimM [Kribbella flavida DSM 17836]
 gi|283811938|gb|ADB33777.1| 16S rRNA processing protein RimM [Kribbella flavida DSM 17836]
          Length = 182

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 38/181 (20%), Positives = 76/181 (41%), Gaps = 5/181 (2%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNR----YVLYSNDNRELRILKMYRKNKRFIA 62
           LV +  IG  HG+ GEV +D   + P          V  +   R L +      + R + 
Sbjct: 2   LVTVGRIGRAHGIKGEVGLDVRTDEPDRRFADGATLVTDTKPPRTLTVESSRWHSGRLLV 61

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F    +  +A +LR+L L A+  +  +   + +E+++ +L  +      G+  G+V  V
Sbjct: 62  KFVESPDRTAAEQLRNLVLQAEIAED-ERPEDPEEYYDRELIGLSVRTTDGEQAGEVIDV 120

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQYDCP 182
            +  +  +LEI+       L+P  +  V +++L E  +L+      L+    +    +  
Sbjct: 121 VHLPSQDLLEIRRPAGNAVLVPLVEQLVPKIDLDEKYVLVADRPGLLDPEGAEVTPTEPG 180

Query: 183 L 183
            
Sbjct: 181 D 181


>gi|311739730|ref|ZP_07713565.1| 16S rRNA processing protein RimM [Corynebacterium pseudogenitalium
           ATCC 33035]
 gi|311305546|gb|EFQ81614.1| 16S rRNA processing protein RimM [Corynebacterium pseudogenitalium
           ATCC 33035]
          Length = 165

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 44/168 (26%), Positives = 73/168 (43%), Gaps = 11/168 (6%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNR-----YVLYSNDNRELRILKMYRKNKRFIA 62
           +++  +  +HG+ GEV +++  + P          +         L I  +     R + 
Sbjct: 3   LMIGRVIKSHGVKGEVVVEATTDEPEVRFAVGEVLHGTQGKKEHTLTIKAVRSHKGRLLV 62

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
           TF  I +   A  LR  K +A        + ++D F++ +LE +      G+  G+V  V
Sbjct: 63  TFEEIKDRTVADSLRGTKFFA-----APLDSDDDGFYDHELEGLRVLLE-GEEIGEVTSV 116

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
            + G+  +LEIK    K  LIPF    V EVNL+     IDP    L+
Sbjct: 117 IHGGSQDLLEIKLDNNKEALIPFVHAIVPEVNLEAGTCTIDPPEGLLD 164


>gi|183597520|ref|ZP_02959013.1| hypothetical protein PROSTU_00794 [Providencia stuartii ATCC 25827]
 gi|188023166|gb|EDU61206.1| hypothetical protein PROSTU_00794 [Providencia stuartii ATCC 25827]
          Length = 182

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 33/183 (18%), Positives = 73/183 (39%), Gaps = 18/183 (9%)

Query: 1   MVKLDKL------VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRI 50
           M K   L      +++  +G  +G+ G + + S   +   +  Y  +        + + +
Sbjct: 1   MSKQANLATPTNPIVLGKLGAAYGIRGWLKVFSSTEHAESIFDYQPWFIQRSGQWQHIEL 60

Query: 51  LKMYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFD 110
                 NK  I    G+D+  +A+ L + ++        +  L+ +E++  DL   +   
Sbjct: 61  EDWKHHNKDIILKLKGVDDRDAATLLTNFEIVVDSAQLPE--LDNNEYYWKDLMGCQVVT 118

Query: 111 RQGKYWGQVCGVYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILIDP 164
            QG   G +  +   G+  ++ IK  ++     K  L+PF     + +V+L+   I +D 
Sbjct: 119 LQGYNLGTITDMMETGSNDVIVIKANLKDAFGIKERLVPFLDGQVIKKVDLKSKLIEVDW 178

Query: 165 IAA 167
              
Sbjct: 179 DPG 181


>gi|116671027|ref|YP_831960.1| 16S rRNA-processing protein RimM [Arthrobacter sp. FB24]
 gi|171855198|sp|A0JXU0|RIMM_ARTS2 RecName: Full=Ribosome maturation factor rimM
 gi|116611136|gb|ABK03860.1| 16S rRNA processing protein RimM [Arthrobacter sp. FB24]
          Length = 197

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 42/187 (22%), Positives = 76/187 (40%), Gaps = 8/187 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLN----RYVLYSNDNRELRILKMYRKNKRFIAT 63
           + +A IG  HG+ GEV +    + P D      R+V+       L +          +  
Sbjct: 3   LQVARIGKPHGIRGEVTVQVLTDAPEDRFIPGTRFVVEPASAGPLTVDSARWNKDILLLG 62

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F GI+  + A  LR  KL+ + +  + EE +++ ++  +L  ++         G + G+ 
Sbjct: 63  FEGIETRNQAEALRGAKLFIETE--ELEEEDDEGWYEHELVGLDV-RVGDAVVGTISGLR 119

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN-NTTMKNPQYDCP 182
                 ++ +++   K  LIPF +  V EVN+ E  IL+ P       N        D  
Sbjct: 120 TLPVQDLIVVESPDGKEILIPFVEEIVPEVNVGEKYILVTPPPGLFEINVEDSGETSDAG 179

Query: 183 LDSAGKK 189
               G+ 
Sbjct: 180 ESGPGEA 186


>gi|330717907|ref|ZP_08312507.1| 16S rRNA-processing protein RimM [Leuconostoc fallax KCTC 3537]
          Length = 169

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 28/170 (16%), Positives = 67/170 (39%), Gaps = 7/170 (4%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-----YVLYSNDNRELRILKMYRKNKRF 60
           +   + TI  THG+ GEV + +  +      +     ++ ++++   + I         +
Sbjct: 2   EYYKVGTIVNTHGIRGEVKVAAITDFAEQRFQKGNTLFIQFNDEKIPVVIQSTRVHKGMY 61

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           + TF   +NI+   + +   L    +    + L E +++   +   +  +      G V 
Sbjct: 62  LLTFEAFNNINEVEKYKQSDLLVSAEQ--RDTLTEGQYYYDQIIGSQVINMAHDEIGTVK 119

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
            +   GA  +  +    +K  L+P     +  V+++   I ID +   L+
Sbjct: 120 EIMVTGANDVWVVARDNKKDALLPVIDDVIKAVDIENQIITIDEMEGLLD 169


>gi|157692281|ref|YP_001486743.1| 16S rRNA-processing protein RimM [Bacillus pumilus SAFR-032]
 gi|166985924|sp|A8FD66|RIMM_BACP2 RecName: Full=Ribosome maturation factor rimM
 gi|157681039|gb|ABV62183.1| 16S rRNA processing protein [Bacillus pumilus SAFR-032]
          Length = 174

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 32/173 (18%), Positives = 76/173 (43%), Gaps = 9/173 (5%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-------YVLYSNDNRELRILKMYRKNK 58
           + + +  I  THG+ GEV + S  + P +  +       +     +  ++ +    +  +
Sbjct: 4   EWLNVGKIVNTHGVRGEVRVVSKTDFPEERYKKGSVLYIFKQGQGEPLKVTVASHRQHKQ 63

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
             + TF  I +++ A  L++  L  +++      L+E EF+   +   E +D + +  GQ
Sbjct: 64  FDLLTFEEISSLNEAELLKESILKVEKEHL--GSLDEGEFYFHQIIGCEVYDEENQLVGQ 121

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN 171
           +  +   GA  +  +    +K  LIP+    V ++++    I I+ +   ++ 
Sbjct: 122 IKEILTPGANDVWVVGRKGKKDALIPYIPSVVKKIDISSKTIHIEVMEGLIDE 174


>gi|194014273|ref|ZP_03052890.1| 16S rRNA processing protein RimM [Bacillus pumilus ATCC 7061]
 gi|194013299|gb|EDW22864.1| 16S rRNA processing protein RimM [Bacillus pumilus ATCC 7061]
          Length = 174

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 32/173 (18%), Positives = 76/173 (43%), Gaps = 9/173 (5%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-------YVLYSNDNRELRILKMYRKNK 58
           + + +  I  THG+ GEV + S  + P +  +       +     +  ++ +    +  +
Sbjct: 4   EWLNVGKIVNTHGVRGEVRVVSKTDFPEERYKKGSVLYIFKQGQGEPLKVTVASHRQHKQ 63

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
             + TF  I +++ A  L++  L  +++      L+E EF+   +   E +D + +  GQ
Sbjct: 64  FDLLTFEEISSLNEAELLKESILKVEKEHL--GSLDEGEFYFHQIIGCEVYDEEDQLVGQ 121

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN 171
           +  +   GA  +  +    +K  LIP+    V ++++    I I+ +   ++ 
Sbjct: 122 IKEILTPGANDVWVVGRKGKKDALIPYIPSVVKKIDIASKTIHIEVMEGLIDE 174


>gi|152980656|ref|YP_001352282.1| 16S rRNA processing protein RimM [Janthinobacterium sp. Marseille]
 gi|209573563|sp|A6SVI5|RIMM_JANMA RecName: Full=Ribosome maturation factor rimM
 gi|151280733|gb|ABR89143.1| 16S rRNA processing protein RimM [Janthinobacterium sp. Marseille]
          Length = 179

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 47/176 (26%), Positives = 76/176 (43%), Gaps = 15/176 (8%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKM---YRKN 57
           M   + LVL+  I   +GLNG V +  Y+ +   L     +  D  E   ++M       
Sbjct: 1   MKVPEDLVLVGYISGAYGLNGWVRVRPYSADADALLTAKTWWLDKPEFHDVEMMQSKIHT 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              +A   G+    +A  L+   +   R  F    L ++EF+  DL  +E  + QG++ G
Sbjct: 61  GDVVAKLMGVAGRDAAEALKGATVQIPRSHFPA--LSDNEFYWVDLIGLEVENLQGEHLG 118

Query: 118 QVCGVYNFGAGSILEI------KNTMEK----TFLIPFTKFAVLEVNLQENKILID 163
           QV  + + GA  IL +      + T  K      LIPF +  V+ V+    KI +D
Sbjct: 119 QVSDMMDNGAHPILRVAVPQAAETTDPKAAPQELLIPFVEQFVITVDRTAKKITVD 174


>gi|49474760|ref|YP_032802.1| 16s rRNA processing protein rimM [Bartonella quintana str.
           Toulouse]
 gi|59798255|sp|Q6FYH3|RIMM_BARQU RecName: Full=Ribosome maturation factor rimM
 gi|49240264|emb|CAF26734.1| 16s rRNA processing protein rimM [Bartonella quintana str.
           Toulouse]
          Length = 197

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 63/192 (32%), Positives = 97/192 (50%), Gaps = 6/192 (3%)

Query: 3   KLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND-NRELRILKMYRKNKRFI 61
           KL   V +A I   HG+ G+V +  ++  P  L  Y +  +D  R   I+ +  +    I
Sbjct: 7   KLKNKVYLAIIDLPHGVKGDVLVKVWSAEPQRLKTYGILYDDTGRPYEIVVLRVQKNNAI 66

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
             F G+++  +A  L+ ++LY  R    D+ L EDEF+  DL  +   D  G+  G+V G
Sbjct: 67  VHFKGVEDRSAAEALKGIRLYVTRDQLVDD-LAEDEFYQVDLIGLRVQDCAGQSLGKVSG 125

Query: 122 VYNFGAGSILEIKNTMEK-TFLIPFTKFAVLEVNLQENKILIDPI-AAGLNNTTMK--NP 177
            +NFGAG +LEI+    K T LIPF+K AV E+ +    ++++P+ A  LNN        
Sbjct: 126 FFNFGAGDLLEIRLNTRKTTVLIPFSKAAVPEICVTSGFLVVEPVAAGLLNNKEKNKVEN 185

Query: 178 QYDCPLDSAGKK 189
             D   D   KK
Sbjct: 186 DLDSNEDERMKK 197


>gi|83644607|ref|YP_433042.1| 16S rRNA processing protein RimM [Hahella chejuensis KCTC 2396]
 gi|109893019|sp|Q2SL57|RIMM_HAHCH RecName: Full=Ribosome maturation factor rimM
 gi|83632650|gb|ABC28617.1| 16S rRNA processing protein RimM [Hahella chejuensis KCTC 2396]
          Length = 173

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 31/170 (18%), Positives = 76/170 (44%), Gaps = 12/170 (7%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY-----SNDNRELRILKMYRKNK 58
           + + V +  I   +G+ G + + S+ + P ++ RY  +       +    ++     + K
Sbjct: 1   MSEKVCIGKIVGVYGVKGWLKVRSFTSPPENMLRYANWELVREDGNRSSAKLRSGKPQGK 60

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
             +   +G+D+ + A      ++  +  +     LEE E++   LE +  F  +G   G+
Sbjct: 61  GIVIALAGVDDRNLAKSYVGCQIEIESSELPA--LEEGEYYWRQLEGLTVFTSEGVNIGR 118

Query: 119 VCGVYNFGAGSILEI----KNTMEKTFLIPFTK-FAVLEVNLQENKILID 163
           V  +   GA  +L +    ++  ++  LIP+     +  ++L +N +++D
Sbjct: 119 VSHLIETGANDVLVVIGSAESIDKRERLIPYLPGQFIENIDLDKNLMVVD 168


>gi|332799155|ref|YP_004460654.1| Ribosome maturation factor rimM [Tepidanaerobacter sp. Re1]
 gi|332696890|gb|AEE91347.1| Ribosome maturation factor rimM [Tepidanaerobacter sp. Re1]
          Length = 171

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 38/173 (21%), Positives = 73/173 (42%), Gaps = 7/173 (4%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRE----LRILKMYRKN 57
           +   + + +  I ++ G+ G+V ++   +NP           D +      ++  +    
Sbjct: 1   MNEKQYIAVGKILSSWGVKGQVKVEPLTDNPKRFKILNEVFIDFKSQAVSYKVESVMFLR 60

Query: 58  KRF-IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           + F +  F GI++   A  L+   +   R+D     L ED FF  D+  +  F+    Y 
Sbjct: 61  QYFPVLKFEGINSKEEADTLKGHYININRKD--AVTLSEDRFFICDIIGLHVFNEFETYI 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           G V  V   GA  +  ++   +   LIP  K  V +V+L+   ++I P+   L
Sbjct: 119 GTVIEVIQTGANDVYVVETKDKNEILIPAIKQVVKKVDLRNGIMIIRPLEGML 171


>gi|66044531|ref|YP_234372.1| 16S rRNA-processing protein RimM [Pseudomonas syringae pv. syringae
           B728a]
 gi|75503052|sp|Q4ZWY8|RIMM_PSEU2 RecName: Full=Ribosome maturation factor rimM
 gi|63255238|gb|AAY36334.1| RimM protein:PRC-barrel [Pseudomonas syringae pv. syringae B728a]
 gi|330969026|gb|EGH69092.1| 16S rRNA-processing protein RimM [Pseudomonas syringae pv. aceris
           str. M302273PT]
          Length = 179

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 34/168 (20%), Positives = 84/168 (50%), Gaps = 11/168 (6%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND-----NRELRILKMYRKNKR 59
           D L+++  I + HG+ GEV + S+ +   +L  Y  ++       ++++ ++    ++K 
Sbjct: 9   DDLIVIGKIYSVHGVRGEVKVYSFTDPIGNLLDYKTWTLRREGSVDKQVELVSGRLQSKF 68

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +    G+D+   A  L   ++   R  F D  L++ E++   LE ++  D+ G+  G++
Sbjct: 69  LVTKLKGLDDREEARLLSGYEICVPRNLFPD--LDDGEYYWYQLEGLKVIDQLGQLLGKI 126

Query: 120 CGVYNFGAGSILEIKNT----MEKTFLIPFTKFAVLEVNLQENKILID 163
             +   G+  ++ +K       ++  L+P+T+  VL +++   ++ +D
Sbjct: 127 DHLLETGSNDVMVVKPCAGSLDDRERLLPYTEQCVLAIDMAAGEMKVD 174


>gi|227824780|ref|ZP_03989612.1| 16S rRNA processing protein rimM [Acidaminococcus sp. D21]
 gi|226905279|gb|EEH91197.1| 16S rRNA processing protein rimM [Acidaminococcus sp. D21]
          Length = 167

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 31/167 (18%), Positives = 74/167 (44%), Gaps = 3/167 (1%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKR 59
           M+ +++ +++  I   HG+ GE  I    + P    +  +++ +D R+L ++ + +    
Sbjct: 1   MMTMEQQIVIGKIVAPHGVRGEFRIMPLTDQPQRYAKMKIVHLDDGRDLTVVSVRQHKNV 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
           ++     I N+  A  LR  +L    ++     L + +F+  D+         G+ +G V
Sbjct: 61  YLMMVKEITNMDEAEALRGRQLVISPKELPP--LPKGQFYVRDILGFAVESPDGEAFGTV 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIA 166
             V + G+  +  I +   +  L+   K  +L ++  E+K++     
Sbjct: 119 KDVISPGSTDVFVIASPTGEEILLAAIKENILTIDWAEHKVVAKLPE 165


>gi|311898560|dbj|BAJ30968.1| putative 16S rRNA-processing protein RimM [Kitasatospora setae
           KM-6054]
          Length = 210

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 32/171 (18%), Positives = 72/171 (42%), Gaps = 5/171 (2%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPI-DLNRYVLYSNDN---RELRILKMYRKNKRFIAT 63
           +++  IG  HG+ G+V ++   + P   L    +   D      L I      + R +  
Sbjct: 3   LVVGKIGRAHGIRGDVSVEVRTDEPELRLGPGAVLLTDPAAIGPLTIESGRVHSGRLLLR 62

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F+G+ +  +A  LR   +     D ++   + DE+++  L  ++     G   G++  V 
Sbjct: 63  FAGVKDRTAAEALRG-TMLIAEIDPEETPDDPDEYYDHQLIGLDVVLADGTPVGELTEVI 121

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTM 174
           +     +L ++       L+PF +  V  ++L E ++++ P    ++    
Sbjct: 122 HLPYQDLLTVQRPDGTEVLVPFVEQIVPVIDLDEQRVVLTPPPGLIDPVDA 172


>gi|311278434|ref|YP_003940665.1| 16S rRNA processing protein RimM [Enterobacter cloacae SCF1]
 gi|308747629|gb|ADO47381.1| 16S rRNA processing protein RimM [Enterobacter cloacae SCF1]
          Length = 182

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 34/183 (18%), Positives = 75/183 (40%), Gaps = 18/183 (9%)

Query: 1   MVKLD------KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRI 50
           M K D      + +++  +G+ +G+ G + + S   +   +  Y  +        + + +
Sbjct: 1   MSKQDAAKAPVEPIVLGKMGSCYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQAVEL 60

Query: 51  LKMYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFD 110
                 N+  I    G+D+  +A+ L + ++        +  LEE +++  DL   +   
Sbjct: 61  EGWRHHNQDIIIKLKGVDDRDAANLLTNCEIVVDSSQLPE--LEEGDYYWKDLMGCQVVT 118

Query: 111 RQGKYWGQVCGVYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILIDP 164
            +G   G+V  +   G+  +L IK  ++     K  L+PF     + +V+L    I +D 
Sbjct: 119 TEGYDLGKVIDMMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLTTRTIEVDW 178

Query: 165 IAA 167
              
Sbjct: 179 DPG 181


>gi|296139336|ref|YP_003646579.1| 16S rRNA processing protein RimM [Tsukamurella paurometabola DSM
           20162]
 gi|296027470|gb|ADG78240.1| 16S rRNA processing protein RimM [Tsukamurella paurometabola DSM
           20162]
          Length = 173

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 36/172 (20%), Positives = 67/172 (38%), Gaps = 8/172 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNR-------YVLYSNDNRELRILKMYRKNKRF 60
           +++  +  +HG+ GE+ +D   ++P                + D +   +      + R 
Sbjct: 3   LVVGRVAKSHGIRGEIVVDVRTDSPELRFADGAVLTGRRPRAKDTQTYTVAASREHSGRL 62

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +    G+ +  +A ELR         D      + DEF++ +LE +      G   G + 
Sbjct: 63  LVRLEGVTDRTAADELRGTLFVIDSADV-QPSDDPDEFYDHELEGLAVRTADGTEVGVIA 121

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNT 172
            V +   G +L +K    +  LIPF    V  V++    I IDP    L+  
Sbjct: 122 EVLHPPGGELLSVKAPDGREILIPFVTAIVPVVDVAGGFIEIDPPEGLLDPE 173


>gi|402166|emb|CAA52886.1| 21kD protein [Salmonella enterica subsp. enterica serovar
           Typhimurium]
          Length = 183

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 32/173 (18%), Positives = 75/173 (43%), Gaps = 13/173 (7%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRK-NKRF 60
           + V++  +G+++G+ G + + S   +   +  Y  +        +++++    +  N+  
Sbjct: 12  EPVVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQQVQLESWKKHHNQDL 71

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           I    G+D+  +A+ L + ++           LEE +++  DL   +    +G   G+V 
Sbjct: 72  IIKLKGVDDRDAANLLTNCEIVVDSSQLPA--LEEGDYYWKDLMGCQVVTAEGYDLGKVI 129

Query: 121 GVYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILIDPIAA 167
            +   G+  +L IK  ++     K  L+PF     + +V+L    I +D    
Sbjct: 130 DMMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLATRTIEVDWDPG 182


>gi|253689571|ref|YP_003018761.1| 16S rRNA processing protein RimM [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|259585648|sp|C6DCQ0|RIMM_PECCP RecName: Full=Ribosome maturation factor rimM
 gi|251756149|gb|ACT14225.1| 16S rRNA processing protein RimM [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 182

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 35/172 (20%), Positives = 70/172 (40%), Gaps = 12/172 (6%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRFI 61
             ++M  IG+ +G+ G + + S   +   +  Y  +     +  + + I      N+  I
Sbjct: 12  NPIVMGKIGSAYGIRGWLRVFSSTEDAESIFDYQPWFIQSKSGWQLVEIEGWKYHNQDLI 71

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               G D+  +A+ L + ++        D  L E +++  DL   +     G   G+V  
Sbjct: 72  IKVKGTDDRDAANLLTNCEIVVDSSQLPD--LGEGDYYWKDLMGCQVVTVAGYELGKVID 129

Query: 122 VYNFGAGSILEIKNTME-----KTFLIPF-TKFAVLEVNLQENKILIDPIAA 167
           +   G+  ++ IK  ++     K  L+PF T+  V  V+L    I +D    
Sbjct: 130 MMETGSNDVMVIKANLKDAFGVKERLVPFLTEQVVKRVDLSTQTIEVDWDPG 181


>gi|86607822|ref|YP_476584.1| 16S rRNA-processing protein RimM [Synechococcus sp.
           JA-2-3B'a(2-13)]
 gi|109893060|sp|Q2JPG6|RIMM_SYNJB RecName: Full=Ribosome maturation factor rimM
 gi|86556364|gb|ABD01321.1| 16S rRNA processing protein RimM [Synechococcus sp.
           JA-2-3B'a(2-13)]
          Length = 179

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 38/179 (21%), Positives = 71/179 (39%), Gaps = 13/179 (7%)

Query: 1   MVKLD-KLVLMATIGTTHGLNGEVYIDSYANNPIDLN----RYVLYSNDNRELRIL---- 51
           M+  D   +L+  +   HGL G + +  +++ P        R++    D   L       
Sbjct: 1   MMARDPDWLLVGQVVAAHGLRGWLRVRCWSDFPERFTEPGPRWLQRDTDPEPLLHPLIEG 60

Query: 52  KMYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDR 111
           + +     ++    GI N   A      +L           L+ +E+   DL  +  + +
Sbjct: 61  QFFPAKGLYLVRLEGIPNRTVAETWVGARLLVPASH--RLPLQPEEYHYRDLIGLAVYHQ 118

Query: 112 QGKYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
            G+  GQV G+   G   +LEI  +  +  LIPF K  V  V+L++  + + P    + 
Sbjct: 119 -GELLGQVSGILAAG-QDVLEITTSDHRQVLIPFVKALVPVVDLEKGALHVQPPPGLVE 175


>gi|238926146|ref|ZP_04657906.1| possible 16S rRNA processing protein [Selenomonas flueggei ATCC
           43531]
 gi|304437005|ref|ZP_07396968.1| 16S rRNA processing protein RimM [Selenomonas sp. oral taxon 149
           str. 67H29BP]
 gi|238886036|gb|EEQ49674.1| possible 16S rRNA processing protein [Selenomonas flueggei ATCC
           43531]
 gi|304369956|gb|EFM23618.1| 16S rRNA processing protein RimM [Selenomonas sp. oral taxon 149
           str. 67H29BP]
          Length = 169

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 29/162 (17%), Positives = 61/162 (37%), Gaps = 2/162 (1%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIATF 64
           D+ +++  IG  HG+ G++ I    + P    +       +  L I  +  + +  +  F
Sbjct: 10  DERIVIGRIGAPHGVRGDLRIIPLTDFPERFAQMREVMAGDELLHITAVKPQGRNILMHF 69

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
              D   +A  L    L   R +     L+E E++  D+  +   D  G   G V  V  
Sbjct: 70  REYDVRETAQRLTGRVLTVPRAE--AAPLDEGEYYVFDIVGLTVRDEDGNELGTVTDVLR 127

Query: 125 FGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIA 166
            G+  +  +++      L+P  +  V  ++     + +    
Sbjct: 128 TGSNDVYAVRDAEGHELLVPALRTVVQNIDTAGGCMTVRLPE 169


>gi|28868681|ref|NP_791300.1| 16S rRNA processing protein RimM [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|213969057|ref|ZP_03397196.1| 16S rRNA processing protein RimM [Pseudomonas syringae pv. tomato
           T1]
 gi|301384048|ref|ZP_07232466.1| 16S rRNA-processing protein RimM [Pseudomonas syringae pv. tomato
           Max13]
 gi|302058754|ref|ZP_07250295.1| 16S rRNA-processing protein RimM [Pseudomonas syringae pv. tomato
           K40]
 gi|302131715|ref|ZP_07257705.1| 16S rRNA-processing protein RimM [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|37999587|sp|Q886V1|RIMM_PSESM RecName: Full=Ribosome maturation factor rimM
 gi|28851920|gb|AAO54995.1| 16S rRNA processing protein RimM [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|213926055|gb|EEB59611.1| 16S rRNA processing protein RimM [Pseudomonas syringae pv. tomato
           T1]
 gi|331016303|gb|EGH96359.1| 16S rRNA-processing protein RimM [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 179

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 33/168 (19%), Positives = 83/168 (49%), Gaps = 11/168 (6%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND-----NRELRILKMYRKNKR 59
           D L+++  I + HG+ GEV + S+ +   +L  Y  ++        +++ ++    ++K 
Sbjct: 9   DDLIVIGKIYSVHGVRGEVKVYSFTDPIGNLLDYKTWTLRREGSVEKQVELVSGRLQSKF 68

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +    G+D+   A  L   ++   R  F D  L++ E++   LE ++  D+ G+  G++
Sbjct: 69  LVVKLKGLDDREEARLLSGYEICVPRNLFPD--LDDGEYYWYQLEGLKVIDQLGQLLGKI 126

Query: 120 CGVYNFGAGSILEIKNT----MEKTFLIPFTKFAVLEVNLQENKILID 163
             +   G+  ++ +K       ++  L+P+T+  VL +++   ++ ++
Sbjct: 127 DHLLETGSNDVMVVKPCAGSLDDRERLLPYTEQCVLAIDMAAGEMKVE 174


>gi|197119791|ref|YP_002140218.1| 16S rRNA processing protein RimM [Geobacter bemidjiensis Bem]
 gi|197089151|gb|ACH40422.1| 16S rRNA processing protein RimM [Geobacter bemidjiensis Bem]
          Length = 172

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 38/174 (21%), Positives = 75/174 (43%), Gaps = 8/174 (4%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDN-----RELRILKMYRK 56
           +   K +L+  I  THG+ G++ +  +A +   +++       +         ++     
Sbjct: 1   MSGSKKLLIGKIQGTHGIKGQLRVIPFAGDASSISQLNEVFVKSPTAALEPFAVVSAKAH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
            KR I T    DNI+    L   ++YA R    +  L +DEF+ +DL  ++     G+  
Sbjct: 61  GKRVILTLKPFDNINQVLHLVGREIYADRVSLPE--LPDDEFYWSDLLGLQVATSDGEEL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           G++  +   G+  +  +K       LIP  +  VL +NL E ++ +      L+
Sbjct: 119 GELVDIIETGSNDVYVVKKGA-LEVLIPALEDVVLSINLAEGRMTVSLPEGLLD 171


>gi|206577100|ref|YP_002237053.1| 16S rRNA processing protein RimM [Klebsiella pneumoniae 342]
 gi|288934016|ref|YP_003438075.1| 16S rRNA processing protein RimM [Klebsiella variicola At-22]
 gi|290510924|ref|ZP_06550293.1| 16S rRNA processing protein RimM [Klebsiella sp. 1_1_55]
 gi|238058952|sp|B5XVK4|RIMM_KLEP3 RecName: Full=Ribosome maturation factor rimM
 gi|206566158|gb|ACI07934.1| 16S rRNA processing protein RimM [Klebsiella pneumoniae 342]
 gi|288888745|gb|ADC57063.1| 16S rRNA processing protein RimM [Klebsiella variicola At-22]
 gi|289775917|gb|EFD83916.1| 16S rRNA processing protein RimM [Klebsiella sp. 1_1_55]
          Length = 182

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 31/172 (18%), Positives = 72/172 (41%), Gaps = 12/172 (6%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRFI 61
             +++  +G+++G+ G + + S   +   +  Y  +        + + +      N+  I
Sbjct: 12  DPIVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWLIQKAGQWQVVELEGWRHHNQDII 71

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               G+D+  +A+ L + ++        +  LEE +++  DL   +    +G   G+V  
Sbjct: 72  IKLKGVDDRDAANLLTNCEIIVDSSQLPE--LEEGDYYWKDLMGCQVVTTEGYSLGKVID 129

Query: 122 VYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILIDPIAA 167
           +   G+  +L IK  ++     K  L+PF     + +V+L    I +D    
Sbjct: 130 MMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLTTRTIEVDWDPG 181


>gi|148238537|ref|YP_001223924.1| 16S rRNA-processing protein [Synechococcus sp. WH 7803]
 gi|166226485|sp|A5GI62|RIMM_SYNPW RecName: Full=Ribosome maturation factor rimM
 gi|147847076|emb|CAK22627.1| RimM protein, required for 16S rRNA processing [Synechococcus sp.
           WH 7803]
          Length = 175

 Score =  131 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 36/177 (20%), Positives = 69/177 (38%), Gaps = 11/177 (6%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND-----NRELRILKMY-- 54
           +  D  + +  +    GL GE+ ++  ++ P                  RE+ +      
Sbjct: 1   MTADDWLPVGKVVAVQGLKGELRVNPASDFPERFTEPGSRWLKARGQAPREIELTSGRQL 60

Query: 55  RKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETF-DRQG 113
                F+  F+G+++  +A  L    L     D  +  L E EF   DL  +E      G
Sbjct: 61  PGKSVFVVRFAGVESRDAAEALVGQTLMVPADDRPE--LAEGEFHLLDLVGLEARLSADG 118

Query: 114 KYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
              G V  + + G   +L ++    +T +IPF +  V +V+L++  + + P    L 
Sbjct: 119 DAIGTVKDLIS-GGNDLLVLERPDGRTLMIPFVEAIVPDVHLEQGWLRLTPPPGLLE 174


>gi|53802419|ref|YP_112924.1| 16S rRNA processing protein RimM [Methylococcus capsulatus str.
           Bath]
 gi|59798629|sp|Q60BS2|RIMM_METCA RecName: Full=Ribosome maturation factor rimM
 gi|53756180|gb|AAU90471.1| 16S rRNA processing protein RimM [Methylococcus capsulatus str.
           Bath]
          Length = 172

 Score =  131 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 36/168 (21%), Positives = 73/168 (43%), Gaps = 9/168 (5%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRF 60
           D+ V++  +    G+ G V   S+ + P++L  Y  ++    +  R   +L+        
Sbjct: 8   DRSVVVGRVSGAFGVRGWVKAVSFTDPPVNLVGYRPWTLRRGDAERRADVLEGREHGNAV 67

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           I    G+D    A  L+  ++  +R         E  ++  DL  ++  +      G+V 
Sbjct: 68  IVRLQGVDTREQAEALKGFEVTVRRSQLPPPAPGE--YYRVDLVGLKVVNLGETVLGEVV 125

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTK-FAVLEVNLQENKILIDPIAA 167
            V   GA  +L ++   ++  L+PF +   V  VNL+E++I++D    
Sbjct: 126 DVMETGANDVLVVQ--GDRERLLPFVQGVFVKSVNLEESRIVVDWDPG 171


>gi|300024813|ref|YP_003757424.1| 16S rRNA processing protein RimM [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299526634|gb|ADJ25103.1| 16S rRNA processing protein RimM [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 185

 Score =  131 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 42/187 (22%), Positives = 80/187 (42%), Gaps = 6/187 (3%)

Query: 1   MVKLD--KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSN--DNRELRILKMYRK 56
           M K +  K +L+  I   HG+ G++ + +Y   P  +  Y   ++    +   +  +   
Sbjct: 1   MTKDEHSKRILLGEISGVHGIRGDILVRTYTATPDAIASYGPLTDATGTKTFSLKIVRVT 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           +K  +A  +GI +  +A  LR  KL+  R+   +    E  F+++DL  +          
Sbjct: 61  DKGVVARIAGISDRTTAEALRGTKLFIAREKLPETSASE--FYHSDLIGLNAVAEDNTPI 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKN 176
           G++  V NFGAG +LE++     +  IPF    V +V+L    ++I    +  + T    
Sbjct: 119 GKIVSVQNFGAGDLLELQPPEGASEFIPFEDQWVPKVDLSARTVVIRRPPSTGDETEDAE 178

Query: 177 PQYDCPL 183
                  
Sbjct: 179 TDEPEQT 185


>gi|148265781|ref|YP_001232487.1| 16S rRNA processing protein RimM [Geobacter uraniireducens Rf4]
 gi|209573558|sp|A5G7Z6|RIMM_GEOUR RecName: Full=Ribosome maturation factor rimM
 gi|146399281|gb|ABQ27914.1| 16S rRNA processing protein RimM [Geobacter uraniireducens Rf4]
          Length = 173

 Score =  131 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 36/175 (20%), Positives = 73/175 (41%), Gaps = 8/175 (4%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY-----SNDNRELRILKMYR 55
           M   ++ VL+  +  THG+ G++ I  ++ +   L             +     +     
Sbjct: 1   MSSGNETVLIGKVSATHGVRGQLRITPFSGDVDSLLTLRSIMVKKPGGEMEIFAVAASKA 60

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
             K+ I T    DNI+    L   +LYA R+   +  L EDE++  DL  ++    +G+ 
Sbjct: 61  HGKKVIITLKAFDNINQVLHLVGRELYALREQLPE--LPEDEYYWCDLLGLQVVTEEGES 118

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
            G++  +   G+  +  ++    +  LIP     VL+V+    ++ +      L+
Sbjct: 119 LGELVDIIVTGSNDVYVVQG-SGREILIPALADVVLDVDSDAKRMTVSLPEGLLD 172


>gi|327394955|dbj|BAK12377.1| 16S rRNA processing protein RimM [Pantoea ananatis AJ13355]
          Length = 182

 Score =  131 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 30/172 (17%), Positives = 71/172 (41%), Gaps = 12/172 (6%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRFI 61
             +++  +G  +G+ G + + S   +   +  Y  +        +++ +      N+  I
Sbjct: 12  NPIVLGKMGAAYGIRGWLKVFSSTEDAESIFDYQPWFIQRAGKWQQVELDGWKHHNQDLI 71

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               GID+  +A++L + ++           L+  E++  DL   +  + +G   G+V  
Sbjct: 72  IKVKGIDDRDAAAQLTNCEIQVDSTQLPA--LDNGEYYWKDLMGCKVVNVEGYELGKVVD 129

Query: 122 VYNFGAGSILEIKNTME-----KTFLIPFTKF-AVLEVNLQENKILIDPIAA 167
           +   G+  +L +K  ++     +  LIPF     + +V+L    I +D    
Sbjct: 130 MMETGSNDVLVVKANLKDAFGVQERLIPFLDEQVIKKVDLSTGLIEVDWDPG 181


>gi|302185526|ref|ZP_07262199.1| 16S rRNA-processing protein RimM [Pseudomonas syringae pv. syringae
           642]
          Length = 179

 Score =  131 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 34/168 (20%), Positives = 84/168 (50%), Gaps = 11/168 (6%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND-----NRELRILKMYRKNKR 59
           D L+++  I + HG+ GEV + S+ +   +L  Y  ++       ++++ ++    ++K 
Sbjct: 9   DDLIVIGKIYSVHGVRGEVKVFSFTDPIGNLLDYKTWTLRREGSVDKQVELVSGRLQSKF 68

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +    G+D+   A  L   ++   R  F D  L++ E++   LE ++  D+ G+  G++
Sbjct: 69  LVTKLKGLDDREEARLLSGYEICVPRNLFPD--LDDGEYYWYQLEGLKVIDQLGQLLGKI 126

Query: 120 CGVYNFGAGSILEIKNT----MEKTFLIPFTKFAVLEVNLQENKILID 163
             +   G+  ++ +K       ++  L+P+T+  VL +++   ++ +D
Sbjct: 127 DHLLETGSNDVMVVKPCAGSLDDRERLLPYTEQCVLAIDMAAGEMKVD 174


>gi|227329615|ref|ZP_03833639.1| 16S rRNA-processing protein [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
          Length = 182

 Score =  131 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 34/172 (19%), Positives = 70/172 (40%), Gaps = 12/172 (6%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRFI 61
             ++M  IG+ +G+ G + + S   +   +  Y  +     +  + + I      N+  I
Sbjct: 12  NPIVMGKIGSAYGIRGWLRVFSSTEDAESIFDYQPWFIQSKSGWQLVEIEGWKYHNQDLI 71

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               G D+  +A+ L + ++        D  L E +++  DL   +     G   G++  
Sbjct: 72  IKVKGADDRDAANLLTNCEIVVDSSQLPD--LGEGDYYWKDLIGCQVVTVTGYELGKIID 129

Query: 122 VYNFGAGSILEIKNTME-----KTFLIPF-TKFAVLEVNLQENKILIDPIAA 167
           +   G+  ++ IK  ++     K  L+PF T+  V  V+L    I +D    
Sbjct: 130 MMETGSNDVMVIKANLKDAFGVKERLVPFLTEQVVKRVDLSAQTIEVDWDPG 181


>gi|223042033|ref|ZP_03612214.1| 16S rRNA-processing protein rimM [Actinobacillus minor 202]
 gi|223017192|gb|EEF15623.1| 16S rRNA-processing protein rimM [Actinobacillus minor 202]
          Length = 175

 Score =  131 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 33/165 (20%), Positives = 66/165 (40%), Gaps = 12/165 (7%)

Query: 9   LMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRFIATF 64
           ++  +G+T+G+ G + + S       +  Y  +        + + +      +   I   
Sbjct: 8   VVGKLGSTYGIRGWLRLYSSTEEAESIFDYQPWFLKIKGQWQPVELENWRYHSNDLIVKL 67

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
            G ++  SA  L + ++      F    LEE +++  DL   +  + +G   G V  +  
Sbjct: 68  KGTEDRESAQLLTNAEIGVDLAVFPA--LEEGDYYWHDLIGCQVVNLEGYTMGTVTEMME 125

Query: 125 FGAGSILEIKNT-----MEKTFLIPFT-KFAVLEVNLQENKILID 163
            G+  +L IK        ++  LIPF  +  V  V+L    I +D
Sbjct: 126 TGSNDVLVIKANSKDAFGKQERLIPFLYEQVVKRVDLTTKTITVD 170


>gi|300905072|ref|ZP_07122881.1| 16S rRNA processing protein RimM [Escherichia coli MS 84-1]
 gi|301305747|ref|ZP_07211834.1| 16S rRNA processing protein RimM [Escherichia coli MS 124-1]
 gi|300403023|gb|EFJ86561.1| 16S rRNA processing protein RimM [Escherichia coli MS 84-1]
 gi|300839001|gb|EFK66761.1| 16S rRNA processing protein RimM [Escherichia coli MS 124-1]
 gi|315253135|gb|EFU33103.1| 16S rRNA processing protein RimM [Escherichia coli MS 85-1]
          Length = 183

 Score =  131 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 31/172 (18%), Positives = 74/172 (43%), Gaps = 12/172 (6%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRFI 61
             +++  +G+++G+ G + + S   +   +  Y  +        +++++      N+  I
Sbjct: 13  DPIVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQQVQLESWKHHNQDMI 72

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               G+D+  +A+ L + ++          +LEE +++  DL   +    +G   G+V  
Sbjct: 73  IKLKGVDDRDAANLLTNCEIVVDSSKLP--QLEEGDYYWKDLMGCQVVTTEGYDLGKVVD 130

Query: 122 VYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILIDPIAA 167
           +   G+  +L IK  ++     K  L+PF     + +V+L    I +D    
Sbjct: 131 MMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLTTRSIEVDWDPG 182


>gi|291618575|ref|YP_003521317.1| RimM [Pantoea ananatis LMG 20103]
 gi|291153605|gb|ADD78189.1| RimM [Pantoea ananatis LMG 20103]
          Length = 185

 Score =  131 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 32/186 (17%), Positives = 74/186 (39%), Gaps = 21/186 (11%)

Query: 1   MVKLD---------KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRE 47
           MV +            +++  +G  +G+ G + + S   +   +  Y  +        ++
Sbjct: 1   MVSMSRQLAAQAPVNPIVLGKMGAAYGIRGWLKVFSSTEDAESIFDYQPWFIQRAGKWQQ 60

Query: 48  LRILKMYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEME 107
           + +      N+  I    GID+  +A++L + ++           L+  E++  DL   +
Sbjct: 61  VELDGWKHHNQDLIIKVKGIDDRDAAAQLTNCEIQVDSTQLPA--LDNGEYYWKDLMGCK 118

Query: 108 TFDRQGKYWGQVCGVYNFGAGSILEIKNTME-----KTFLIPFTKF-AVLEVNLQENKIL 161
             + +G   G+V  +   G+  +L +K  ++     +  LIPF     + +V+L    I 
Sbjct: 119 VVNVEGYELGKVVDMMETGSNDVLVVKANLKDAFGVQERLIPFLDEQVIKKVDLSTGLIE 178

Query: 162 IDPIAA 167
           +D    
Sbjct: 179 VDWDPG 184


>gi|237800085|ref|ZP_04588546.1| 16S rRNA-processing protein RimM [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|331022940|gb|EGI02997.1| 16S rRNA-processing protein RimM [Pseudomonas syringae pv. oryzae
           str. 1_6]
          Length = 179

 Score =  131 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 33/168 (19%), Positives = 83/168 (49%), Gaps = 11/168 (6%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND-----NRELRILKMYRKNKR 59
           D L+++  I + HG+ GEV + S+ +   +L  Y  ++       ++++ ++    ++K 
Sbjct: 9   DDLIVIGKIYSVHGVRGEVKVYSFTDPIGNLLDYKTWTLRREGSVDKQVELVSGRLQSKF 68

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +    G+D+   A  L    +   R  F D  L++ E++   LE ++  D+ G+  G++
Sbjct: 69  LVVKLKGLDDREEARLLSGYDICVPRNLFPD--LDDGEYYWYQLEGLKVIDQLGQLLGKI 126

Query: 120 CGVYNFGAGSILEIKNT----MEKTFLIPFTKFAVLEVNLQENKILID 163
             +   G+  ++ +K       ++  L+P+T+  VL +++   ++ ++
Sbjct: 127 DHLLETGSNDVMVVKPCAGSLDDRERLLPYTEQCVLAIDMAAGEMKVE 174


>gi|310766682|gb|ADP11632.1| 16S rRNA processing protein [Erwinia sp. Ejp617]
          Length = 185

 Score =  131 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 32/186 (17%), Positives = 73/186 (39%), Gaps = 21/186 (11%)

Query: 1   MVKLD---------KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRE 47
           MV +            +++  +G+ +G+ G + + S   +   +  Y  +        + 
Sbjct: 1   MVNMSKQLTAQPPANPLILGKMGSAYGIRGWLKVFSSTEDAESIFDYQPWFIQRAGQWQL 60

Query: 48  LRILKMYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEME 107
           + +    R N+  I    GID+  +A  L + ++    +     +L+  +++  DL   +
Sbjct: 61  VELEGWKRHNQDMIIKVKGIDDRDAAGLLTNCEIVVDSEQLP--QLDNGDYYWKDLMGCQ 118

Query: 108 TFDRQGKYWGQVCGVYNFGAGSILEIKNTME-----KTFLIPFTKF-AVLEVNLQENKIL 161
               +G   G+V  +   G+  +L +K  ++     +  LIPF     +  V+L    I 
Sbjct: 119 VVTVEGYELGKVIDMMETGSNDVLVVKANLKDAFGAQERLIPFLDEQVIKNVDLTTRTIK 178

Query: 162 IDPIAA 167
           +D    
Sbjct: 179 VDWDPG 184


>gi|217964055|ref|YP_002349733.1| 16S rRNA processing protein RimM [Listeria monocytogenes HCC23]
 gi|254797753|sp|B8DDW0|RIMM_LISMH RecName: Full=Ribosome maturation factor rimM
 gi|217333325|gb|ACK39119.1| 16S rRNA processing protein RimM [Listeria monocytogenes HCC23]
          Length = 172

 Score =  131 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 39/174 (22%), Positives = 76/174 (43%), Gaps = 9/174 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-------YVLYSNDNRELRILKMYRK 56
           ++K+  +  I  THGL GE+ + +  + P +  +       +   S    +L I    + 
Sbjct: 1   MEKMYNVGKIVNTHGLIGEIRVIATTDFPEERFQVGNTVYLFEKNSKKPEKLIIRSHRKH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
               +  F G   IH    +++  L  K       +LEE+EF+  ++         G+  
Sbjct: 61  KNFDLLMFEGFTGIHQVERMKEGVLKIKEAQL--TDLEENEFYFHEIIGCTVVTTDGEEL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           G++  +   GA  +  +K + +K  LIP+    V E+N+ + KI I+ +   L+
Sbjct: 119 GEITEILTPGANDVWVVKGSDKKEKLIPYIADVVKEININDKKITIEVMEGLLD 172


>gi|39995751|ref|NP_951702.1| 16S rRNA processing protein RimM [Geobacter sulfurreducens PCA]
 gi|59798803|sp|Q74FG4|RIMM_GEOSL RecName: Full=Ribosome maturation factor rimM
 gi|39982515|gb|AAR33975.1| 16S rRNA processing protein RimM [Geobacter sulfurreducens PCA]
          Length = 172

 Score =  131 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 35/174 (20%), Positives = 75/174 (43%), Gaps = 8/174 (4%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRIL-----KMYRK 56
           ++ D L L+  I TTHG+ G++ + S++     +          ++ R+      +    
Sbjct: 1   MRQDDLKLLGKIVTTHGIRGQLKVASFSGEFDTILSLETVVLKGKDGRMETFPVARATVH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           + R + + +   NI+    L     YA R  F    LEE E++  DL  ++     G   
Sbjct: 61  HDRVLLSLTPFTNINEVLHLISAVSYAHRDQFPP--LEEGEYYWCDLIGLQVVTAAGTVI 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           G++  +    +  +  ++    + +LIP  +  V++V+L+   + + P    L+
Sbjct: 119 GRLDSILPTESHDVYVVRGAD-REYLIPAVEDVVVQVDLEAGTMTVSPPEGLLD 171


>gi|304399180|ref|ZP_07381047.1| 16S rRNA processing protein RimM [Pantoea sp. aB]
 gi|304353234|gb|EFM17614.1| 16S rRNA processing protein RimM [Pantoea sp. aB]
          Length = 182

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 30/172 (17%), Positives = 72/172 (41%), Gaps = 12/172 (6%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRFI 61
             +++  +G  +G+ G + + S   +   +  Y  +        +++ +      N+  I
Sbjct: 12  NPIVLGKMGAAYGIRGWLKVFSSTEDAESIFNYQPWFIQRAGKWQQVELEGWKHHNQDLI 71

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               GI++  +A++L + ++           LEE +++  DL   +  + +G   G+V  
Sbjct: 72  IKVKGIEDRDAAAQLTNCEIQVDSTQLPS--LEEGDYYWKDLMGCQVVNLEGYEMGKVID 129

Query: 122 VYNFGAGSILEIKNTME-----KTFLIPFTKF-AVLEVNLQENKILIDPIAA 167
           +   G+  +L +K  ++     +  LIPF     + +V+L    I +D    
Sbjct: 130 MMETGSNDVLVVKANLKDAFGAQERLIPFLDEQVIRKVDLSTGVIEVDWDPG 181


>gi|16803833|ref|NP_465318.1| 16S rRNA-processing protein RimM [Listeria monocytogenes EGD-e]
 gi|224500788|ref|ZP_03669137.1| 16S rRNA-processing protein [Listeria monocytogenes Finland 1988]
 gi|224503775|ref|ZP_03672082.1| 16S rRNA-processing protein [Listeria monocytogenes FSL R2-561]
 gi|254831606|ref|ZP_05236261.1| 16S rRNA-processing protein RimM [Listeria monocytogenes 10403S]
 gi|21362860|sp|Q8Y6A2|RIMM_LISMO RecName: Full=Ribosome maturation factor rimM
 gi|16411247|emb|CAC99871.1| lmo1793 [Listeria monocytogenes EGD-e]
          Length = 172

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 39/174 (22%), Positives = 74/174 (42%), Gaps = 9/174 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-------YVLYSNDNRELRILKMYRK 56
           ++K+  +  I  THGL GE+ + +  + P +  +       +   S    +L I    + 
Sbjct: 1   MEKMYNVGKIVNTHGLIGEIRVIATTDFPEERFQVGNTVYLFEKNSKKPEKLIIRSHRKH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
               +  F G   IH    +++  L  K        LEE+EF+  ++         G+  
Sbjct: 61  KNFDLLMFEGFTGIHQVERMKEGVLKIKETQL--TNLEENEFYFHEIIGCTVVTTDGEEL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           G++  +   GA  +  +K   +K  LIP+    V E+N+ + KI I+ +   L+
Sbjct: 119 GEITEILTPGANDVWVVKGADKKEKLIPYIADVVKEINIDDQKITIEVMEGLLD 172


>gi|317495378|ref|ZP_07953747.1| 16S rRNA processing protein RimM [Gemella moribillum M424]
 gi|316914437|gb|EFV35914.1| 16S rRNA processing protein RimM [Gemella moribillum M424]
          Length = 169

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 42/169 (24%), Positives = 77/169 (45%), Gaps = 8/169 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYV---LYSNDN---RELRILKMYRKNKRFI 61
           + +  I  TH L GEV + S  +   +  +     L +  N   RE+ +          +
Sbjct: 3   LKVGKIVNTHSLKGEVKVISSTDFEEERFKKGSKLLITRGNQLIREVVVQSYRNHKNFLL 62

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
             F GID++  A +L++L++       K  ELEE+EF+   +   E FD   K  G++  
Sbjct: 63  VKFEGIDSVEEAEKLKNLQIKI--DSDKVGELEENEFYFHQIIGCEVFDENDKNLGEIID 120

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           +   GA  +  IK    K  LIP+ +  V ++++   K+ I+ +   ++
Sbjct: 121 ILTPGANDVWVIKGENGKEILIPYIEDVVKKIDITNKKVNIEVMEGLID 169


>gi|254393818|ref|ZP_05008930.1| 16S rRNA processing protein [Streptomyces clavuligerus ATCC 27064]
 gi|326443724|ref|ZP_08218458.1| 16S rRNA-processing protein RimM [Streptomyces clavuligerus ATCC
           27064]
 gi|197707417|gb|EDY53229.1| 16S rRNA processing protein [Streptomyces clavuligerus ATCC 27064]
          Length = 219

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 35/168 (20%), Positives = 75/168 (44%), Gaps = 5/168 (2%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPI-DLNRYVLYSNDN---RELRILKMYRKNKRFIAT 63
           +++  IG  HG+ GEV ++   + P   L    +   D      L I      + R +  
Sbjct: 3   LVVGRIGRAHGVKGEVSVEVRTDEPELRLGPGAVLLTDPPARGPLTIETGRVHSGRLLLR 62

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F+G+ + + A  LR+  L A   D +     +DE+++  L +++     G   G++  + 
Sbjct: 63  FAGVRDRNGAEALRETLLIADV-DPEASPEGDDEYYDHQLIDLDVVTVDGTEVGRITEIS 121

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN 171
           +  +  +  ++       +IPF    V  ++L+E + +IDP    +++
Sbjct: 122 HLPSQDLFIVERPDGTEVMIPFVTEIVTSIDLEEQRAVIDPPPGLIDD 169


>gi|271501690|ref|YP_003334716.1| 16S rRNA processing protein RimM [Dickeya dadantii Ech586]
 gi|270345245|gb|ACZ78010.1| 16S rRNA processing protein RimM [Dickeya dadantii Ech586]
          Length = 182

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 32/172 (18%), Positives = 73/172 (42%), Gaps = 12/172 (6%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND----NRELRILKMYRKNKRFI 61
             V++  +G+T+G+ G + + S   +   +  Y  +        + + I      N+  +
Sbjct: 12  NPVVLGKLGSTYGIKGWLRVFSSTEDTESIFDYQPWFIRNKGLWQPIEIESWRHHNQDLV 71

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
                ID+  +A+ L + ++        +  L+E +++  DL   +     G   G+V  
Sbjct: 72  IKIKDIDDREAANLLTNCEIVVDSAQLPE--LDEGDYYWKDLIGCDVVTVGGYELGKVID 129

Query: 122 VYNFGAGSILEIKNTME-----KTFLIPF-TKFAVLEVNLQENKILIDPIAA 167
           +   G+  +L ++  ++     K  LIPF T+  +  V+L  ++I +D    
Sbjct: 130 MMETGSNDVLVVRANLKDAYGVKERLIPFLTEQVIKHVDLSTHRIEVDWDPG 181


>gi|296111838|ref|YP_003622220.1| 16S rRNA processing protein [Leuconostoc kimchii IMSNU 11154]
 gi|295833370|gb|ADG41251.1| 16S rRNA processing protein [Leuconostoc kimchii IMSNU 11154]
          Length = 173

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 36/175 (20%), Positives = 72/175 (41%), Gaps = 7/175 (4%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNP-IDLNRYVLYSNDNR----ELRILKMYR 55
           M   +    + TI  THG+ GEV I +  +       +      D +     +++     
Sbjct: 1   MTNTENYFKVGTIVNTHGIRGEVKIMAITDFAADRFKKGAELQIDTKQGFLPMKVQSSRL 60

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
               ++  F GI NI+   + +   +Y   +    +EL++DE++  ++ +    D  G  
Sbjct: 61  HKNMWLVLFEGITNINDIEKYKTHDIYVYGE--ARQELDDDEYYYDEIIDSRVVDLDGHE 118

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
            G V  +    A  +  +K   +   LIP     V  V+++++ I ID +   L+
Sbjct: 119 IGVVSDIMTTPANDVWTVKREGQPDALIPMIDDVVKNVDVEQHLITIDALEGLLD 173


>gi|295397869|ref|ZP_06807932.1| 16S rRNA processing protein RimM [Aerococcus viridans ATCC 11563]
 gi|294973914|gb|EFG49678.1| 16S rRNA processing protein RimM [Aerococcus viridans ATCC 11563]
          Length = 191

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 39/185 (21%), Positives = 85/185 (45%), Gaps = 7/185 (3%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVL---YSNDNRELRILKM---YR 55
           +  ++  L+  I  T  L GEV + +  + P +  R        N ++ +  +++     
Sbjct: 7   MAEEQYYLVGKIVNTQALRGEVRVMATTDFPEERFRIGATLAIFNGDKLVETVEVDGHRL 66

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
                +  F G DNI+   + +   L     + + +EL+E+EF+  D+  +E +     Y
Sbjct: 67  HKNFNLLHFKGKDNINDVEKFKGFDLKVAGTEREADELDENEFYYDDIIGLEVYTTDETY 126

Query: 116 WGQVCGVYNFGAGSILEI-KNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTM 174
            G+V  + +  +  +  I +    K  LIP+ +  VLE++L +N+++IDP+   +++   
Sbjct: 127 LGKVREITSLPSNDVWAIQRPNKGKDILIPYIEDIVLEIDLDDNRVVIDPMDGLIDDVDA 186

Query: 175 KNPQY 179
           +    
Sbjct: 187 EKGDA 191


>gi|46143634|ref|ZP_00134829.2| COG0806: RimM protein, required for 16S rRNA processing
           [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|126209251|ref|YP_001054476.1| 16S rRNA-processing protein RimM [Actinobacillus pleuropneumoniae
           L20]
 gi|165977224|ref|YP_001652817.1| 16S rRNA-processing protein RimM [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|190151142|ref|YP_001969667.1| 16S rRNA-processing protein rimM [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|303253214|ref|ZP_07339363.1| 16S rRNA-processing protein [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|307246717|ref|ZP_07528787.1| Ribosome maturation factor rimM [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|307248858|ref|ZP_07530871.1| Ribosome maturation factor rimM [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|307251086|ref|ZP_07533010.1| Ribosome maturation factor rimM [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|307255702|ref|ZP_07537506.1| Ribosome maturation factor rimM [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|307257886|ref|ZP_07539642.1| Ribosome maturation factor rimM [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|307260154|ref|ZP_07541864.1| Ribosome maturation factor rimM [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|307262282|ref|ZP_07543931.1| Ribosome maturation factor rimM [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
 gi|307264491|ref|ZP_07546076.1| Ribosome maturation factor rimM [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
 gi|166226421|sp|A3N385|RIMM_ACTP2 RecName: Full=Ribosome maturation factor rimM
 gi|238687520|sp|B0BSV9|RIMM_ACTPJ RecName: Full=Ribosome maturation factor rimM
 gi|238692359|sp|B3GZ39|RIMM_ACTP7 RecName: Full=Ribosome maturation factor rimM
 gi|126098043|gb|ABN74871.1| 16S rRNA-processing protein rimM [Actinobacillus pleuropneumoniae
           serovar 5b str. L20]
 gi|165877325|gb|ABY70373.1| 16S rRNA processing protein RimM [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|189916273|gb|ACE62525.1| 16S rRNA-processing protein rimM [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|302647896|gb|EFL78103.1| 16S rRNA-processing protein [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|306852417|gb|EFM84652.1| Ribosome maturation factor rimM [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|306854785|gb|EFM86975.1| Ribosome maturation factor rimM [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|306856916|gb|EFM89048.1| Ribosome maturation factor rimM [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|306861379|gb|EFM93369.1| Ribosome maturation factor rimM [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|306863616|gb|EFM95543.1| Ribosome maturation factor rimM [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|306865800|gb|EFM97678.1| Ribosome maturation factor rimM [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|306868045|gb|EFM99872.1| Ribosome maturation factor rimM [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
 gi|306870188|gb|EFN01947.1| Ribosome maturation factor rimM [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
          Length = 175

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 32/165 (19%), Positives = 66/165 (40%), Gaps = 12/165 (7%)

Query: 9   LMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRFIATF 64
           ++  +G+T+G+ G + + S       +  Y  +        + + +      N   I   
Sbjct: 8   VVGKLGSTYGIRGWLRLYSSTEETESIFDYQPWFLKIKGQWQPIELESWRYHNNDLIVKL 67

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
            G D+  SA  L + ++      F +  LEE +++  DL   +  + +    G V  +  
Sbjct: 68  KGSDDRESAQLLTNAEIGVDLSVFPE--LEEGDYYWHDLIGCQVINLEDYSMGVVTELME 125

Query: 125 FGAGSILEIKNT-----MEKTFLIPFT-KFAVLEVNLQENKILID 163
            G+  +L ++        ++  LIPF  +  V  V+L    I +D
Sbjct: 126 TGSNDVLVVRANSKDAFGKQERLIPFLYEQVVKRVDLATKTITVD 170


>gi|152965368|ref|YP_001361152.1| 16S rRNA processing protein RimM [Kineococcus radiotolerans
           SRS30216]
 gi|209573564|sp|A6W7U9|RIMM_KINRD RecName: Full=Ribosome maturation factor rimM
 gi|151359885|gb|ABS02888.1| 16S rRNA processing protein RimM [Kineococcus radiotolerans
           SRS30216]
          Length = 174

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 34/175 (19%), Positives = 71/175 (40%), Gaps = 6/175 (3%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNR---YVLYSNDNRELRILKMYRKNKRFIATF 64
            ++A +G  HG+ GEV ++   ++P         +    D   L +      N   + TF
Sbjct: 3   YVVARVGRPHGVRGEVTVEVRTDDPDTRFAPGAVLRTDPDRGPLTVATARWHNGTLLLTF 62

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
            G+++  +   LR+ +L        + + ++D ++   L+ +      G   G V  +  
Sbjct: 63  QGVEDRTAVEGLRNTRLVVDL--DDEADPDDDAWYPHQLQGLAAVTTTGTPLGTVKDLLT 120

Query: 125 FGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQY 179
            GA  +L +  T  +  L+PF    V  V+++  K+++ P            P+ 
Sbjct: 121 GGAQDVLVVTGTDGREVLVPFVTPLVPRVDVKRGKVVLSPPGGLFVE-LPGEPEE 174


>gi|322515607|ref|ZP_08068586.1| 16S rRNA processing protein RimM [Actinobacillus ureae ATCC 25976]
 gi|322118317|gb|EFX90592.1| 16S rRNA processing protein RimM [Actinobacillus ureae ATCC 25976]
          Length = 175

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 32/165 (19%), Positives = 67/165 (40%), Gaps = 12/165 (7%)

Query: 9   LMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRFIATF 64
           ++  +G+T+G+ G + + S       +  Y  +        + + +      +   I   
Sbjct: 8   VVGKLGSTYGIRGWLRLYSSTEETESIFDYQPWFLKIKGQWQPIELESWRYHSNDLIVKL 67

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
            G D+  SA  L + ++      F +  LEE +++  DL   +  + +G   G V  +  
Sbjct: 68  KGTDDRESAQLLTNAEIGVDLSVFPE--LEEGDYYWHDLIGCQAVNLEGYTMGVVTELME 125

Query: 125 FGAGSILEIKNT-----MEKTFLIPFT-KFAVLEVNLQENKILID 163
            G+  +L ++        ++  LIPF  +  V  V+L    I +D
Sbjct: 126 TGSNDVLVVRANSKDAFGKQERLIPFLYEQVVKRVDLATKTITVD 170


>gi|300722262|ref|YP_003711546.1| 16S rRNA processing protein [Xenorhabdus nematophila ATCC 19061]
 gi|297628763|emb|CBJ89341.1| 16S rRNA processing protein [Xenorhabdus nematophila ATCC 19061]
          Length = 182

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 29/183 (15%), Positives = 71/183 (38%), Gaps = 18/183 (9%)

Query: 1   MVKLD------KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRI 50
           M K        + +++  +G+ +G+ G + + S   +  D+  Y  +        + + +
Sbjct: 1   MSKQSGLKHPVEPIVLGKLGSAYGIRGWLRVFSSTEHTEDIFEYQPWFIQRSGQWQHIEL 60

Query: 51  LKMYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFD 110
                 N+  +     ID+  +A+   + ++        +  LE  +++  DL   +  +
Sbjct: 61  EAWKHHNQDIVVKIKDIDDRDAANLFTNCEVMVDSSQLPE--LEAGDYYWKDLIGCQVMN 118

Query: 111 RQGKYWGQVCGVYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILIDP 164
             G   G +  +   G+  ++ IK  ++     K  L+PF     + +V+L    I +D 
Sbjct: 119 TAGYNLGTIDDMMETGSNDVMVIKANLKDAFGVKERLVPFLDGQVIKKVDLATKTIEVDW 178

Query: 165 IAA 167
              
Sbjct: 179 DPG 181


>gi|225180941|ref|ZP_03734389.1| 16S rRNA processing protein RimM [Dethiobacter alkaliphilus AHT 1]
 gi|225168422|gb|EEG77225.1| 16S rRNA processing protein RimM [Dethiobacter alkaliphilus AHT 1]
          Length = 169

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 33/171 (19%), Positives = 74/171 (43%), Gaps = 7/171 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR----YVLYSNDNRELRILKMYRKNKR 59
           +++ V +  + TTHG+ G + +   ++NP  +      +V     +    +++ +   + 
Sbjct: 1   MEQSVAIGKVVTTHGVKGGMKVQPLSDNPERIKELIRVFVEKDGHSAARDVVEAFVHGRA 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
           ++    GID+  +A EL    L     +     L E+ ++   +  ++ +   G Y G +
Sbjct: 61  WVIRLEGIDSCDAARELVGAMLTIPISE--RLPLPENSYYLDQIIGLDVYTVDGTYLGSI 118

Query: 120 CGVYNFGAGSILEIKNT-MEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
             V   G+  +  ++N    +  LIP  K  V  ++L   ++ +DP    L
Sbjct: 119 INVLETGSNDVYVVENKADGRQVLIPALKAVVKSIDLDTGRMEVDPPEGLL 169


>gi|190573385|ref|YP_001971230.1| 16S rRNA-processing protein RimM [Stenotrophomonas maltophilia
           K279a]
 gi|229890156|sp|B2FUB4|RIMM_STRMK RecName: Full=Ribosome maturation factor rimM
 gi|190011307|emb|CAQ44920.1| putative 16S rRNA-processing protein RimM [Stenotrophomonas
           maltophilia K279a]
          Length = 170

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 33/169 (19%), Positives = 79/169 (46%), Gaps = 10/169 (5%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY-----SNDNRELRILKMYR 55
           M  +++ +L+  +    G+ GE+ ++S+      + RY  +     S     +  ++   
Sbjct: 1   MKDIERRILLGRVVGAFGVRGEIKLESWTEPRSAIFRYQPWIVRSPSGVETTIEGVRGRD 60

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
             K  +A F G+++  +   +R  ++Y  R      + +E  ++  DLE ++    +G  
Sbjct: 61  SGKHLVARFPGVEDRDTVEAMRGTEIYVARSALPPPKPDE--YYWVDLEGLDVKTTEGVA 118

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFT-KFAVLEVNLQENKILID 163
            GQV  +++ GA  ++ ++   ++  +IPF     V  V+ + N +++D
Sbjct: 119 LGQVSHLFSTGANDVVVVR--GDRERMIPFVQPDFVKSVDFEANLVVVD 165


>gi|167630253|ref|YP_001680752.1| 16S rRNA processing protein rimm [Heliobacterium modesticaldum
           Ice1]
 gi|209573559|sp|B0TH66|RIMM_HELMI RecName: Full=Ribosome maturation factor rimM
 gi|167592993|gb|ABZ84741.1| 16S rRNA processing protein rimm [Heliobacterium modesticaldum
           Ice1]
          Length = 171

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 34/172 (19%), Positives = 62/172 (36%), Gaps = 9/172 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS------NDNRELRILKMYRKN 57
           + K V +  I  T G+ G+V +      P   N                 L I   +   
Sbjct: 1   MAKRVRVGQIVNTQGVRGQVRLWPLTEKPSRFNEIKRVFVEAPPQGAPEVLTITSAHPLK 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
           K  I +F  I ++  A  L+   L    ++    E +   +++  LE +  F   G+  G
Sbjct: 61  KLVIVSFQEISDMTQAERLKGCYLTIPVEEVPAPEPDS--YYHFQLEGLSVFTEAGERLG 118

Query: 118 QVCGVYNFGAGSILEIKNTM-EKTFLIPFTKFAVLEVNLQENKILIDPIAAG 168
           Q+  +   G+  +  ++        LIP  K  VL+V+L    + +      
Sbjct: 119 QIEEILETGSNDVYVVRQASPPGEVLIPALKSVVLKVDLAAGTMTVRLPDGL 170


>gi|308187874|ref|YP_003932005.1| 16S rRNA-processing protein rimM [Pantoea vagans C9-1]
 gi|308058384|gb|ADO10556.1| 16S rRNA-processing protein rimM [Pantoea vagans C9-1]
          Length = 182

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 31/172 (18%), Positives = 72/172 (41%), Gaps = 12/172 (6%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRFI 61
             +++  +G  +G+ G + + S   +   +  Y  +        +++ +      N+  I
Sbjct: 12  NPIVLGKMGAAYGIRGWLKVFSSTEDAESIFNYQPWFIQRAGKWQQVELEGWKHHNQDLI 71

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               GID+  +A++L + ++           LEE +++  DL   +  + +G   G+V  
Sbjct: 72  IKVKGIDDRDAAAQLTNCEIQVDSTQLPS--LEEGDYYWKDLMGCQVVNLEGYEMGKVID 129

Query: 122 VYNFGAGSILEIKNTME-----KTFLIPFTKF-AVLEVNLQENKILIDPIAA 167
           +   G+  +L +K  ++     +  LIPF     + +V+L    I +D    
Sbjct: 130 MMETGSNDVLVVKANLKDAFGAQERLIPFLDEQVIRKVDLSTGVIEVDWDPG 181


>gi|227530563|ref|ZP_03960612.1| 16S rRNA processing protein RimM [Lactobacillus vaginalis ATCC
           49540]
 gi|227349521|gb|EEJ39812.1| 16S rRNA processing protein RimM [Lactobacillus vaginalis ATCC
           49540]
          Length = 169

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 31/169 (18%), Positives = 63/169 (37%), Gaps = 8/169 (4%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYV------LYSNDNRELRILKMYRKNKR 59
           K   +  I  THG+ GEV +    +   +               +  EL I         
Sbjct: 2   KFYNVGKIVNTHGIRGEVRVIPTTDFVDERFAKDAKLYLANQQGEPLELTIESSRPHKGS 61

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +  F G DNI+     R+ +L    +D   + LEE  ++   +  +      G+  G++
Sbjct: 62  ILVKFVGYDNINDVENFRNRELRVSEED--QQPLEEGSYYYHQIIGLTVKTIDGRELGKI 119

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAG 168
             + + GA  +  ++   +   L+P     V +V+L    + ++ +   
Sbjct: 120 KEILSPGANDVWVVQRPHQADLLLPKIDDVVKKVDLDNGVVEVELLEGL 168


>gi|221134434|ref|ZP_03560739.1| 16S rRNA processing protein RimM [Glaciecola sp. HTCC2999]
          Length = 173

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 37/170 (21%), Positives = 76/170 (44%), Gaps = 9/170 (5%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND-NRELRILKMYRKNKR 59
           M +  + V++  IG  +G+ G V I+SY +    +  YV +     +  ++ +    +  
Sbjct: 1   MSRASETVIIGKIGAPYGVKGWVKINSYTDEKAGIFDYVPWIIGAGQHFQVAQWRTHSNS 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +A   GID+  SA  +++L +  +     +  L +DEF+  DL  M+    +G   G +
Sbjct: 61  LVAKLEGIDDRDSAERIKNLDIAIESSQLPE--LSDDEFYWRDLMGMQVVTEKGYSLGTI 118

Query: 120 CGVYNFGAGSILEIKNT-----MEKTFLIPFT-KFAVLEVNLQENKILID 163
             ++  GA  ++ IK        +K  ++P      V +++     I +D
Sbjct: 119 KEIFATGANDVMLIKANTNDAFGQKERMLPILFDQVVKQIDKPSATITVD 168


>gi|240948145|ref|ZP_04752548.1| 16S rRNA-processing protein [Actinobacillus minor NM305]
 gi|240297498|gb|EER48005.1| 16S rRNA-processing protein [Actinobacillus minor NM305]
          Length = 175

 Score =  131 bits (330), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 33/165 (20%), Positives = 67/165 (40%), Gaps = 12/165 (7%)

Query: 9   LMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRFIATF 64
           ++  +G+T+G+ G + + S       +  Y  +        + + +      +   I   
Sbjct: 8   VVGKLGSTYGIRGWLRLYSSTEEAESIFDYQPWFLKIKGQWQPVELENWRYHSNDLIVKL 67

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
            G ++  SA  L + ++      F +  LEE +++  DL   +  + +G   G V  +  
Sbjct: 68  KGTEDRESAQLLTNAEIGVDLAVFPE--LEEGDYYWHDLIGCQVVNLEGYTMGTVTEMME 125

Query: 125 FGAGSILEIKNT-----MEKTFLIPFT-KFAVLEVNLQENKILID 163
            G+  +L IK        ++  LIPF  +  V  V+L    I +D
Sbjct: 126 TGSNDVLVIKANSKDAFGKQERLIPFLYEQVVKRVDLTTKTITVD 170


>gi|188534779|ref|YP_001908576.1| 16S rRNA-processing protein RimM [Erwinia tasmaniensis Et1/99]
 gi|188029821|emb|CAO97702.1| 16S rRNA-processing protein RimM [Erwinia tasmaniensis Et1/99]
          Length = 185

 Score =  131 bits (330), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 33/186 (17%), Positives = 74/186 (39%), Gaps = 21/186 (11%)

Query: 1   MVKLDK---------LVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRE 47
           MV + K          +++  +G+ +G+ G + + S   +   +  Y  +        + 
Sbjct: 1   MVNMSKQLTSQPPATPLILGKMGSAYGIRGWLKVFSSTEDAESIFDYQPWFIQRAGQWQL 60

Query: 48  LRILKMYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEME 107
           + +    R N+  I    GID+  +A  L + ++    +   +  L+  +++  DL   +
Sbjct: 61  VELEGWKRHNQDMIIKVKGIDDRDAAGLLTNCEIVVDSEQLPE--LDNGDYYWKDLMGCQ 118

Query: 108 TFDRQGKYWGQVCGVYNFGAGSILEIKNTME-----KTFLIPFTKF-AVLEVNLQENKIL 161
               +G   G+V  +   G+  +L +K  ++     +  LIPF     +  V+L    I 
Sbjct: 119 VVTVEGYELGKVIDMMETGSNDVLVVKANLKDAFGAQERLIPFLDEQVIKNVDLTTRTIK 178

Query: 162 IDPIAA 167
           +D    
Sbjct: 179 VDWDPG 184


>gi|159904270|ref|YP_001551614.1| 16S rRNA-processing protein RimM [Prochlorococcus marinus str. MIT
           9211]
 gi|238687125|sp|A9BD47|RIMM_PROM4 RecName: Full=Ribosome maturation factor rimM
 gi|159889446|gb|ABX09660.1| possible 16S rRNA processing protein RimM [Prochlorococcus marinus
           str. MIT 9211]
          Length = 176

 Score =  131 bits (330), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 47/178 (26%), Positives = 78/178 (43%), Gaps = 11/178 (6%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDL----NRYVLYSNDNRELRILKMYRK 56
           M + D  + +  +    GL GEV ++  ++ P        R++  + +      LK  R+
Sbjct: 1   MSRKDSWLTIGKLVGAQGLRGEVKVNPSSDFPERFINPGERWLQKNTEEPSRIELKSGRQ 60

Query: 57  ---NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMET-FDRQ 112
                 +I +F GI + + A  +   KL          +L+E EF   DL  ++  F + 
Sbjct: 61  LPGKSIYIVSFIGITDRNKAESIVGNKLLVPSDQKP--KLKEGEFHLVDLLGLKAKFTQD 118

Query: 113 GKYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           G   G+V  + + G   +L IK    KT LIPF K  V  +NL++  +LI P    L 
Sbjct: 119 GSDVGEVIDLTSAG-NDLLVIKLVEGKTVLIPFVKEIVPVINLKQGWLLIKPPPGLLE 175


>gi|283479486|emb|CAY75402.1| 16S rRNA-processing protein rimM [Erwinia pyrifoliae DSM 12163]
          Length = 185

 Score =  131 bits (330), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 33/186 (17%), Positives = 74/186 (39%), Gaps = 21/186 (11%)

Query: 1   MVKLDK---------LVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRE 47
           MV + K          +++  +G+ +G+ G + + S   +   +  Y  +        + 
Sbjct: 1   MVNMSKQLTAQPPATPLILGKMGSAYGIRGWLKVFSSTEDAESIFDYQPWFIQRAGQWQL 60

Query: 48  LRILKMYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEME 107
           + +    R N+  I    GID+  +A  L + ++    +   +  L+  +++  DL   +
Sbjct: 61  VELEGWKRHNQDMIIKVKGIDDRDAAGLLTNCEIVVDSEQLPE--LDNGDYYWKDLMGCQ 118

Query: 108 TFDRQGKYWGQVCGVYNFGAGSILEIKNTME-----KTFLIPFTKF-AVLEVNLQENKIL 161
               +G   G+V  +   G+  +L +K  ++     +  LIPF     +  V+L    I 
Sbjct: 119 VVTVEGYELGKVIDMMETGSNDVLVVKANLKDAFGAQERLIPFLDEQVIKNVDLTTRTIK 178

Query: 162 IDPIAA 167
           +D    
Sbjct: 179 VDWDPG 184


>gi|268593128|ref|ZP_06127349.1| 16S rRNA processing protein RimM [Providencia rettgeri DSM 1131]
 gi|291311400|gb|EFE51853.1| 16S rRNA processing protein RimM [Providencia rettgeri DSM 1131]
          Length = 181

 Score =  131 bits (330), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 32/173 (18%), Positives = 70/173 (40%), Gaps = 13/173 (7%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRF 60
           +  +++  +G  +G+ G + + S   +   +  Y  +        + + I      NK  
Sbjct: 11  ENPIVLGKLGAAYGIRGWLKVFSSTEHAESIFEYQPWFIQRSGQWQHIEIEDWKHHNKDI 70

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           I   +G+D+  +A+ L + ++        +    E+E++  DL   +    QG   G + 
Sbjct: 71  IVKLNGVDDRDAAALLTNFEIAVDSTQLPEL---ENEYYWKDLMGCQVVTLQGYDLGTIT 127

Query: 121 GVYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILIDPIAA 167
            +   G+  +L IK  ++     K  L+PF     + +V+L    I +D    
Sbjct: 128 DMMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLDAKLIEVDWDPG 180


>gi|162382795|ref|YP_454227.2| 16S rRNA-processing protein [Sodalis glossinidius str. 'morsitans']
          Length = 182

 Score =  131 bits (330), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 31/172 (18%), Positives = 70/172 (40%), Gaps = 12/172 (6%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSN----DNRELRILKMYRKNKRFI 61
           + V++  +G+ +G+ G + + S       +  Y  +      + + + +    R N+  I
Sbjct: 12  EPVVVGKMGSAYGIRGWLRVFSSTEEAESIFDYQPWFIKRAREWQPIGLESWKRHNQDLI 71

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
                I++  +A+ L + ++        D  L+  E++  DL   +     G   G+V  
Sbjct: 72  IKVRDIEDREAATLLTNCEIVVDASQLPD--LDSGEYYWKDLLGCQVVTVGGYQLGEVID 129

Query: 122 VYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILIDPIAA 167
           +   G+  +L +K  ++     +  LIPF     +  V+L  + I +D    
Sbjct: 130 LMETGSNDVLVVKANLKDAFGIQERLIPFLDGKVIKNVDLAAHIIEVDWDPG 181


>gi|331091005|ref|ZP_08339847.1| ribosome maturation factor rimM [Lachnospiraceae bacterium
           2_1_46FAA]
 gi|330405227|gb|EGG84763.1| ribosome maturation factor rimM [Lachnospiraceae bacterium
           2_1_46FAA]
          Length = 168

 Score =  131 bits (330), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 34/169 (20%), Positives = 80/169 (47%), Gaps = 6/169 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILK----MYRKNKR 59
           +++L+ +  I +THG+ GEV +    ++     +      D    +++     +    + 
Sbjct: 1   MEQLLQVGIISSTHGVRGEVKVFPTTDDINRFKKLKQVILDTGREKMVLEVQGVKFFKQF 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F GIDNI+   + +   L+  R+     +L+++E+F  D+  M  +  + +++G +
Sbjct: 61  AILKFKGIDNINDIEKYKGKSLFVDREH--AVKLKKNEYFIADMIGMNVYTEEDEFFGVL 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAG 168
             V   GA  +  I +      L+P  +  +L V+++++K++I  +   
Sbjct: 119 KDVIETGANDVYVISSEKHGEVLVPAIRQCILNVDIEKSKMVIHLLEGL 167


>gi|329770416|ref|ZP_08261798.1| 16S rRNA processing protein RimM [Gemella sanguinis M325]
 gi|328836539|gb|EGF86199.1| 16S rRNA processing protein RimM [Gemella sanguinis M325]
          Length = 169

 Score =  131 bits (330), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 43/169 (25%), Positives = 76/169 (44%), Gaps = 8/169 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYV---LYSNDNR---ELRILKMYRKNKRFI 61
           + +  I  TH L GEV + S  +   +  +     L +  N+   E+ +          +
Sbjct: 3   LKVGKIVNTHSLRGEVKVISSTDFEEERFKKGSKLLITRGNQVIEEVVVESYRSHKNSLL 62

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
             F GID+I+ A + ++L+L    ++    ELEE+EF+  ++     FD      G+V  
Sbjct: 63  VKFEGIDSINEAEKFKNLQLKVDSENI--SELEENEFYFHEIIGCRVFDENNMLLGEVVE 120

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           +   GA  +  IK    K  LIP+    V  V++Q  KI I+ +   ++
Sbjct: 121 ILTPGANDVWVIKGENGKEILIPYIVDVVKNVDVQNKKIDIEIMEGLID 169


>gi|258653300|ref|YP_003202456.1| 16S rRNA processing protein RimM [Nakamurella multipartita DSM
           44233]
 gi|258556525|gb|ACV79467.1| 16S rRNA processing protein RimM [Nakamurella multipartita DSM
           44233]
          Length = 167

 Score =  131 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 36/165 (21%), Positives = 71/165 (43%), Gaps = 4/165 (2%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNR---YVLYSNDNRELRILKMYRKNKRFIATF 64
           V++  IG  HGL G+V I    ++P         +    D   L ++   R     +  F
Sbjct: 3   VVVGRIGRPHGLRGDVTIAVNTDDPDARFAAGSVLGTDPDRGPLTVVTRRRSGGVLLLRF 62

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
            GI++  +A  LR   L    +   + +  ++ F++  L  +   D  G+  G+V  V++
Sbjct: 63  EGIEDRDAAEALRGTSLTVPAETLPESDDPDE-FYDHQLIGLAVRDPSGQDLGKVVEVWH 121

Query: 125 FGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
             A  +L ++        +PF +  V  V+L ++ +++DP     
Sbjct: 122 PPASPVLLVRRPDGSDEAVPFVRALVPTVDLAQSYLVVDPPEGMF 166


>gi|304311870|ref|YP_003811468.1| 16S rRNA processing protein [gamma proteobacterium HdN1]
 gi|301797603|emb|CBL45824.1| 16S rRNA processing protein [gamma proteobacterium HdN1]
          Length = 177

 Score =  131 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 31/167 (18%), Positives = 71/167 (42%), Gaps = 11/167 (6%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSN----DNRELRILKMYRKNKRFI 61
             V++    + +G+ G + + S+     ++  Y          ++ L + K+    K  +
Sbjct: 8   NWVVVGRFASPYGVKGWLKLYSHTEPMQNIGEYPELWELGVSGSKPLVLEKVQFHGKGLV 67

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
           A   G D+   A      +L   R       L E +++ + LE +  ++  G + G+V  
Sbjct: 68  AKIKGCDDRTMAESHVGCELAIPRGQLPA--LPEGDYYWSQLEGLSVYNESGCFLGKVDH 125

Query: 122 VYNFGAGSILEIKNT----MEKTFLIPFT-KFAVLEVNLQENKILID 163
           +   GA  ++ +K       ++   +P+     VL+V+L+  ++L+D
Sbjct: 126 LVETGANDVMVVKPAAGSVDDRERWLPYVLGHHVLQVDLENQRMLVD 172


>gi|184200710|ref|YP_001854917.1| putative 16S rRNA processing protein RimM [Kocuria rhizophila
           DC2201]
 gi|238689200|sp|B2GFY3|RIMM_KOCRD RecName: Full=Ribosome maturation factor rimM
 gi|183580940|dbj|BAG29411.1| putative 16S rRNA processing protein RimM [Kocuria rhizophila
           DC2201]
          Length = 191

 Score =  131 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 47/192 (24%), Positives = 76/192 (39%), Gaps = 27/192 (14%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLN---------------RYVLYSNDNRELRILK 52
           V +A IG  HG+ GEV ++ + ++P                   R    + D RE   ++
Sbjct: 3   VRVARIGKPHGVRGEVTVELFTDDPQARFAPGSVLSIQHARGGRRGQGSAADAREPLAVQ 62

Query: 53  M------YRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEM 106
                         +A F  I + ++A   R L+L+A+  D     LE+DE+   DL  +
Sbjct: 63  SLTVTGHRWNKDVLVARFEEISDRNAAEAARGLELFAEVADLP---LEDDEWHQDDLLGL 119

Query: 107 ETFDRQGKY--WGQVCGVYNFGAGSILEIKN-TMEKTFLIPFTKFAVLEVNLQENKILID 163
              D        G V  +    A  +LEI      +T L+PF +  V EV+L    +L+ 
Sbjct: 120 VAVDLTRGEARIGTVKALIQGSAQDLLEITPQGGGRTVLVPFVEEIVPEVDLDRGLVLVS 179

Query: 164 PIAAGLNNTTMK 175
           P    L     +
Sbjct: 180 PPPGLLELGEGE 191


>gi|70728477|ref|YP_258226.1| 16S rRNA-processing protein RimM [Pseudomonas fluorescens Pf-5]
 gi|109893033|sp|Q4KHQ7|RIMM_PSEF5 RecName: Full=Ribosome maturation factor rimM
 gi|68342776|gb|AAY90382.1| 16S rRNA processing protein RimM [Pseudomonas fluorescens Pf-5]
          Length = 178

 Score =  131 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 34/167 (20%), Positives = 81/167 (48%), Gaps = 10/167 (5%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDN----RELRILKMYRKNKRF 60
           D L+++  I + HG+ GEV + S+ +   +L  Y  ++       +++ ++     +K  
Sbjct: 9   DDLIVIGKIYSVHGVRGEVKVFSFTDPIKNLLDYKTWTLKREGSVKQVELVSGRGNDKFL 68

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +A   G+D+   A  L   ++   R  F +  L + E++   L+ ++  D  G+  G++ 
Sbjct: 69  VAKLKGLDDREEARLLAGYEICVPRSLFPE--LTDGEYYWYQLQGLKVIDGLGQLLGKID 126

Query: 121 GVYNFGAGSILEIKNT----MEKTFLIPFTKFAVLEVNLQENKILID 163
            +   G+  ++ +K       ++  L+P+T+  VL V+L   ++ ++
Sbjct: 127 HLLETGSNDVMVVKPCAGSLDDRERLLPYTEQCVLAVDLAAGEMKVE 173


>gi|170717929|ref|YP_001783519.1| 16S rRNA-processing protein RimM [Haemophilus somnus 2336]
 gi|189040843|sp|B0UVM7|RIMM_HAES2 RecName: Full=Ribosome maturation factor rimM
 gi|168826058|gb|ACA31429.1| 16S rRNA processing protein RimM [Haemophilus somnus 2336]
          Length = 175

 Score =  131 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 35/172 (20%), Positives = 71/172 (41%), Gaps = 12/172 (6%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKN 57
           ++  ++ ++  +G+T+G+ G + + S       +  Y  +        + + +      N
Sbjct: 1   MEQQRIEVVGKLGSTYGIRGWLRLYSSTEQAESIFDYQPWFLKIKGQWQPIELESWKFHN 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              I    GI+    A  L ++++      F    L+E +F+  DL   +  + QG   G
Sbjct: 61  HELIVKLKGINEREVAQTLANVEIGVNLSIFP--LLDEGDFYWHDLIGCQVVNLQGYAMG 118

Query: 118 QVCGVYNFGAGSILEIKNT-----MEKTFLIPFT-KFAVLEVNLQENKILID 163
            V  +   GA  +L ++ +      +K  LIPF  +  V  V+L    I +D
Sbjct: 119 VVSEMMETGANDVLVVRASTKDAFGKKERLIPFLYEQVVKRVDLSSKTIEVD 170


>gi|292491048|ref|YP_003526487.1| 16S rRNA processing protein RimM [Nitrosococcus halophilus Nc4]
 gi|291579643|gb|ADE14100.1| 16S rRNA processing protein RimM [Nitrosococcus halophilus Nc4]
          Length = 175

 Score =  131 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 40/164 (24%), Positives = 75/164 (45%), Gaps = 9/164 (5%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRKNKRF 60
           ++ VL+  I   +G+ G V + SY     ++ RY  +    +      R+L+   + K  
Sbjct: 11  NRYVLIGRISGVYGIQGWVRVYSYTEPRDNILRYEPWYLQQNGKWIARRLLEGRTQGKGI 70

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +    GID+   A++    ++   R+       EE E++  DL  +     QG   G+V 
Sbjct: 71  VVALDGIDDRDVATQWIGREIAVHREQLPPP--EEGEYYWADLIGLRVITVQGVELGRVE 128

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKF-AVLEVNLQENKILID 163
            +   GA  +L ++   E+  LIPF K   V +V+L++  + +D
Sbjct: 129 RLLETGANDVLVVQ--GERERLIPFRKDTIVKQVDLEQGLLRVD 170


>gi|209573745|sp|Q1GYT7|RIMM_METFK RecName: Full=Ribosome maturation factor rimM
          Length = 173

 Score =  131 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 40/172 (23%), Positives = 73/172 (42%), Gaps = 13/172 (7%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY---------SNDNRELRIL 51
           M  + +LV+M  I   +G+ G V +         L  Y  +             +   + 
Sbjct: 1   MQIVSELVIMGRIVAPYGVYGWVKVQPATEYVDSLFDYGRWMLGRGDPKQPEQWQSCEVE 60

Query: 52  KMYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDR 111
           K    N   +    GID+   A   + + +   R +  +   EE E++ +DL  ++  ++
Sbjct: 61  KAKVHNDLLLVKLQGIDDRDQAFSCKGMYVAVYRDELPEP--EEGEYYWSDLIGLQVRNQ 118

Query: 112 QGKYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
           Q   +GQV  V+  GA  +L +K   ++  L+PF    VLEV+     +L+D
Sbjct: 119 QEVDFGQVVDVFATGANDVLVVK--GDRERLVPFIGQVVLEVDTDGKTMLVD 168


>gi|118443705|ref|YP_878283.1| 16S rRNA-processing protein RimM [Clostridium novyi NT]
 gi|209573572|sp|A0Q0Y1|RIMM_CLONN RecName: Full=Ribosome maturation factor rimM
 gi|118134161|gb|ABK61205.1| 16S rRNA processing protein RimM [Clostridium novyi NT]
          Length = 162

 Score =  131 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 35/163 (21%), Positives = 71/163 (43%), Gaps = 4/163 (2%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIAT 63
           +++ + +  I  THG+ GE+ +    +N            D   + I     +  + I  
Sbjct: 1   MEQFLAVGKIINTHGIKGEIKVMPSTDNVERFKELNEAYIDGNIVEIEGCKFQPGKVILK 60

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
             GID+I  A  L++  +   R++     L+ED ++  D+     +D   K  G +  + 
Sbjct: 61  IKGIDSIEDAQRLKNKYIKVSREN--AATLDEDCYYEADIVGCTVYDENEKQLGNIDEII 118

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIA 166
           + G+  +  IK       LIP  K  ++++++   KI+I P+ 
Sbjct: 119 HTGSNDVYWIKGPN--ELLIPAIKSVIVDIDVNNKKIIIKPLE 159


>gi|317049259|ref|YP_004116907.1| 16S rRNA processing protein RimM [Pantoea sp. At-9b]
 gi|316950876|gb|ADU70351.1| 16S rRNA processing protein RimM [Pantoea sp. At-9b]
          Length = 182

 Score =  131 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 32/172 (18%), Positives = 71/172 (41%), Gaps = 12/172 (6%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRFI 61
             V++  +G  +G+ G + + S       +  Y  +        + + +      N+  I
Sbjct: 12  NPVVLGKMGAAYGIRGWLKVFSSTEEAESIFDYQPWFIQHAGQWQLVELEGWKHHNQDLI 71

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
              +GID+  +A++L + ++           LEE +++  DL   +  + +G   G+V  
Sbjct: 72  IKVNGIDDRDAAAQLTNCEITVDSAQLPA--LEEGDYYWKDLMGCKVVNLEGYEMGKVID 129

Query: 122 VYNFGAGSILEIKNTME-----KTFLIPFTKF-AVLEVNLQENKILIDPIAA 167
           +   G+  +L +K  ++     +  LIPF     + +V+L    I +D    
Sbjct: 130 LMETGSNDVLVVKANLKDAFGAQERLIPFLDEQVIKKVDLSTGTIEVDWDPG 181


>gi|255325256|ref|ZP_05366362.1| 16S rRNA processing protein RimM [Corynebacterium
           tuberculostearicum SK141]
 gi|255297821|gb|EET77132.1| 16S rRNA processing protein RimM [Corynebacterium
           tuberculostearicum SK141]
          Length = 165

 Score =  131 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 42/168 (25%), Positives = 73/168 (43%), Gaps = 11/168 (6%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNR-----YVLYSNDNRELRILKMYRKNKRFIA 62
           +++  +  +HG+ GEV +++  + P          +         L I  +     R + 
Sbjct: 3   LMIGRVIKSHGVKGEVVVEATTDEPEVRFAVGEVLHGTQGKKEHTLTIKAVRSHKGRLLV 62

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
           TF  I +   A  LR  K +A        + ++D F++ +LE +      G+  G+V  V
Sbjct: 63  TFEEIKDRTVADSLRGTKFFA-----APLDSDDDGFYDHELEGLRVLLE-GEEIGEVTSV 116

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
            + G+  +LE++    K  LIPF    V EVNL+     IDP    L+
Sbjct: 117 IHGGSQDLLEVELDNSKEALIPFVHAIVPEVNLEAGTCTIDPPEGLLD 164


>gi|300172997|ref|YP_003772163.1| 16S rRNA processing protein RimM [Leuconostoc gasicomitatum LMG
           18811]
 gi|299887376|emb|CBL91344.1| 16S rRNA processing protein RimM [Leuconostoc gasicomitatum LMG
           18811]
          Length = 173

 Score =  131 bits (329), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 31/175 (17%), Positives = 65/175 (37%), Gaps = 7/175 (4%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-----VLYSNDNRELRILKMYR 55
           M   +    + TI  THG+ GEV I +  +   D  +      +        +++     
Sbjct: 1   MTNTENYFKVGTIVNTHGIRGEVKIMAITDFAADRFKKGAELQIDTKQGFVPVKVQDSRM 60

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
               ++  F G+ NI+   + +   +Y      +   L +DE++  ++      D +   
Sbjct: 61  HKNMWLVLFEGVTNINEIEKYKTHDIYVIGGAREA--LGDDEYYYNEIIGCRVIDLEDND 118

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
            G +  +   GA  +  +    +   LIP     V  V++    + ID +   L+
Sbjct: 119 IGVISEIMETGANDVWVVSRDGQSDALIPMIDDVVKNVDVAGKLVTIDALEGLLD 173


>gi|258406143|ref|YP_003198885.1| 16S rRNA processing protein RimM [Desulfohalobium retbaense DSM
           5692]
 gi|257798370|gb|ACV69307.1| 16S rRNA processing protein RimM [Desulfohalobium retbaense DSM
           5692]
          Length = 182

 Score =  131 bits (329), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 35/170 (20%), Positives = 66/170 (38%), Gaps = 7/170 (4%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND-----NRELRILKMYRKNKRF 60
           +LV +  I    GL GEV ++ +A+ P                  +   +L       R 
Sbjct: 5   RLVPIGRIAKPLGLRGEVCLEPHADFPFVFASLERIYLQFERRRPKPYAVLSHRVHKGRD 64

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +    GI+   +A  +R  ++ A+ +D  +   ++      DL         G + G+V 
Sbjct: 65  VLLLHGIEGRDAAESIRGREVLARARDLPEP--DDAVLLRQDLPGCRVELEDGAWVGEVL 122

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
            V +  A  +  I     +  L P  +  VL+V+L+   ++I P    L+
Sbjct: 123 EVQDNRAQDVWVILGPQGQEILFPVCEAFVLDVDLERRVVVIRPPEGLLD 172


>gi|292900326|ref|YP_003539695.1| 16S_rRNA processing protein [Erwinia amylovora ATCC 49946]
 gi|291200174|emb|CBJ47302.1| 16S rRNA processing protein [Erwinia amylovora ATCC 49946]
          Length = 185

 Score =  131 bits (329), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 32/186 (17%), Positives = 73/186 (39%), Gaps = 21/186 (11%)

Query: 1   MVKLD---------KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRE 47
           MV +            +++  +G+ +G+ G + + S   +   +  Y  +        + 
Sbjct: 1   MVNMSKQLTAQPPANPLILGKMGSAYGIRGWLKVFSSTEDAESIFDYQPWFIQRAGQWQL 60

Query: 48  LRILKMYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEME 107
           + +    R N+  I    GID+  +A  L + ++    +     +L+  +++  DL   +
Sbjct: 61  VELEGWKRHNQDMIIKVKGIDDRDAAGLLTNCEIVVDSEQLP--QLDNGDYYWKDLMGCQ 118

Query: 108 TFDRQGKYWGQVCGVYNFGAGSILEIKNTME-----KTFLIPFTKF-AVLEVNLQENKIL 161
               +G   G+V  +   G+  +L +K  ++     +  LIPF     +  V+L    I 
Sbjct: 119 VVTVEGYELGKVIDMMETGSNDVLVVKANLKDAFGVQERLIPFLDEQVIKNVDLTTRTIK 178

Query: 162 IDPIAA 167
           +D    
Sbjct: 179 VDWDPG 184


>gi|326204804|ref|ZP_08194658.1| 16S rRNA processing protein RimM [Clostridium papyrosolvens DSM
           2782]
 gi|325985016|gb|EGD45858.1| 16S rRNA processing protein RimM [Clostridium papyrosolvens DSM
           2782]
          Length = 169

 Score =  131 bits (329), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 37/171 (21%), Positives = 78/171 (45%), Gaps = 6/171 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNR----ELRILKMYRKNKR 59
           + + +++  +  THG+ GE+   +  ++P    +      D      +  I  +    + 
Sbjct: 1   MLEYLIVGQLVNTHGVKGELKATAQTDDPQRFRKLKWVYIDKNGSLEKCNISGVKFFKQF 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F GID+I  A +L+   L   R +    +L E+ FF  D+  ++ +D   +  G++
Sbjct: 61  VIIKFEGIDSIEEAEKLKGFYLKVDRAN--AVKLPENSFFIADILGLKVYDENNQLLGEL 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
             V   G+  +  ++++  K  L+P  K  V E++++E KI +      L+
Sbjct: 119 KDVIQTGSNDVYVVRDSEAKEILVPALKSVVKEISIEEGKISVILPKGLLD 169


>gi|254901179|ref|ZP_05261103.1| 16S rRNA-processing protein RimM [Listeria monocytogenes J0161]
 gi|254914088|ref|ZP_05264100.1| conserved hypothetical protein [Listeria monocytogenes J2818]
 gi|293592110|gb|EFG00445.1| conserved hypothetical protein [Listeria monocytogenes J2818]
          Length = 172

 Score =  131 bits (329), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 39/174 (22%), Positives = 75/174 (43%), Gaps = 9/174 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-------YVLYSNDNRELRILKMYRK 56
           ++K+  +  I  THGL GE+ + +  + P +  +       +   S    +L I    + 
Sbjct: 1   MEKMYNVGKIVNTHGLIGEIRVIATTDFPEERFQVGNTVYLFEKNSKKPEKLIIRSHRKH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
               +  F G   IH    +++  L  K       +LEE+EF+  ++         G+  
Sbjct: 61  KNFDLLMFEGFTGIHQVERMKEGVLKIKETQL--TDLEENEFYFHEIIGCTVVTTDGEEL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           G++  +   GA  +  +K   +K  LIP+    V E+N+ + KI I+ +   L+
Sbjct: 119 GEITEILTPGANDVWVVKGADKKEKLIPYIADVVKEINIDDQKITIEVMEGLLD 172


>gi|332289617|ref|YP_004420469.1| 16S rRNA-processing protein RimM [Gallibacterium anatis UMN179]
 gi|330432513|gb|AEC17572.1| 16S rRNA-processing protein RimM [Gallibacterium anatis UMN179]
          Length = 174

 Score =  131 bits (329), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 33/171 (19%), Positives = 71/171 (41%), Gaps = 11/171 (6%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND----NRELRILKMYRKN 57
           ++  K+ ++  +G+T+G+ G + + S       +  Y  +  +     + + I      +
Sbjct: 1   MEQQKIGVVGKLGSTYGIRGWLRVYSSTEYAESIFDYQPWFLNIKKQWQPVEIEGWRHHS 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
           +  I    G+D+   A  L ++++        +  L+E EF+  DL      + QG   G
Sbjct: 61  QDLIVKIKGVDDREQAQTLANIEIGVDLNQLPE--LDEGEFYWHDLIGCRVINLQGYDMG 118

Query: 118 QVCGVYNFGAGSILEIKNTM-----EKTFLIPFTKFAVLEVNLQENKILID 163
            V  +   G+  +L ++        ++  LIP+    V  V+L    I +D
Sbjct: 119 VVSELMETGSNDVLVVQANGKDAFAKQERLIPYIDAVVKRVDLSTKVIEVD 169


>gi|299066904|emb|CBJ38099.1| 16S rRNA processing protein [Ralstonia solanacearum CMR15]
          Length = 213

 Score =  131 bits (329), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 39/169 (23%), Positives = 72/169 (42%), Gaps = 12/169 (7%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----------SNDNRELRILKMY 54
           D LV +  +G  +G+ G + +  + +    L+    +          S+D R L I    
Sbjct: 42  DDLVEVGYVGGAYGVRGWIKVQPHGDAEALLHAGTWWLKPAAGAPAVSSDWRVLPIGTSR 101

Query: 55  RKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGK 114
             +   +A    + + + A  LR   ++ +R DF     +E  F+  DL      + Q +
Sbjct: 102 EHSGSVVAGSPAVPDRNVAEALRGCTVWVRRADFPTPADDE--FYWVDLIGSTVVNEQQE 159

Query: 115 YWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
             G V G+ + GA  IL I +      L+PF +  V  V++   +I++D
Sbjct: 160 TLGTVAGLIDNGAHQILRIVDESGTERLVPFVEVYVKSVDVAGKRIVVD 208


>gi|113460440|ref|YP_718502.1| 16S rRNA-processing protein RimM [Haemophilus somnus 129PT]
 gi|122945158|sp|Q0I1J9|RIMM_HAES1 RecName: Full=Ribosome maturation factor rimM
 gi|112822483|gb|ABI24572.1| 16S rRNA processing protein RimM [Haemophilus somnus 129PT]
          Length = 175

 Score =  131 bits (329), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 35/172 (20%), Positives = 71/172 (41%), Gaps = 12/172 (6%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKN 57
           ++  ++ ++  +G+T+G+ G + + S       +  Y  +        + + +      N
Sbjct: 1   MEQQRIEVVGKLGSTYGIRGWLRLYSSTEQAESIFDYQPWFLKIKGQWQPIELESWKFHN 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              I    GI+    A  L ++++      F    L+E +F+  DL   +  + QG   G
Sbjct: 61  HELIVKLKGINEREVAQTLANVEIGVNLSVFP--LLDEGDFYWHDLIGCQVVNLQGYAMG 118

Query: 118 QVCGVYNFGAGSILEIKNT-----MEKTFLIPFT-KFAVLEVNLQENKILID 163
            V  +   GA  +L ++ +      +K  LIPF  +  V  V+L    I +D
Sbjct: 119 VVSEMMETGANDVLVVRASTKDAFGKKERLIPFLYEQVVKRVDLSSKTIEVD 170


>gi|167648844|ref|YP_001686507.1| 16S rRNA-processing protein RimM [Caulobacter sp. K31]
 gi|167351274|gb|ABZ74009.1| 16S rRNA processing protein RimM [Caulobacter sp. K31]
          Length = 200

 Score =  131 bits (329), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 50/191 (26%), Positives = 87/191 (45%), Gaps = 8/191 (4%)

Query: 1   MVKLD--KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRE--LRILKMYRK 56
           M +     L+L+  +    G+ GE+ I +Y  +P+ L R+   +  +    L +      
Sbjct: 9   MTQSSPQNLILVGRVAGAFGVRGELRIATYTEDPLTLTRFKALTRQDGSPALTVQTARVV 68

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFD-RQGKY 115
               +A  +G+D   +A  LR L+LY  R    +   +EDE++  DL  +        + 
Sbjct: 69  KDGVVARCAGVDTKEAADALRGLRLYVPRAALPEP--DEDEYYLADLIGLPVRHVATDEL 126

Query: 116 WGQVCGVYNFGAGSILEIKNT-MEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTM 174
            G++  V NFGA  +LEI      +T+ +PFT+ AV EV + +  +L DP A        
Sbjct: 127 LGKIKSVQNFGADDLLEIDPALGGQTWYLPFTRAAVPEVKIADGVVLADPPALVGEPEGP 186

Query: 175 KNPQYDCPLDS 185
           ++P  D   + 
Sbjct: 187 ESPAEDDDGER 197


>gi|255522476|ref|ZP_05389713.1| 16S rRNA-processing protein RimM [Listeria monocytogenes FSL
           J1-175]
 gi|328466403|gb|EGF37554.1| 16S rRNA-processing protein RimM [Listeria monocytogenes 1816]
 gi|332312234|gb|EGJ25329.1| Ribosome maturation factor rimM [Listeria monocytogenes str. Scott
           A]
          Length = 172

 Score =  131 bits (329), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 39/174 (22%), Positives = 76/174 (43%), Gaps = 9/174 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-------YVLYSNDNRELRILKMYRK 56
           ++K+  +  I  THGL GE+ + +  + P +  +       +   S    +L I    + 
Sbjct: 1   MEKMYNVGKIVNTHGLIGEIRVIATTDFPEERFQVGNTVYLFEKNSKKPEKLIIRSHRKH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
               +  F G   IH    +++  L  K       +LEE+EF+  ++         G+  
Sbjct: 61  KNFDLLMFEGFTGIHQVERMKEGVLKIKEAQL--TDLEENEFYFHEIIGCIVVTTDGEEL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           G++  +   GA  +  +K + +K  LIP+    V E+N+ + KI I+ +   L+
Sbjct: 119 GEITEILTPGANDVWVVKGSDKKEKLIPYIADVVKEININDKKITIEVMEGLLD 172


>gi|226224396|ref|YP_002758503.1| 16S rRNA processing protein RimM [Listeria monocytogenes Clip81459]
 gi|259585647|sp|C1KW92|RIMM_LISMC RecName: Full=Ribosome maturation factor rimM
 gi|225876858|emb|CAS05567.1| Putative 16S rRNA processing protein RimM [Listeria monocytogenes
           serotype 4b str. CLIP 80459]
          Length = 172

 Score =  130 bits (328), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 40/174 (22%), Positives = 76/174 (43%), Gaps = 9/174 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-------YVLYSNDNRELRILKMYRK 56
           ++K+  +  I  THGL GE+ + +  + P +  +       +   S    +L I    + 
Sbjct: 1   MEKMYNVGKIVNTHGLIGEIRVIATTDFPEERFQVGNTVYLFEKNSKKPEKLIIRSHRKH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
               +  F G   IH    +++  L  K       +LEE+EF+  ++         GK  
Sbjct: 61  KNFDLLMFEGFTGIHQVERMKEGVLKIKEAQL--TDLEENEFYFHEIIGCIVVTTDGKEL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           G++  +   GA  +  +K + +K  LIP+    V E+N+ + KI I+ +   L+
Sbjct: 119 GEITEILTPGANDVWVVKGSDKKEKLIPYIADVVKEININDKKITIEVMEGLLD 172


>gi|30249636|ref|NP_841706.1| hypothetical protein NE1672 [Nitrosomonas europaea ATCC 19718]
 gi|48474816|sp|Q82U37|RIMM_NITEU RecName: Full=Ribosome maturation factor rimM
 gi|30138999|emb|CAD85583.1| RimM [Nitrosomonas europaea ATCC 19718]
          Length = 169

 Score =  130 bits (328), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 40/164 (24%), Positives = 77/164 (46%), Gaps = 7/164 (4%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY-----SNDNRELRILKMYRKNKRFI 61
           +V++  I   HG+ G++ +  +      L  Y ++       + + +R    +  +   I
Sbjct: 1   MVVLGRIAGPHGIRGQIKVIPFTEYVDGLMEYPVWCLSRDEKNWQIVRPATFFIHDNLLI 60

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELE-EDEFFNTDLEEMETFDRQGKYWGQVC 120
            T +G  +  SASEL+ L +   R        + ED ++ TDL  +   + QG+  G V 
Sbjct: 61  VTLTGYSDRTSASELKGLLVAVPRSQLPPLSKDGEDGYYWTDLIGISVVNMQGEPLGTVA 120

Query: 121 GVYNFGAGSILEIK-NTMEKTFLIPFTKFAVLEVNLQENKILID 163
           G++  GA  +L ++ +   K  LIPF    + +V+L+  +I +D
Sbjct: 121 GLFETGANDVLRVRLSGSSKDELIPFVDQVIRQVDLESRQITVD 164


>gi|300704719|ref|YP_003746322.1| 16S rRNA processing protein [Ralstonia solanacearum CFBP2957]
 gi|299072383|emb|CBJ43721.1| 16S rRNA processing protein [Ralstonia solanacearum CFBP2957]
          Length = 213

 Score =  130 bits (328), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 38/169 (22%), Positives = 71/169 (42%), Gaps = 12/169 (7%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----------SNDNRELRILKMY 54
           D LV +  +G  +G+ G + +  + +    L+    +          S+D R L +    
Sbjct: 42  DDLVEVGYVGGAYGIRGWIKVQPHGDAEALLHAGTWWLKPAAGAPTVSSDWRVLPVGTSR 101

Query: 55  RKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGK 114
             +   +A    + + + A  LR   ++  R DF     +E  F+  DL      + Q +
Sbjct: 102 EHSGSVVAGSPAVPDRNVAEALRGCAVWISRADFPAPADDE--FYWVDLIGSTVVNEQQE 159

Query: 115 YWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
             G V G+ + GA  IL I +      L+PF +  V  V++   +I++D
Sbjct: 160 SLGTVAGLLDNGAHQILRIVDEGGTERLVPFVEVYVKSVDVAGKRIVVD 208


>gi|254519210|ref|ZP_05131266.1| ribosome maturation factor rimM [Clostridium sp. 7_2_43FAA]
 gi|226912959|gb|EEH98160.1| ribosome maturation factor rimM [Clostridium sp. 7_2_43FAA]
          Length = 165

 Score =  130 bits (328), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 42/169 (24%), Positives = 73/169 (43%), Gaps = 4/169 (2%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIAT 63
           +  ++ +  I  THGL GEV + +  ++P   N       D  E +I     +  R I  
Sbjct: 1   MRDILRVGKIVNTHGLKGEVKVIALTDDPKRYNDLDFVLIDGVERKIQGCKFQKDRVIVK 60

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
             GID+I  A + ++  +   R+      LEED ++  D+     +D +GK  G+V  V 
Sbjct: 61  IEGIDSIEEAEKYKNKYMEIPREY--AVPLEEDTYYIADIIGCNVYDTEGKSLGEVYDVI 118

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNT 172
                 +  I+    K  LIP     V +++++  KI I P+    +  
Sbjct: 119 QTKNNDVYWIRKP--KELLIPVLLDIVTDIDVENRKITIKPVGEWQDED 165


>gi|209573746|sp|B0T563|RIMM_CAUSK RecName: Full=Ribosome maturation factor rimM
          Length = 192

 Score =  130 bits (328), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 50/191 (26%), Positives = 87/191 (45%), Gaps = 8/191 (4%)

Query: 1   MVKLD--KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRE--LRILKMYRK 56
           M +     L+L+  +    G+ GE+ I +Y  +P+ L R+   +  +    L +      
Sbjct: 1   MTQSSPQNLILVGRVAGAFGVRGELRIATYTEDPLTLTRFKALTRQDGSPALTVQTARVV 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFD-RQGKY 115
               +A  +G+D   +A  LR L+LY  R    +   +EDE++  DL  +        + 
Sbjct: 61  KDGVVARCAGVDTKEAADALRGLRLYVPRAALPEP--DEDEYYLADLIGLPVRHVATDEL 118

Query: 116 WGQVCGVYNFGAGSILEIKNT-MEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTM 174
            G++  V NFGA  +LEI      +T+ +PFT+ AV EV + +  +L DP A        
Sbjct: 119 LGKIKSVQNFGADDLLEIDPALGGQTWYLPFTRAAVPEVKIADGVVLADPPALVGEPEGP 178

Query: 175 KNPQYDCPLDS 185
           ++P  D   + 
Sbjct: 179 ESPAEDDDGER 189


>gi|330872810|gb|EGH06959.1| 16S rRNA-processing protein RimM [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 179

 Score =  130 bits (328), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 32/168 (19%), Positives = 82/168 (48%), Gaps = 11/168 (6%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND-----NRELRILKMYRKNKR 59
           D L+++  I + HG+ GEV + S+ +   +L  Y  ++        +++ ++    ++K 
Sbjct: 9   DDLIVIGKIYSVHGVRGEVKVYSFTDPIGNLLDYKTWTLRREGSVEKQVELVSGRLQSKF 68

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +     +D+   A  L   ++   R  F D  L++ E++   LE ++  D+ G+  G++
Sbjct: 69  LVVKLKDLDDREEARLLSGYEICVPRNLFPD--LDDGEYYWYQLEGLKVIDQLGQLLGKI 126

Query: 120 CGVYNFGAGSILEIKNT----MEKTFLIPFTKFAVLEVNLQENKILID 163
             +   G+  ++ +K       ++  L+P+T+  VL +++   ++ ++
Sbjct: 127 DHLLETGSNDVMVVKPCAGSLDDRERLLPYTEQCVLAIDMAAGEMKVE 174


>gi|224584528|ref|YP_002638326.1| 16S rRNA-processing protein RimM [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|224469055|gb|ACN46885.1| 16S rRNA-processing protein [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
          Length = 185

 Score =  130 bits (328), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 33/184 (17%), Positives = 75/184 (40%), Gaps = 19/184 (10%)

Query: 1   MVKLD-------KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELR 49
           M+          + V++  +G+++G+ G + + S   +   +  Y  +        ++++
Sbjct: 3   MMSKQLAAQVPAEPVVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQQVQ 62

Query: 50  ILKMYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETF 109
           +      N+  I    G+D+  +A+ L + ++           LEE +++  DL   +  
Sbjct: 63  LESWKHHNQDLIIKLKGVDDRDAANLLTNCEIVVDSSQLPA--LEEGDYYWKDLMGCQVV 120

Query: 110 DRQGKYWGQVCGVYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILID 163
             +G   G+V  +   G+  +L IK  ++     K  L+PF     + +V L    I +D
Sbjct: 121 TAEGYDLGKVIDMMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVVLATRTIEVD 180

Query: 164 PIAA 167
               
Sbjct: 181 WDPG 184


>gi|58580949|ref|YP_199965.1| 16S rRNA-processing protein RimM [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|188578072|ref|YP_001915001.1| 16S rRNA-processing protein RimM [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|58425543|gb|AAW74580.1| 16S rRNA processing protein RimM [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|188522524|gb|ACD60469.1| 16S rRNA processing protein RimM [Xanthomonas oryzae pv. oryzae
           PXO99A]
          Length = 180

 Score =  130 bits (328), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 33/169 (19%), Positives = 78/169 (46%), Gaps = 10/169 (5%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY-----SNDNRELRILKMYR 55
           M + ++ +L+  +    G+ GE+ ++S+      + RY  +     S     +  ++   
Sbjct: 11  MKQTERRILLGRVVGAFGVKGELKLESWTEPRSAIFRYQPWIVRAPSGQESVINGVRGRD 70

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
           + K  IA F G+ +  +   +   ++Y  R      + +E  ++  DLEE++    +G  
Sbjct: 71  QGKNLIAVFPGVADRDTVEAMHGTEIYVARSALPPPKPDE--YYWVDLEELQVETVEGVK 128

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFT-KFAVLEVNLQENKILID 163
            G V  +++ G+  ++ ++   ++  +IPF     V  V+ + N I++D
Sbjct: 129 LGTVSHLFSTGSNDVVVVR--GDRERMIPFVFPDFVKSVDFEANLIVVD 175


>gi|315282787|ref|ZP_07871115.1| 16S rRNA processing protein RimM [Listeria marthii FSL S4-120]
 gi|313613566|gb|EFR87382.1| 16S rRNA processing protein RimM [Listeria marthii FSL S4-120]
          Length = 172

 Score =  130 bits (328), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 39/174 (22%), Positives = 74/174 (42%), Gaps = 9/174 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-------YVLYSNDNRELRILKMYRK 56
           ++K+  +  I  THGL GE+ + +  + P +  +       +   S    +L I    + 
Sbjct: 1   MEKMYNVGKIVNTHGLIGEIRVIATTDFPEERFQVGNTVYLFEKNSKKPEKLIIRSHRKH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
               +  F G   IH    +++  L  K       +LEE+EF+  ++         G+  
Sbjct: 61  KNFDLLMFEGFTGIHQVERMKEGVLKIKEAQL--TDLEENEFYFHEIIGCTVVTTDGEEL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           G++  +   GA  +  +K   +K  LIP+    V E+N  + KI I+ +   L+
Sbjct: 119 GEITEILTPGANDVWVVKGADKKEKLIPYIADVVKEINTNDKKITIEVMEGLLD 172


>gi|220912967|ref|YP_002488276.1| 16S rRNA-processing protein RimM [Arthrobacter chlorophenolicus A6]
 gi|219859845|gb|ACL40187.1| 16S rRNA processing protein RimM [Arthrobacter chlorophenolicus A6]
          Length = 181

 Score =  130 bits (328), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 42/182 (23%), Positives = 74/182 (40%), Gaps = 8/182 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLN----RYVLYSNDNRELRILKMYRKNKRFIAT 63
           + +A IG  HG+ GEV +    + P D       +V+    +  L +          +  
Sbjct: 3   LQVARIGKPHGIRGEVTVQVMTDAPGDRFVPGVEFVVEPAQSGPLTVSSARWNKDILLLA 62

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F  I++ + A  LR  KL+ +  +  ++  +ED ++  +L  +E         G+V  + 
Sbjct: 63  FEEIEDRNQAETLRGAKLFIETAELDED--DEDGWYEHELVGLEARVGS-TVVGKVTALN 119

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN-NTTMKNPQYDCP 182
              A  +L +     +  LIPF +  V EVN+ E  IL+ P       N+    P     
Sbjct: 120 TAPAQDLLMVTTPDGEEILIPFVEQIVPEVNVGEGYILLTPPDGLFEVNSGEAAPSEPEG 179

Query: 183 LD 184
            D
Sbjct: 180 TD 181


>gi|329847287|ref|ZP_08262315.1| 16S rRNA processing protein RimM [Asticcacaulis biprosthecum C19]
 gi|328842350|gb|EGF91919.1| 16S rRNA processing protein RimM [Asticcacaulis biprosthecum C19]
          Length = 166

 Score =  130 bits (328), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 50/165 (30%), Positives = 83/165 (50%), Gaps = 4/165 (2%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSN--DNRELRILKMYRKNKR 59
           +    LVL+A +G  HG+ GE  + S+ ++P+ L  +    +      L + K       
Sbjct: 1   MTKPNLVLVAQVGAPHGVQGEFKLMSFMDDPLSLLEHSPLLDVAGKPALVVTKARAHKGA 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +       +  +A +L+  KLY  R D  D   +E+E++ TDL  M+  D  G   G+V
Sbjct: 61  LLVFAEQAPDRTAAEKLKGQKLYVDRADLPDT--DEEEYYVTDLIGMDVVDTSGNMVGKV 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDP 164
             V NFGAG +L++K     +F +PFT   V +V+L E +I++D 
Sbjct: 119 VNVDNFGAGDLLDVKPLEGVSFYVPFTLAHVPQVHLAEGRIVVDL 163


>gi|294626998|ref|ZP_06705588.1| 16S rRNA-processing protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292598660|gb|EFF42807.1| 16S rRNA-processing protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
          Length = 170

 Score =  130 bits (328), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 34/169 (20%), Positives = 78/169 (46%), Gaps = 10/169 (5%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY-----SNDNRELRILKMYR 55
           M + ++ +L+  I    G+ GE+ ++S+      + RY  +     S     +  ++   
Sbjct: 1   MKQTERRILLGRIVGAFGVKGELKLESWTEPRTAIFRYQPWIVRTPSGQESVVSGVRGRD 60

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
           + K  IA F G+ +  +   +   ++Y  R      + +E  ++  DLEE++    +G  
Sbjct: 61  QGKNLIAVFPGVTDRDTVEAMHGTEIYVARSALPPPKPDE--YYWVDLEELQVETVEGVK 118

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFT-KFAVLEVNLQENKILID 163
            G V  +++ G+  ++ ++   ++  +IPF     V  V+ + N I++D
Sbjct: 119 LGTVSHLFSTGSNDVVVVR--GDRERMIPFVFPDFVKSVDFEANLIVVD 165


>gi|78224065|ref|YP_385812.1| 16S rRNA processing protein RimM [Geobacter metallireducens GS-15]
 gi|109893018|sp|Q39RN7|RIMM_GEOMG RecName: Full=Ribosome maturation factor rimM
 gi|78195320|gb|ABB33087.1| 16S rRNA processing protein RimM [Geobacter metallireducens GS-15]
          Length = 173

 Score =  130 bits (328), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 37/175 (21%), Positives = 75/175 (42%), Gaps = 8/175 (4%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY-----SNDNRELRILKMYR 55
           M+    LVL+  +  THG+ G++ +  ++     +            N      + +   
Sbjct: 1   MLGSTDLVLLGKVVATHGIRGQLSVVPFSGEFSTILSMQTVYLSGPDNRKESFEVDRAAV 60

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
              R + T  G  NI+    L   +L+A+R  F    L+E EF+  DL  +     +G  
Sbjct: 61  HRNRVLLTLKGFANINEVLHLVGRELFARRDQFPP--LDEGEFYWCDLIGLSVTTSEGLS 118

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
            G++  +   G+  +  +++  E+ +LIP  +  V+ V+L +  + + P    L+
Sbjct: 119 LGRIEEIIATGSNDVYVVRD-GEREYLIPALEDIVVGVDLDKGIMTVSPTEGLLD 172


>gi|83745801|ref|ZP_00942858.1| RimM [Ralstonia solanacearum UW551]
 gi|83727491|gb|EAP74612.1| RimM [Ralstonia solanacearum UW551]
          Length = 213

 Score =  130 bits (328), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 38/169 (22%), Positives = 71/169 (42%), Gaps = 12/169 (7%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----------SNDNRELRILKMY 54
           D LV +  +G  +G+ G + +  + +    L+    +          S+D R L +    
Sbjct: 42  DDLVEVGYVGGAYGIRGWIKVQPHGDAEALLHAGTWWLKPAAGAPAVSSDWRVLPVGTSR 101

Query: 55  RKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGK 114
             +   +A    + + + A  LR   ++  R DF     +E  F+  DL      + Q +
Sbjct: 102 EHSGSVVAGSPAVPDRNVAEALRGCAVWVSRADFPAPADDE--FYWVDLIGSAVVNEQQE 159

Query: 115 YWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
             G V G+ + GA  IL I +      L+PF +  V  V++   +I++D
Sbjct: 160 SLGTVAGLLDNGAHQILRIVDEGGTERLVPFVEVYVKSVDVAGKRIVVD 208


>gi|313632802|gb|EFR99758.1| 16S rRNA processing protein RimM [Listeria seeligeri FSL N1-067]
          Length = 172

 Score =  130 bits (328), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 36/174 (20%), Positives = 74/174 (42%), Gaps = 9/174 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-------YVLYSNDNRELRILKMYRK 56
           ++K+  +  I  THGL GE+ + +  +   +  +       +   S    +L I    + 
Sbjct: 1   MEKMYNVGKIVNTHGLIGEIRVIATTDFADERFQVGNTVYLFEKNSKKPEKLIIRSHRKH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
               +  F G   IH    +++  L    +     +LEE+E++  ++         G+  
Sbjct: 61  KNFDLLMFEGFTGIHQVERMKEGTLKITEKQL--TDLEENEYYFHEIIGCTVVTTDGEEL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           G++  +   GA  +  +K    K  LIP+ +  V E+N+ + KI I+ +   L+
Sbjct: 119 GEITEILTPGANDVWVVKGKDNKEKLIPYIEEVVKEINISDKKITIEVMEGLLD 172


>gi|78046899|ref|YP_363074.1| 16S rRNA-processing protein RimM [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|109893068|sp|Q3BVY9|RIMM_XANC5 RecName: Full=Ribosome maturation factor rimM
 gi|78035329|emb|CAJ22974.1| 16S rRNA processing protein RimM [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
          Length = 180

 Score =  130 bits (328), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 34/169 (20%), Positives = 77/169 (45%), Gaps = 10/169 (5%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY-----SNDNRELRILKMYR 55
           M + ++ +L+  I    G+ GE+ ++S+      + RY  +     S     +  ++   
Sbjct: 11  MKQTERRILLGRIVGAFGVKGELKLESWTEPRTAIFRYQPWIVRAPSGQESVVSGVRGRD 70

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
           + K  IA F G+ +  +   +   ++Y  R      + +E  ++  DLEE++    +G  
Sbjct: 71  QGKNLIAVFPGVTDRDTVEAMHGTEIYVARSALPPPKPDE--YYWVDLEELQVETVEGVK 128

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFT-KFAVLEVNLQENKILID 163
            G V  +++ G+  ++ ++   ++  +IPF     V  V+   N I++D
Sbjct: 129 LGTVSHLFSTGSNDVVVVR--GDRERMIPFVFPDFVKSVDFDANLIVVD 175


>gi|261820440|ref|YP_003258546.1| 16S rRNA-processing protein RimM [Pectobacterium wasabiae WPP163]
 gi|261604453|gb|ACX86939.1| 16S rRNA processing protein RimM [Pectobacterium wasabiae WPP163]
          Length = 182

 Score =  130 bits (328), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 34/172 (19%), Positives = 70/172 (40%), Gaps = 12/172 (6%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRFI 61
             ++M  IG+ +G+ G + + S   +   +  Y  +     +  + + I      N+  I
Sbjct: 12  NPIVMGKIGSAYGIRGWLRVFSSTEDADSIFDYQPWFIQSKSGWQLVEIEGWKYHNQDLI 71

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               G D+  +A+ L + ++        D  L E +++  DL   +     G   G++  
Sbjct: 72  IKVKGADDRDAANLLTNCEIVVDSSQLPD--LGEGDYYWKDLIGCQVVTVTGYELGKIID 129

Query: 122 VYNFGAGSILEIKNTME-----KTFLIPF-TKFAVLEVNLQENKILIDPIAA 167
           +   G+  ++ IK  ++     K  L+PF T+  V  V+L    I +D    
Sbjct: 130 MMETGSNDVMVIKANLKDAFGVKERLVPFLTEQVVKRVDLSAQTIEVDWDPG 181


>gi|313896374|ref|ZP_07829927.1| 16S rRNA processing protein RimM [Selenomonas sp. oral taxon 137
           str. F0430]
 gi|312975173|gb|EFR40635.1| 16S rRNA processing protein RimM [Selenomonas sp. oral taxon 137
           str. F0430]
          Length = 175

 Score =  130 bits (327), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 36/172 (20%), Positives = 67/172 (38%), Gaps = 7/172 (4%)

Query: 1   MVKL-----DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYR 55
           M KL     +  +++  +G  HG+ G+V +    + P    R       +  L I++M  
Sbjct: 1   MTKLSPSAPEGRIVIGRVGAPHGIAGDVRVIPLTDFPERFARLREVVVGDELLHIVRMKE 60

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
           + K F+  F        A  L    L   R D     LEE E++  D+  +  +D  G  
Sbjct: 61  QGKNFLMQFREYPVREEAQRLTGRLLTVARTD--AAPLEEGEYYVFDIVGLSVYDEAGTL 118

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAA 167
            G V  V   G+  +  ++    +  LIP  +  V  +++   ++ +     
Sbjct: 119 LGSVENVIRTGSNDVYAVRAEDGRELLIPALRSVVRNIDIAGGRMDVCLPDE 170


>gi|227115234|ref|ZP_03828890.1| 16S rRNA-processing protein [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 182

 Score =  130 bits (327), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 33/172 (19%), Positives = 70/172 (40%), Gaps = 12/172 (6%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRFI 61
             ++M  IG+ +G+ G + + S   +   +  Y  +     +  + + I      N+  I
Sbjct: 12  NPIVMGKIGSAYGIRGWLRVFSSTEDAESIFDYQPWFIQSKSGWQLVEIEGWKYHNQDLI 71

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               G D+  +A+ L + ++        D  L E +++  DL   +     G   G++  
Sbjct: 72  IKVKGADDRDAANLLTNCEIVVDSSQLPD--LGEGDYYWKDLIGCQVVTVTGYELGKIID 129

Query: 122 VYNFGAGSILEIKNTME-----KTFLIPF-TKFAVLEVNLQENKILIDPIAA 167
           +   G+  ++ IK  ++     K  L+PF T+  V  V+L    + +D    
Sbjct: 130 MMETGSNDVMVIKANLKDAFGVKERLVPFLTEQVVKRVDLSAQTVEVDWDPG 181


>gi|285017747|ref|YP_003375458.1| 16s rrna-processing protein [Xanthomonas albilineans GPE PC73]
 gi|283472965|emb|CBA15470.1| probable 16s rrna-processing protein [Xanthomonas albilineans]
          Length = 170

 Score =  130 bits (327), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 36/169 (21%), Positives = 73/169 (43%), Gaps = 10/169 (5%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY-----SNDNRELRILKMYR 55
           M    + +L+  +    G+ GE  ++S+    + + RY  +           L  ++   
Sbjct: 1   MKDSQRRILLGRVLGAFGIRGEAKLESWTEPRLAIFRYQPWIVRKPDGSESTLTGVRGRA 60

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
             K  IA+   + +  +   LR  ++Y  R        +E  ++  DLE ++    +G  
Sbjct: 61  SGKSLIASLPEVSDRDAVEALRGTEIYVTRSSLPPPHPDE--YYWVDLEGLDVRTVEGVA 118

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFT-KFAVLEVNLQENKILID 163
            GQV  +++ GA  +L ++   E+  L+PF     V  V+ + N I++D
Sbjct: 119 LGQVSHLFSTGANDVLVVR--GERERLVPFVQPDYVRSVDFEANLIVVD 165


>gi|291550680|emb|CBL26942.1| 16S rRNA processing protein RimM [Ruminococcus torques L2-14]
          Length = 169

 Score =  130 bits (327), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 40/171 (23%), Positives = 75/171 (43%), Gaps = 7/171 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRE----LRILKMYRKNKR 59
           +++ + +  I +THGL GEV +    ++            D       L I  +    + 
Sbjct: 1   MEQFLQVGVISSTHGLRGEVKVFPTTDDAARFQTLKNVVLDTGREKLDLEIQSVRFFKQF 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY-WGQ 118
            I  F GIDNI+   + +   L+  R++    ELEEDE++  DL  ME +    +  +G 
Sbjct: 61  VIVKFKGIDNINDIEKYKGKSLFVTREN--AVELEEDEYYIGDLIGMEVYTDDSEERFGV 118

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           +  V   GA  +  I +      L+P     +L+++++  K+ +  +   L
Sbjct: 119 LKDVMETGANEVYIITSENHGEVLLPAIHECILDIDVEAKKMKVHLMEGLL 169


>gi|329297077|ref|ZP_08254413.1| 16S rRNA-processing protein RimM [Plautia stali symbiont]
          Length = 182

 Score =  130 bits (327), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 31/168 (18%), Positives = 71/168 (42%), Gaps = 12/168 (7%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRFI 61
             +++  +G  +G+ G + + S   +   +  Y  +        +++ +      N+  I
Sbjct: 12  NPIILGKMGAAYGIRGWLKVFSSTEHAESIFDYQPWFIQRAGQWQQVELEGWKHHNQDLI 71

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               GID+  +A++L + ++           LEE +++  DL   +  +  G   G+V  
Sbjct: 72  IKVKGIDDRDAAAQLTNCEITVDSTQLPA--LEEGDYYWKDLMGCKVVNLDGYEMGKVID 129

Query: 122 VYNFGAGSILEIKNTME-----KTFLIPFTKF-AVLEVNLQENKILID 163
           +   G+  +L +K  ++     +  LIPF     + +V+L    I +D
Sbjct: 130 LMETGSNDVLVVKANLKDAFGVQERLIPFLDEQVIKKVDLATGTIEVD 177


>gi|309775672|ref|ZP_07670671.1| 16S rRNA processing protein RimM [Erysipelotrichaceae bacterium
           3_1_53]
 gi|308916578|gb|EFP62319.1| 16S rRNA processing protein RimM [Erysipelotrichaceae bacterium
           3_1_53]
          Length = 167

 Score =  130 bits (327), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 34/167 (20%), Positives = 68/167 (40%), Gaps = 8/167 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNR-----YVLYSNDNRELRILKMYRKNKRFIA 62
           + +  +  THGL GEV I    + P          ++       +L +  +     + I 
Sbjct: 4   INIGMLVNTHGLRGEVKIKVLTDFPQLRFHKGATVHLQLPTGELDLCVAGVRESKGQLIV 63

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F G D+I+     +   L  +  + ++  L+  E +  +L++   +   G   G V  +
Sbjct: 64  KFEGYDDINQVEAWKGSMLTIREDELQE--LDAYEAYYYELQDAAVYTMDGTLLGTVTEI 121

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
              GA ++L +K    K  LIPF +  V E + +   + ++ +   L
Sbjct: 122 IETGANAVLRVKTAD-KDILIPFVRAFVKEFDRKAKVMKVELLEGLL 167


>gi|303250040|ref|ZP_07336242.1| 16S rRNA-processing protein [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307253472|ref|ZP_07535343.1| Ribosome maturation factor rimM [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|302651103|gb|EFL81257.1| 16S rRNA-processing protein [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306859151|gb|EFM91193.1| Ribosome maturation factor rimM [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
          Length = 175

 Score =  130 bits (327), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 31/165 (18%), Positives = 65/165 (39%), Gaps = 12/165 (7%)

Query: 9   LMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRFIATF 64
           ++  +G+T+G+ G + + S       +  Y  +        + + +      N   I   
Sbjct: 8   VVGKLGSTYGIRGWLRLYSSTEETESIFDYQPWFLKIKGQWQPIELESWRYHNNDLIVKL 67

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
              D+  SA  L + ++      F +  LEE +++  DL   +  + +    G V  +  
Sbjct: 68  KSSDDRESAQLLTNAEIGVDLSVFPE--LEEGDYYWHDLIGCQVINLEDYSMGVVTELME 125

Query: 125 FGAGSILEIKNT-----MEKTFLIPFT-KFAVLEVNLQENKILID 163
            G+  +L ++        ++  LIPF  +  V  V+L    I +D
Sbjct: 126 TGSNDVLVVRANSKDAFGKQERLIPFLYEQVVKRVDLATKTITVD 170


>gi|118617623|ref|YP_905955.1| 16S rRNA-processing protein RimM [Mycobacterium ulcerans Agy99]
 gi|166226457|sp|A0PQ65|RIMM_MYCUA RecName: Full=Ribosome maturation factor rimM
 gi|118569733|gb|ABL04484.1| 16S rRNA processing protein RimM [Mycobacterium ulcerans Agy99]
          Length = 174

 Score =  130 bits (327), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 36/171 (21%), Positives = 66/171 (38%), Gaps = 10/171 (5%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLN--------RYVLYSNDNRELRILKMYRKNKR 59
           +++  +   HG+ GEV ++   + P            +        R   I  +     R
Sbjct: 3   LVIGRVVKAHGITGEVVVEIRTDEPDRRFTPGASLRAKRSRDGGTGRNYVIEGVREHGAR 62

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +   +G+++  +A  LR         D    E  +  +++  LE +      G+  G V
Sbjct: 63  LLVRLAGVNDRDTADGLRGSLFVIDSADLPPIEEPDT-YYDHQLEGLRVRTTAGQDVGVV 121

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
             V + GAG +L +K       L+PF    V  V+L +  + IDP    L+
Sbjct: 122 AEVLHTGAGELLAVKCDSG-EVLVPFVGAIVTSVSLDDRILEIDPPDGLLD 171


>gi|121602541|ref|YP_988423.1| 16S rRNA processing protein RimM [Bartonella bacilliformis KC583]
 gi|166226425|sp|A1UR20|RIMM_BARBK RecName: Full=Ribosome maturation factor rimM
 gi|120614718|gb|ABM45319.1| 16S rRNA processing protein RimM [Bartonella bacilliformis KC583]
          Length = 191

 Score =  130 bits (327), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 60/171 (35%), Positives = 96/171 (56%), Gaps = 3/171 (1%)

Query: 3   KLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKRFI 61
           +L+K VL+A I   HG+ G+V ++     P  L  Y VLY +  R   I+ M       I
Sbjct: 7   ELNKAVLLAVIRAAHGIRGDVVVNLLGAEPQRLKTYGVLYDDKGRLYEIVSMRVHKNNVI 66

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
             F G+D+  +A  L+ ++LY +R  F D+ L+ DEF+  DL  +  +D   +  G+V G
Sbjct: 67  VRFKGVDDRSTAEALKGVQLYIERDQFADD-LDTDEFYQIDLIGLRVYDNTNQLLGEVSG 125

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPI-AAGLNN 171
            +NFGAG +LE++    KT LIPF+K AV E+ +    +++DP+ A   ++
Sbjct: 126 FFNFGAGDLLEVRLISHKTELIPFSKAAVPEICVASGFLVVDPVAAGLFSD 176


>gi|292487303|ref|YP_003530175.1| 16S rRNA-processing protein rimM [Erwinia amylovora CFBP1430]
 gi|291552722|emb|CBA19767.1| 16S rRNA-processing protein rimM [Erwinia amylovora CFBP1430]
 gi|312171411|emb|CBX79670.1| 16S rRNA-processing protein rimM [Erwinia amylovora ATCC BAA-2158]
          Length = 182

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 30/172 (17%), Positives = 70/172 (40%), Gaps = 12/172 (6%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRFI 61
             +++  +G+ +G+ G + + S   +   +  Y  +        + + +    R N+  I
Sbjct: 12  NPLILGKMGSAYGIRGWLKVFSSTEDAESIFDYQPWFIQRAGQWQLVELEGWKRHNQDMI 71

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               GID+  +A  L + ++    +     +L+  +++  DL   +    +G   G+V  
Sbjct: 72  IKVKGIDDRDAAGLLTNCEIVVDSEQLP--QLDNGDYYWKDLMGCQVVTVEGYELGKVID 129

Query: 122 VYNFGAGSILEIKNTME-----KTFLIPFTKF-AVLEVNLQENKILIDPIAA 167
           +   G+  +L +K  ++     +  LIPF     +  V+L    I +D    
Sbjct: 130 MMETGSNDVLVVKANLKDAFGVQERLIPFLDEQVIKNVDLTTRTIKVDWDPG 181


>gi|322831431|ref|YP_004211458.1| 16S rRNA processing protein RimM [Rahnella sp. Y9602]
 gi|321166632|gb|ADW72331.1| 16S rRNA processing protein RimM [Rahnella sp. Y9602]
          Length = 182

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 31/183 (16%), Positives = 73/183 (39%), Gaps = 18/183 (9%)

Query: 1   MVKLDKLVL------MATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRI 50
           M K    V+      +  +G+T+G+ G + + S   +   +  Y  +        + + +
Sbjct: 1   MSKQSNPVVPAEPLVLGKMGSTYGIRGWLRVFSSTEDAESIFDYQPWFIQRAGKWQVVEL 60

Query: 51  LKMYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFD 110
               R  +  I    G+D+  +A+ L + ++    +      LE+ +++  DL   +   
Sbjct: 61  EGWKRHTQDLIIKVKGVDDRDAANLLTNCEIVVDSKQLPP--LEDGDYYWKDLFGCQVVT 118

Query: 111 RQGKYWGQVCGVYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILIDP 164
             G   G++  +   G+  ++ +K  ++     K  LIPF     + +V+L    + +D 
Sbjct: 119 TSGYELGKIIDMMETGSNDVMVVKANLKDAFGLKERLIPFLDGQVIKKVDLATRTVEVDW 178

Query: 165 IAA 167
              
Sbjct: 179 DPG 181


>gi|84622877|ref|YP_450249.1| 16S rRNA-processing protein [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|67461247|sp|Q5H391|RIMM_XANOR RecName: Full=Ribosome maturation factor rimM
 gi|109893069|sp|Q2P652|RIMM_XANOM RecName: Full=Ribosome maturation factor rimM
 gi|209573732|sp|B2SJV2|RIMM_XANOP RecName: Full=Ribosome maturation factor rimM
 gi|84366817|dbj|BAE67975.1| Probable 16S rRNA processing protein rimM [Xanthomonas oryzae pv.
           oryzae MAFF 311018]
          Length = 170

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 33/169 (19%), Positives = 78/169 (46%), Gaps = 10/169 (5%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY-----SNDNRELRILKMYR 55
           M + ++ +L+  +    G+ GE+ ++S+      + RY  +     S     +  ++   
Sbjct: 1   MKQTERRILLGRVVGAFGVKGELKLESWTEPRSAIFRYQPWIVRAPSGQESVINGVRGRD 60

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
           + K  IA F G+ +  +   +   ++Y  R      + +E  ++  DLEE++    +G  
Sbjct: 61  QGKNLIAVFPGVADRDTVEAMHGTEIYVARSALPPPKPDE--YYWVDLEELQVETVEGVK 118

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFT-KFAVLEVNLQENKILID 163
            G V  +++ G+  ++ ++   ++  +IPF     V  V+ + N I++D
Sbjct: 119 LGTVSHLFSTGSNDVVVVR--GDRERMIPFVFPDFVKSVDFEANLIVVD 165


>gi|154246453|ref|YP_001417411.1| 16S rRNA-processing protein RimM [Xanthobacter autotrophicus Py2]
 gi|238686722|sp|A7IIB1|RIMM_XANP2 RecName: Full=Ribosome maturation factor rimM
 gi|154160538|gb|ABS67754.1| 16S rRNA processing protein RimM [Xanthobacter autotrophicus Py2]
          Length = 185

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 50/191 (26%), Positives = 90/191 (47%), Gaps = 12/191 (6%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSN--DNRELRILKMYRKNKRFI 61
           +   +L+A IG  HG+ GEV +  +  +P  +  Y   ++    +  RI  +      F+
Sbjct: 1   MADRILVARIGAPHGVRGEVRLFVFTEDPGAVLDYDPLTDATGKKRFRIAALRAAKDHFV 60

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
           A   GI +  +A  L +L L+  R+     + ++D F++ DL  ++  D  G   G+V  
Sbjct: 61  ARIEGIADRTAAEALTNLDLFVPREALPPPD-DDDTFYHADLIGLDVVDEAGVVIGKVVA 119

Query: 122 VYNFGAGSILEIKN----TMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNP 177
           + +FGAG ILE       T  KT ++PF+K AV  V++   ++++   A          P
Sbjct: 120 LQDFGAGDILEYAPTLPATKAKTLMVPFSKDAVPVVDVPGRRVVV---AEAFVERRPAEP 176

Query: 178 QYDCPLDSAGK 188
             +   D+ G+
Sbjct: 177 --EEGEDTGGE 185


>gi|255524255|ref|ZP_05391214.1| 16S rRNA processing protein RimM [Clostridium carboxidivorans P7]
 gi|296185377|ref|ZP_06853787.1| 16S rRNA processing protein RimM [Clostridium carboxidivorans P7]
 gi|255512080|gb|EET88361.1| 16S rRNA processing protein RimM [Clostridium carboxidivorans P7]
 gi|296050211|gb|EFG89635.1| 16S rRNA processing protein RimM [Clostridium carboxidivorans P7]
          Length = 162

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 36/163 (22%), Positives = 72/163 (44%), Gaps = 4/163 (2%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIAT 63
           + + V +  I  THG+ GE+ I    ++     +      +  E  ++    +  + I  
Sbjct: 1   MKQFVTVGQIINTHGIKGELKIYPLTDDLRRFRKLQKVYVEGVEKNVVWCKLQTDKVILK 60

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
             GID++  A + ++  L   R+D    +L E  +F  D+         G  +G++  V 
Sbjct: 61  IEGIDSVEEAMKYKEKYLDVSRED--AVKLPEGSYFIADIIGCSVVGENGAEYGKIADVI 118

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIA 166
             G+  +  IK    K  LIP  K  V++++++  +I+I P+ 
Sbjct: 119 KTGSNDVYWIK--EGKELLIPALKDIVIDMDIENKRIVIKPVE 159


>gi|197303268|ref|ZP_03168309.1| hypothetical protein RUMLAC_01991 [Ruminococcus lactaris ATCC
           29176]
 gi|197297694|gb|EDY32253.1| hypothetical protein RUMLAC_01991 [Ruminococcus lactaris ATCC
           29176]
          Length = 178

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 40/171 (23%), Positives = 78/171 (45%), Gaps = 7/171 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRE----LRILKMYRKNKR 59
           +++ + +  I +THGL GEV +    ++            D  +    L I  +    + 
Sbjct: 10  MEQFLQVGVISSTHGLRGEVKVFPTTDDAARFQTLKEVILDTGKEKLDLEIQSVRFFKQF 69

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETF-DRQGKYWGQ 118
            I  F GID+I+   + +   L+  R++    ELEEDE++  DL  M+ + D   + +G 
Sbjct: 70  VIVKFKGIDDINDIEKYKGKSLFVAREN--AVELEEDEYYIGDLIGMDVYTDESEERFGV 127

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           +  V   GA  +  +++      L+P     +LEV+ +E K+ +  +   +
Sbjct: 128 LKDVMETGANEVYIVQSERYGEVLLPAIHECILEVDPEEKKMTVHLMEGLI 178


>gi|149911443|ref|ZP_01900060.1| 16S rRNA-processing protein [Moritella sp. PE36]
 gi|149805474|gb|EDM65481.1| 16S rRNA-processing protein [Moritella sp. PE36]
          Length = 168

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 36/165 (21%), Positives = 69/165 (41%), Gaps = 13/165 (7%)

Query: 9   LMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRKNKRFIATF 64
           ++  +G  +G+ G + I+S+ + P  +  Y  +      +  E+ +    R  K  IA  
Sbjct: 2   VVGRLGAVYGIKGWMKINSFTDIPEGIFNYSPWLIEQKGEWVEVALEDFKRHGKGLIAKL 61

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
           +GID    A  L   ++             EDEF+  DL        +G   G+V  +  
Sbjct: 62  AGIDIREEAQSLTGAEIAINADQLPAL---EDEFYWRDLIGCSVETDKGYTLGKVTDMME 118

Query: 125 FGAGSILEIKNT-----MEKTFLIPFTK-FAVLEVNLQENKILID 163
            G+  +L IK        +K  L+P+     ++ V++   KI+++
Sbjct: 119 TGSNDVLVIKANATDAFGKKERLVPYLDGQVIISVDITAQKIIVN 163


>gi|148380404|ref|YP_001254945.1| 16S rRNA processing protein RimM [Clostridium botulinum A str. ATCC
           3502]
 gi|168180673|ref|ZP_02615337.1| 16S rRNA processing protein RimM [Clostridium botulinum NCTC 2916]
 gi|226949799|ref|YP_002804890.1| 16S rRNA processing protein RimM [Clostridium botulinum A2 str.
           Kyoto]
 gi|209573571|sp|A5I4M4|RIMM_CLOBH RecName: Full=Ribosome maturation factor rimM
 gi|148289888|emb|CAL83996.1| putative 16S rRNA processing protein RimM [Clostridium botulinum A
           str. ATCC 3502]
 gi|182668387|gb|EDT80366.1| 16S rRNA processing protein RimM [Clostridium botulinum NCTC 2916]
 gi|226843072|gb|ACO85738.1| 16S rRNA processing protein RimM [Clostridium botulinum A2 str.
           Kyoto]
          Length = 164

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 39/163 (23%), Positives = 72/163 (44%), Gaps = 4/163 (2%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIAT 63
           + + + +  I  THG+ GEV +    ++     +      D  E +IL    +    +  
Sbjct: 1   MKEFLAVGEIINTHGIKGEVKVYPLTDDMKRFKKLKEVFIDGEERKILSCKLQPNNVVLK 60

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
             GID+I  A++ R   L  KR++    +L +  +F  DL E    D  G+  GQ+  V 
Sbjct: 61  IEGIDSIEEANKYRKKLLEIKREN--SVKLPKGSYFIADLIECRVIDEDGREIGQISDVI 118

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIA 166
             G+  + E+K   +   L+P  K  V  ++++   + I P+ 
Sbjct: 119 KTGSNDVYEVK--GKSEVLVPAIKDIVTNIDIENKTVTIKPLE 159


>gi|108808841|ref|YP_652757.1| 16S rRNA-processing protein RimM [Yersinia pestis Antiqua]
 gi|108810969|ref|YP_646736.1| 16S rRNA-processing protein RimM [Yersinia pestis Nepal516]
 gi|153997660|ref|ZP_02022760.1| 16S rRNA processing protein [Yersinia pestis CA88-4125]
 gi|161484858|ref|NP_668228.2| 16S rRNA-processing protein RimM [Yersinia pestis KIM 10]
 gi|161511454|ref|NP_991788.2| 16S rRNA-processing protein RimM [Yersinia pestis biovar Microtus
           str. 91001]
 gi|162421041|ref|YP_001605453.1| 16S rRNA-processing protein RimM [Yersinia pestis Angola]
 gi|165925672|ref|ZP_02221504.1| 16S rRNA processing protein RimM [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165936610|ref|ZP_02225177.1| 16S rRNA processing protein RimM [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|166009999|ref|ZP_02230897.1| 16S rRNA processing protein RimM [Yersinia pestis biovar Antiqua
           str. E1979001]
 gi|166213093|ref|ZP_02239128.1| 16S rRNA processing protein RimM [Yersinia pestis biovar Antiqua
           str. B42003004]
 gi|167399078|ref|ZP_02304602.1| 16S rRNA processing protein RimM [Yersinia pestis biovar Antiqua
           str. UG05-0454]
 gi|167421657|ref|ZP_02313410.1| 16S rRNA processing protein RimM [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167423837|ref|ZP_02315590.1| 16S rRNA processing protein RimM [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|170025578|ref|YP_001722083.1| 16S rRNA-processing protein RimM [Yersinia pseudotuberculosis
           YPIII]
 gi|218930315|ref|YP_002348190.1| 16S rRNA-processing protein RimM [Yersinia pestis CO92]
 gi|229838912|ref|ZP_04459071.1| 16S rRNA processing protein [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229896395|ref|ZP_04511563.1| 16S rRNA processing protein [Yersinia pestis Pestoides A]
 gi|229899478|ref|ZP_04514620.1| 16S rRNA processing protein [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229901184|ref|ZP_04516307.1| 16S rRNA processing protein [Yersinia pestis Nepal516]
 gi|270489367|ref|ZP_06206441.1| 16S rRNA processing protein RimM [Yersinia pestis KIM D27]
 gi|294505008|ref|YP_003569070.1| 16S rRNA-processing protein [Yersinia pestis Z176003]
 gi|21362863|sp|Q8ZBU8|RIMM_YERPE RecName: Full=Ribosome maturation factor rimM
 gi|122382874|sp|Q1C410|RIMM_YERPA RecName: Full=Ribosome maturation factor rimM
 gi|122385120|sp|Q1CLJ4|RIMM_YERPN RecName: Full=Ribosome maturation factor rimM
 gi|238687264|sp|A9R0U4|RIMM_YERPG RecName: Full=Ribosome maturation factor rimM
 gi|238688419|sp|B1JJ90|RIMM_YERPY RecName: Full=Ribosome maturation factor rimM
 gi|108774617|gb|ABG17136.1| 16S rRNA processing protein RimM [Yersinia pestis Nepal516]
 gi|108780754|gb|ABG14812.1| 16S rRNA processing protein RimM [Yersinia pestis Antiqua]
 gi|115348926|emb|CAL21885.1| 16S rRNA processing protein [Yersinia pestis CO92]
 gi|149289297|gb|EDM39377.1| 16S rRNA processing protein [Yersinia pestis CA88-4125]
 gi|162353856|gb|ABX87804.1| 16S rRNA processing protein RimM [Yersinia pestis Angola]
 gi|165915259|gb|EDR33869.1| 16S rRNA processing protein RimM [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|165922284|gb|EDR39461.1| 16S rRNA processing protein RimM [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165990906|gb|EDR43207.1| 16S rRNA processing protein RimM [Yersinia pestis biovar Antiqua
           str. E1979001]
 gi|166205880|gb|EDR50360.1| 16S rRNA processing protein RimM [Yersinia pestis biovar Antiqua
           str. B42003004]
 gi|166960576|gb|EDR56597.1| 16S rRNA processing protein RimM [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167051582|gb|EDR62990.1| 16S rRNA processing protein RimM [Yersinia pestis biovar Antiqua
           str. UG05-0454]
 gi|167058007|gb|EDR67753.1| 16S rRNA processing protein RimM [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|169752112|gb|ACA69630.1| 16S rRNA processing protein RimM [Yersinia pseudotuberculosis
           YPIII]
 gi|229681909|gb|EEO78002.1| 16S rRNA processing protein [Yersinia pestis Nepal516]
 gi|229687475|gb|EEO79549.1| 16S rRNA processing protein [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229695278|gb|EEO85325.1| 16S rRNA processing protein [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229700469|gb|EEO88500.1| 16S rRNA processing protein [Yersinia pestis Pestoides A]
 gi|262366997|gb|ACY63554.1| 16S rRNA-processing protein [Yersinia pestis D182038]
 gi|270337871|gb|EFA48648.1| 16S rRNA processing protein RimM [Yersinia pestis KIM D27]
 gi|294355467|gb|ADE65808.1| 16S rRNA-processing protein [Yersinia pestis Z176003]
 gi|320016487|gb|ADW00059.1| 16S rRNA processing protein [Yersinia pestis biovar Medievalis str.
           Harbin 35]
          Length = 182

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 33/183 (18%), Positives = 77/183 (42%), Gaps = 18/183 (9%)

Query: 1   MVKL------DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRI 50
           M K       D+ +++  +G+T+G+ G + + S   N   +  Y  +        + + +
Sbjct: 1   MSKQLNPAVPDQPIVLGKMGSTYGIRGWLRVFSSTENAESIFDYQPWFIQQAGKWQHVEL 60

Query: 51  LKMYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFD 110
               R ++  I    G+D+  +A+ L + ++           LEED+++  DL   +   
Sbjct: 61  EDWKRHSQDLIIKVKGVDDREAANLLTNCEIIVDSTQLPA--LEEDDYYWKDLMGCQVVT 118

Query: 111 RQGKYWGQVCGVYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILIDP 164
             G   G++  +   G+  ++ +K  ++     K  L+PF     + +V+L   ++ +D 
Sbjct: 119 TTGYELGKIIDMMETGSNDVMVVKANLKDAFGMKERLVPFLHGQVIKKVDLTAQRVEVDW 178

Query: 165 IAA 167
              
Sbjct: 179 DPG 181


>gi|116495081|ref|YP_806815.1| 16S rRNA-processing protein RimM [Lactobacillus casei ATCC 334]
 gi|191638584|ref|YP_001987750.1| 16S rRNA-processing protein RimM [Lactobacillus casei BL23]
 gi|227534906|ref|ZP_03964955.1| 16S rRNA processing protein [Lactobacillus paracasei subsp.
           paracasei ATCC 25302]
 gi|122263502|sp|Q038J9|RIMM_LACC3 RecName: Full=Ribosome maturation factor rimM
 gi|238693051|sp|B3WEU1|RIMM_LACCB RecName: Full=Ribosome maturation factor rimM
 gi|116105231|gb|ABJ70373.1| 16S rRNA processing protein RimM [Lactobacillus casei ATCC 334]
 gi|190712886|emb|CAQ66892.1| Probable 16S rRNA-processing protein rimM [Lactobacillus casei
           BL23]
 gi|227187662|gb|EEI67729.1| 16S rRNA processing protein [Lactobacillus paracasei subsp.
           paracasei ATCC 25302]
 gi|327382625|gb|AEA54101.1| 16S rRNA processing protein RimM [Lactobacillus casei LC2W]
 gi|327385821|gb|AEA57295.1| 16S rRNA processing protein RimM [Lactobacillus casei BD-II]
          Length = 172

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 33/174 (18%), Positives = 68/174 (39%), Gaps = 6/174 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNRELRILKMYRKNKR 59
           +     + TI  THG+ GEV +    + P D  +      + ++    L I  +      
Sbjct: 1   MPDYYDIGTIVNTHGIRGEVRVLVTTDFPADRFKVGNTVYVATSPKTALTIQSVREHKGL 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            + TF    +I+     +  KL       +   L+E  ++  D+  +   D QG+  G+V
Sbjct: 61  TLLTFKDYTDINQVLPFKGKKLQVTETALQP--LDEGSYYYKDIIGLTVIDEQGQTLGKV 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTT 173
             + + G   +  I  + +   L+PF K  V  ++L +    +      +++  
Sbjct: 119 NEILSPGPNDVWVIPRSGKSDILLPFLKSVVQSIDLDQKVAHVIVPEGLIDDAD 172


>gi|317968417|ref|ZP_07969807.1| 16S rRNA-processing protein RimM [Synechococcus sp. CB0205]
          Length = 198

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 44/196 (22%), Positives = 75/196 (38%), Gaps = 18/196 (9%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS-----------NDNRELR 49
           M +  +L+++  I    GL GE+ ++  ++ P    +                 + RE++
Sbjct: 6   MEQQPELLVVGKIVAAQGLRGELRVNPLSDFPERFTQAGPRWLRAPAQKRGPAPEPREIQ 65

Query: 50  ILKMYRK--NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEME 107
           +L   R    + F+    GID+  SA      +L          +L + EF   DL  +E
Sbjct: 66  LLSGRRLPGKELFVIRIEGIDDRSSAEACVGQELLVPSDQRP--KLSKGEFHLLDLMGLE 123

Query: 108 TF-DRQGKYWGQVCGVYNFGAGSILEIKNTMEKT-FLIPFTKFAVLEVNLQENKILIDPI 165
                 G   GQV  + + G   +LE++ + +K    IPF +  V  V L+E  I I P 
Sbjct: 124 VRLLETGTPIGQVQDLLHAG-NDLLEVQLSGKKQPLWIPFVESIVPRVELEEGWIGITPP 182

Query: 166 AAGLNNTTMKNPQYDC 181
              L            
Sbjct: 183 PGLLELADPSPRDGQS 198


>gi|88706919|ref|ZP_01104618.1| 16S rRNA processing protein rimM [Congregibacter litoralis KT71]
 gi|88698841|gb|EAQ95961.1| 16S rRNA processing protein rimM [Congregibacter litoralis KT71]
          Length = 179

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 31/171 (18%), Positives = 75/171 (43%), Gaps = 14/171 (8%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYV----LYSNDNRELRILKMYRKNKRF 60
           ++++L   I   +G+ G V +  + + P +   +     L       + ++    + K +
Sbjct: 6   NQMLLAGKITGAYGIKGWVKVQVFTDPPDNFFAFRHHQVLRRGQLETIELVDGRSQGKGW 65

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY---WG 117
           +A   G+DN   A  LR  +++  + +     L  DE++   L+ ++ +   G+     G
Sbjct: 66  VARVVGVDNRTDAELLRGTEIWVPQSELP--VLASDEYYWHQLQGLQVWCEHGEQRLLLG 123

Query: 118 QVCGVYNFGAGSILEIKNTME----KTFLIPFTKF-AVLEVNLQENKILID 163
           +V  +   GA  +L ++++      +  LIP+     VL V+ +   + ++
Sbjct: 124 EVDHLLETGANDVLVLRSSEGSIDERERLIPYLPDSVVLAVDTEAGTMTVN 174


>gi|168184652|ref|ZP_02619316.1| 16S rRNA processing protein RimM [Clostridium botulinum Bf]
 gi|237795882|ref|YP_002863434.1| 16S rRNA-processing protein RimM [Clostridium botulinum Ba4 str.
           657]
 gi|182672310|gb|EDT84271.1| 16S rRNA processing protein RimM [Clostridium botulinum Bf]
 gi|229261722|gb|ACQ52755.1| 16S rRNA processing protein RimM [Clostridium botulinum Ba4 str.
           657]
          Length = 164

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 39/163 (23%), Positives = 73/163 (44%), Gaps = 4/163 (2%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIAT 63
           + + + +  I  THG+ GEV +    ++     +      D  E +IL    +    +  
Sbjct: 1   MKEFLAVGEIINTHGIKGEVKVFPLTDDMKRFKKLKEVFIDGEERKILSCKLQPNNVVLK 60

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
             GID+I  A++ R   L  KR++    +L +  +F  DL E    D +G+  GQ+  V 
Sbjct: 61  IEGIDSIEEANKYRKKLLEIKREN--SIKLPKGSYFIADLIECRVIDEKGREIGQISDVI 118

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIA 166
             G+  + E+K   +   L+P  K  V  ++++   + I P+ 
Sbjct: 119 KTGSNDVYEVK--GKSEVLVPAIKDIVTNIDIENKTVTIKPLE 159


>gi|313637368|gb|EFS02847.1| 16S rRNA processing protein RimM [Listeria seeligeri FSL S4-171]
          Length = 172

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 36/174 (20%), Positives = 74/174 (42%), Gaps = 9/174 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-------YVLYSNDNRELRILKMYRK 56
           ++K+  +  I  THGL GE+ + +  +   +  +       +   S    +L I    + 
Sbjct: 1   MEKMYNVGKIVNTHGLIGEIRVIATTDFADERFQVGNTVXLFEKNSKKPEKLIIRSHRKH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
               +  F G   IH    +++  L    +     +LEE+E++  ++         G+  
Sbjct: 61  KNFDLLMFEGFTGIHQVERMKEGTLKITEKQL--TDLEENEYYFHEIIGCTVVTTDGEEL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           G++  +   GA  +  +K    K  LIP+ +  V E+N+ + KI I+ +   L+
Sbjct: 119 GEITEILTPGANDVWVVKGKDNKEKLIPYIEEVVKEINISDKKITIEVMEGLLD 172


>gi|183981814|ref|YP_001850105.1| 16S rRNA processing protein RimM [Mycobacterium marinum M]
 gi|238689244|sp|B2HJL4|RIMM_MYCMM RecName: Full=Ribosome maturation factor rimM
 gi|183175140|gb|ACC40250.1| 16S rRNA processing protein RimM [Mycobacterium marinum M]
          Length = 174

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 35/171 (20%), Positives = 66/171 (38%), Gaps = 10/171 (5%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLN--------RYVLYSNDNRELRILKMYRKNKR 59
           +++  +   HG+ GEV ++   + P            +        R   I  +     R
Sbjct: 3   LVIGRVVKAHGITGEVVVEIRTDEPDRRFTPGASLRAKRSRDGGTGRNYVIEGVREHGAR 62

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +   +G+++  +A  LR         D    +  +  +++  LE +      G+  G V
Sbjct: 63  LLVRLAGVNDRDTADGLRGSLFVIDSADLPPIDEPDT-YYDHQLEGLRVRTTAGQDVGVV 121

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
             V + GAG +L +K       L+PF    V  V+L +  + IDP    L+
Sbjct: 122 AEVLHTGAGELLAVKCDSG-EVLVPFVGAIVTSVSLDDRILEIDPPDGLLD 171


>gi|194288940|ref|YP_002004847.1| 16S rRNA-processing protein rimm [Cupriavidus taiwanensis LMG
           19424]
 gi|209573574|sp|B3R397|RIMM_CUPTR RecName: Full=Ribosome maturation factor rimM
 gi|193222775|emb|CAQ68778.1| 16S rRNA PROCESSING PROTEIN [Cupriavidus taiwanensis LMG 19424]
          Length = 207

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 43/179 (24%), Positives = 82/179 (45%), Gaps = 22/179 (12%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLN---RYVLYS-------------NDNREL 48
           + LV +  +G  +G+ G + +  +A++   L    R+ L S             +    +
Sbjct: 26  EDLVEVGYVGAAYGIRGWIKVQPHADDASALLHARRWWLLSPPQAGLVAADAARSQPVCV 85

Query: 49  RILKMYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMET 108
           +I +    +   +A  +G+ + + A  LR  +++ +R DF     +EDEF+  DL     
Sbjct: 86  KIAQSREHSGTVVAQAAGVADRNLAEALRGRRVWIRRADFPAP--DEDEFYWVDLIGCNV 143

Query: 109 FDRQGKYWGQVCGVYNFGAGSILEIK--NTMEK--TFLIPFTKFAVLEVNLQENKILID 163
            + QG+  G+V G+ + GA  IL++       K    LIPF    + EV+    +I++D
Sbjct: 144 SNEQGELLGEVSGLIDNGAHQILQVAFVQPDGKAGERLIPFVDAFLREVDTAGKRIVVD 202


>gi|51595185|ref|YP_069376.1| 16S rRNA-processing protein RimM [Yersinia pseudotuberculosis IP
           32953]
 gi|153949535|ref|YP_001402184.1| 16S rRNA-processing protein RimM [Yersinia pseudotuberculosis IP
           31758]
 gi|186894200|ref|YP_001871312.1| 16S rRNA-processing protein RimM [Yersinia pseudotuberculosis
           PB1/+]
 gi|59798664|sp|Q66E58|RIMM_YERPS RecName: Full=Ribosome maturation factor rimM
 gi|166985979|sp|A7FLQ6|RIMM_YERP3 RecName: Full=Ribosome maturation factor rimM
 gi|238691407|sp|B2K5Y9|RIMM_YERPB RecName: Full=Ribosome maturation factor rimM
 gi|51588467|emb|CAH20075.1| 16S rRNA processing protein [Yersinia pseudotuberculosis IP 32953]
 gi|152961030|gb|ABS48491.1| 16S rRNA processing protein RimM [Yersinia pseudotuberculosis IP
           31758]
 gi|186697226|gb|ACC87855.1| 16S rRNA processing protein RimM [Yersinia pseudotuberculosis
           PB1/+]
          Length = 182

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 33/183 (18%), Positives = 78/183 (42%), Gaps = 18/183 (9%)

Query: 1   MVKL------DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRI 50
           M K       D+ +++  +G+T+G+ G + + S   N   +  Y  +        + + +
Sbjct: 1   MSKQLNPAVPDQPIVLGKMGSTYGIRGWLRVFSSTENAESIFDYQPWFIQQAGKWQHVEL 60

Query: 51  LKMYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFD 110
               R ++  I    G+D+  +A+ L + +++          LEED+++  DL   +   
Sbjct: 61  EDWKRHSQDLIIKVKGVDDRDAANLLTNCEIFVDSTQLPA--LEEDDYYWKDLMGCQVVT 118

Query: 111 RQGKYWGQVCGVYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILIDP 164
             G   G++  +   G+  ++ +K  ++     K  L+PF     + +V+L   ++ +D 
Sbjct: 119 TTGYELGKIIDMMETGSNDVMVVKANLKDAFGMKERLVPFLHGQVIKKVDLTAQRVEVDW 178

Query: 165 IAA 167
              
Sbjct: 179 DPG 181


>gi|319409397|emb|CBI83041.1| Ribosome maturation factor rimM [Bartonella schoenbuchensis R1]
          Length = 179

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 61/163 (37%), Positives = 86/163 (52%), Gaps = 2/163 (1%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYRKNKRFIATFSG 66
           + +A IG  HG+ G+V++      P  L  Y VLY    R   I     +    I  F G
Sbjct: 12  ICLAIIGAAHGIRGDVWVKVLGGEPERLKAYGVLYDKGGRCYEIATFRVQKNDAIVRFKG 71

Query: 67  IDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFG 126
           ++   +A  L+ + LY KR    D+ L EDEF+  DL  +  +D   K  G+V G +NFG
Sbjct: 72  VEERSAAEALKGINLYIKRDQLLDD-LAEDEFYQIDLIGLCVYDDADKRLGEVSGFFNFG 130

Query: 127 AGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           AG +LEI     K  LIPF+K AV E+ +    I+I+P+AAGL
Sbjct: 131 AGDLLEICLDGGKRELIPFSKAAVPEICVASGFIVINPVAAGL 173


>gi|294664961|ref|ZP_06730273.1| 16S rRNA-processing protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|292605268|gb|EFF48607.1| 16S rRNA-processing protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 170

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 34/169 (20%), Positives = 78/169 (46%), Gaps = 10/169 (5%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY-----SNDNRELRILKMYR 55
           M + ++ +L+  I    G+ GE+ ++S+      + RY  +     S     +  ++   
Sbjct: 1   MKQTERRILLGRIVGAFGVKGELKLESWTEPRTAIFRYQPWIVRTPSGQESGVSGVRGRD 60

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
           + K  IA F G+ +  +   +   ++Y  R      + +E  ++  DLEE++    +G  
Sbjct: 61  QGKNLIAVFPGVTDRDTVEAMHGTEIYVARSALPPPKPDE--YYWVDLEELQVETVEGVK 118

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFT-KFAVLEVNLQENKILID 163
            G V  +++ G+  ++ ++   ++  +IPF     V  V+ + N I++D
Sbjct: 119 LGTVSHLFSTGSNDVVVVR--GDRERMIPFVFPDFVKSVDFEANLIVVD 165


>gi|259047125|ref|ZP_05737526.1| 16S rRNA processing protein RimM [Granulicatella adiacens ATCC
           49175]
 gi|259036175|gb|EEW37430.1| 16S rRNA processing protein RimM [Granulicatella adiacens ATCC
           49175]
          Length = 171

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 38/173 (21%), Positives = 74/173 (42%), Gaps = 8/173 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVL---YSNDNRELRILKM---YRKN 57
           +     +  I  T GL GEV + S  +   +  +         D   L  + +    R  
Sbjct: 1   MTTFYKVGKIVNTQGLRGEVRVISTTDFAEERYKKGTELAIFKDGEFLTFVTVASHRRHK 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              + TF G++ I    + ++  L    +     ELE+DEF+  ++  +E    +G+  G
Sbjct: 61  NFDLLTFEGMNRIEDVEKYKECLLKVAEEQL--TELEDDEFYYHEIIGLEIVTDEGEVLG 118

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           +V  + + G+  +  +K   +K  LIPF +  V +V+ +E K  I  +   ++
Sbjct: 119 KVTEILSPGSNDVWVVKQKGKKELLIPFIEPVVYKVDKEEKKAYIHLLEGLID 171


>gi|21242046|ref|NP_641628.1| 16S rRNA-processing protein RimM [Xanthomonas axonopodis pv. citri
           str. 306]
 gi|24418649|sp|Q8PMY2|RIMM_XANAC RecName: Full=Ribosome maturation factor rimM
 gi|21107448|gb|AAM36164.1| 16S rRNA processing protein RimM [Xanthomonas axonopodis pv. citri
           str. 306]
          Length = 170

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 34/169 (20%), Positives = 78/169 (46%), Gaps = 10/169 (5%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY-----SNDNRELRILKMYR 55
           M + ++ +L+  I    G+ GE+ ++S+      + RY  +     S     +  ++   
Sbjct: 1   MKQNERRILLGRIVGAFGVKGELKLESWTEPRTAIFRYQPWIVRSPSGQESVVSGVRGRD 60

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
           + K  IA F G+ +  +   +   ++Y  R      + +E  ++  DLEE++    +G  
Sbjct: 61  QGKNLIAVFPGVTDRDTVEAMHGTEIYVARSALPPPKPDE--YYWVDLEELQVETVEGVK 118

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFT-KFAVLEVNLQENKILID 163
            G V  +++ G+  ++ ++   ++  +IPF     V  V+ + N I++D
Sbjct: 119 LGTVSHLFSTGSNDVVVVR--GDRERMIPFVFPDFVKSVDFEANLIVVD 165


>gi|325919892|ref|ZP_08181881.1| 16S rRNA processing protein RimM [Xanthomonas gardneri ATCC 19865]
 gi|325549601|gb|EGD20466.1| 16S rRNA processing protein RimM [Xanthomonas gardneri ATCC 19865]
          Length = 170

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 34/169 (20%), Positives = 79/169 (46%), Gaps = 10/169 (5%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY-----SNDNRELRILKMYR 55
           M + ++ +L+  +    G+ GE+ I+S+      + RY  +     S +   L   +   
Sbjct: 1   MKQTERRILLGRVAGAFGVKGELKIESWTEPRSAIFRYQPWILRTPSGEESTLSGARGRD 60

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
           + K  +ATF  + +  +   +  +++Y  R      + +E  ++  DLEE++    +G  
Sbjct: 61  QGKHLVATFPSVSDRDTVEAMHGIEIYVSRSVLPPPKPDE--YYWVDLEELQVETVEGVK 118

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFT-KFAVLEVNLQENKILID 163
            G V  +++ G+  ++ ++   ++  L+PF     V  V+ + N I++D
Sbjct: 119 LGTVSHLFSTGSNDVMVVR--GDRERLVPFVLPDFVKSVDFEANLIVVD 165


>gi|259909408|ref|YP_002649764.1| 16S rRNA-processing protein RimM [Erwinia pyrifoliae Ep1/96]
 gi|224965030|emb|CAX56561.1| 16S rRNA-processing protein [Erwinia pyrifoliae Ep1/96]
          Length = 182

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 30/170 (17%), Positives = 70/170 (41%), Gaps = 12/170 (7%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRFIAT 63
           +++  +G+ +G+ G + + S   +   +  Y  +        + + +    R N+  I  
Sbjct: 14  LILGKMGSAYGIRGWLKVFSSTEDAESIFDYQPWFIQRAGQWQLVELEGWKRHNQDMIIK 73

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
             GID+  +A  L + ++    +   +  L+  +++  DL   +    +G   G+V  + 
Sbjct: 74  VKGIDDRDAAGLLTNCEIVVDSEQLPE--LDNGDYYWKDLMGCQVVTVEGYELGKVIDMM 131

Query: 124 NFGAGSILEIKNTME-----KTFLIPFTKF-AVLEVNLQENKILIDPIAA 167
             G+  +L +K  ++     +  LIPF     +  V+L    I +D    
Sbjct: 132 ETGSNDVLVVKANLKDAFGAQERLIPFLDEQVIKNVDLTTRTIKVDWDPG 181


>gi|146312730|ref|YP_001177804.1| 16S rRNA-processing protein RimM [Enterobacter sp. 638]
 gi|172045968|sp|A4WDH3|RIMM_ENT38 RecName: Full=Ribosome maturation factor rimM
 gi|145319606|gb|ABP61753.1| 16S rRNA processing protein RimM [Enterobacter sp. 638]
          Length = 177

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 30/179 (16%), Positives = 71/179 (39%), Gaps = 15/179 (8%)

Query: 1   MVKLD--KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMY 54
           M      + +++  +G+ +G+ G + + S   +   +  Y  +         E+ +    
Sbjct: 1   MSNKAPVEPIVLGKMGSCYGIRGWLRVFSSTEDAESIFDYQPWFIQKGGKWEEVELESWR 60

Query: 55  RKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGK 114
           R N+  +    G+++  +A+ L + ++             +D ++  DL   +    +G 
Sbjct: 61  RHNQDIVIKLKGVEDRDAANLLTNCEIVVDSSQLPKL---DDGYYWKDLMGCQVVTTEGY 117

Query: 115 YWGQVCGVYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILIDPIAA 167
             G+V  +   G+  +L IK  ++     K  L+PF     + +V+L    I +D    
Sbjct: 118 ELGKVIDMMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLTTRTIEVDWDPG 176


>gi|261867111|ref|YP_003255033.1| 16S rRNA-processing protein RimM [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|261412443|gb|ACX81814.1| 16S rRNA processing protein RimM [Aggregatibacter
           actinomycetemcomitans D11S-1]
          Length = 175

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 33/172 (19%), Positives = 68/172 (39%), Gaps = 12/172 (6%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKN 57
           ++  ++  +  +G+T+G+ G + I S       +  Y  +        +          N
Sbjct: 1   MQQQRIETVGKLGSTYGIRGWLRIYSSTEQAESIFDYQPWFLKIKGQWQPTEPENWRHHN 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              I    G+D+  +A  L ++++      F   +L+E +++  DL      +  G   G
Sbjct: 61  HELIVKLKGVDDREAAQILANVEIGVDLSVFP--QLKEGDYYWHDLIGCTVVNLAGYAMG 118

Query: 118 QVCGVYNFGAGSILEIKNT-----MEKTFLIPFT-KFAVLEVNLQENKILID 163
            V  +   G+  +L +K        ++  LIPF  +  V  V+L    I +D
Sbjct: 119 TVTEMMETGSNDVLVVKANVKDAFGKQERLIPFLYEQVVKRVDLATKTITVD 170


>gi|153930923|ref|YP_001384621.1| 16S rRNA-processing protein RimM [Clostridium botulinum A str. ATCC
           19397]
 gi|153935028|ref|YP_001388138.1| 16S rRNA-processing protein RimM [Clostridium botulinum A str.
           Hall]
 gi|166226434|sp|A7FW10|RIMM_CLOB1 RecName: Full=Ribosome maturation factor rimM
 gi|152926967|gb|ABS32467.1| 16S rRNA processing protein RimM [Clostridium botulinum A str. ATCC
           19397]
 gi|152930942|gb|ABS36441.1| 16S rRNA processing protein RimM [Clostridium botulinum A str.
           Hall]
          Length = 164

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 39/163 (23%), Positives = 72/163 (44%), Gaps = 4/163 (2%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIAT 63
           + + + +  I  THG+ GEV +    ++     +      D  E +IL    +    +  
Sbjct: 1   MKEFLAVGEIINTHGIKGEVKVYPLTDDMKRFKKLKEVFIDGEEKKILSCKLQPNNVVLK 60

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
             GID+I  A++ R   L  KR++    +L +  +F  DL E    D  G+  GQ+  V 
Sbjct: 61  IEGIDSIEEANKYRKKLLEIKREN--SVKLPKGSYFIADLIECRVIDEDGREIGQISDVI 118

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIA 166
             G+  + E+K   +   L+P  K  V  ++++   + I P+ 
Sbjct: 119 KTGSNDVYEVK--GKSEVLVPAIKDIVTNIDIENKTVTIKPLE 159


>gi|154483573|ref|ZP_02026021.1| hypothetical protein EUBVEN_01277 [Eubacterium ventriosum ATCC
           27560]
 gi|149735483|gb|EDM51369.1| hypothetical protein EUBVEN_01277 [Eubacterium ventriosum ATCC
           27560]
          Length = 169

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 34/171 (19%), Positives = 69/171 (40%), Gaps = 6/171 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRE----LRILKMYRKNKR 59
           +++L  +  I  THG+ GEV +    +N    +       D  +    L +  +      
Sbjct: 1   MEELFRVGVISNTHGIRGEVKVYPTTDNVRRFDDLKEVILDTGKEQLNLHVTSVKYFKNM 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F   DNI+     + + L   R++     LEE E++  D+   +    + K  G +
Sbjct: 61  VILKFKEFDNINDIIPYKGMDLLVTREN--AIPLEEGEYYIADIIGSKVITDEDKILGTL 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
             V   GA  +  +K    K  L+P  +  +L+ +++   + +  +   L+
Sbjct: 119 TDVLQTGANDVYVVKTKDGKEVLLPSIEECILDRDIENKIVKVHIMKGLLD 169


>gi|330964076|gb|EGH64336.1| 16S rRNA-processing protein RimM [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 179

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 33/168 (19%), Positives = 82/168 (48%), Gaps = 11/168 (6%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND-----NRELRILKMYRKNKR 59
           D L+++  I + HG+ GEV + S+ +   +L  Y  ++        +++ ++    ++K 
Sbjct: 9   DDLIVIGKIYSVHGVRGEVKVYSFTDPIGNLLDYKTWTLRREGSVEKQVELVSGRLQSKF 68

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +     +D+   A  L   ++   R  F D  L++ E++   LE ++  D+ G+  G++
Sbjct: 69  LVVKLKDLDDREEARLLSGYEICVPRNLFPD--LDDGEYYWYQLEGLKVIDQLGQLLGKI 126

Query: 120 CGVYNFGAGSILEIKNT----MEKTFLIPFTKFAVLEVNLQENKILID 163
             +   G+  ++ +K       ++  L+P+T+  VL +N+   ++ ++
Sbjct: 127 DHLLETGSNDVMVVKPCAGSLDDRERLLPYTEQCVLAINMAAGEMKVE 174


>gi|330959142|gb|EGH59402.1| 16S rRNA-processing protein RimM [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 179

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 35/168 (20%), Positives = 82/168 (48%), Gaps = 11/168 (6%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND-----NRELRILKMYRKNKR 59
           D L+++  I + HG+ GEV + S+ +   +L  Y  ++        +++ ++    ++K 
Sbjct: 9   DDLIVIGKIYSVHGVRGEVKVYSFTDPIGNLLDYKTWTLRREGSVEKQVELVSGRLQSKF 68

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +    G+D+   A  L    +   R  F D  L++ E++   LE ++  D+ G+  G++
Sbjct: 69  LVTKLKGLDDREEARLLSGYDICVPRNLFPD--LDDGEYYWYQLEGLKVIDQLGQLLGKI 126

Query: 120 CGVYNFGAGSILEIKNT----MEKTFLIPFTKFAVLEVNLQENKILID 163
             +   G+  ++ +K       ++  L+P+T+  VL V++   ++ +D
Sbjct: 127 DHLLETGSNDVMVVKPCAGSLDDRERLLPYTEQCVLAVDMGAGEMKVD 174


>gi|300692087|ref|YP_003753082.1| 16S rRNA processing protein [Ralstonia solanacearum PSI07]
 gi|299079147|emb|CBJ51815.1| 16S rRNA processing protein [Ralstonia solanacearum PSI07]
          Length = 213

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 37/169 (21%), Positives = 69/169 (40%), Gaps = 12/169 (7%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSN----------DNRELRILKMY 54
           D LV +  +G  +G+ G + +    +    L+    +            D R L +    
Sbjct: 42  DDLVEVGYVGGAYGIRGWIKVQPLGDAEALLHASTWWLKPAAGAPAVPSDWRVLPVGTSR 101

Query: 55  RKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGK 114
             +   +A    + + + A  LR   ++ +R DF     +E  F+  DL      + Q +
Sbjct: 102 EHSGSVVAGSPAVPDRNVAEALRGCAVWVRRADFPAPADDE--FYWVDLIGSIVVNEQQE 159

Query: 115 YWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
             G V G+ + GA  IL I +      L+PF +  V  V++   +I++D
Sbjct: 160 TLGTVAGLIDNGAHQILRIVDEGGTERLVPFVEVYVKSVDVAGKRIVVD 208


>gi|212712911|ref|ZP_03321039.1| hypothetical protein PROVALCAL_04008 [Providencia alcalifaciens DSM
           30120]
 gi|212684456|gb|EEB43984.1| hypothetical protein PROVALCAL_04008 [Providencia alcalifaciens DSM
           30120]
          Length = 182

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 36/183 (19%), Positives = 72/183 (39%), Gaps = 18/183 (9%)

Query: 1   MVKLDKL------VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRI 50
           M K  KL      +++  +G  +G+ G + + S   +   +  Y  +        + + I
Sbjct: 1   MSKQTKLVPPSNPIVLGKLGAAYGIRGWLKVFSSTEHAESIFDYQPWFIQRSGQWQHIEI 60

Query: 51  LKMYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFD 110
                 NK  I    G+++  +A+ L + ++        D  L+ DE++  DL       
Sbjct: 61  EDWKHHNKDIIVKLKGVEDRDAAALLTNFEIAVDSTQLPD--LDNDEYYWKDLMGCHVVT 118

Query: 111 RQGKYWGQVCGVYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILIDP 164
            +G   G V  +   G+  +L IK  ++     K  L+PF     + +V+L    I ++ 
Sbjct: 119 SEGYDLGTVIDMMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLSTKIIEVEW 178

Query: 165 IAA 167
              
Sbjct: 179 DPG 181


>gi|218132455|ref|ZP_03461259.1| hypothetical protein BACPEC_00314 [Bacteroides pectinophilus ATCC
           43243]
 gi|217992565|gb|EEC58567.1| hypothetical protein BACPEC_00314 [Bacteroides pectinophilus ATCC
           43243]
          Length = 169

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 41/171 (23%), Positives = 73/171 (42%), Gaps = 6/171 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNR----ELRILKMYRKNKR 59
           +++ + +  I +THG+ GEV +    ++P   +       D +    +L I  +    + 
Sbjct: 1   MEQTLRVGVITSTHGIRGEVKVFPTTDDPKRFDYLEEVIVDMKREPVKLEIEGVKYFKQF 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F G DNI+   +     L   R++    ELE+ EFF  DL  ++    +G   G +
Sbjct: 61  VILKFKGYDNINDIQQFVKKDLLVTREN--AVELEDGEFFICDLVGLKVVTDEGVELGVL 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
             +   GA  +  +     K  LIP     +LE N +E  I +  +   L+
Sbjct: 119 KDIMQTGANDVYVVGMNDGKEVLIPSIPQCILEKNPEEGYIRVHLLKGLLD 169


>gi|240170572|ref|ZP_04749231.1| 16S rRNA-processing protein [Mycobacterium kansasii ATCC 12478]
          Length = 177

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 35/174 (20%), Positives = 67/174 (38%), Gaps = 12/174 (6%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY--------SNDNRELRILKMYRKNKR 59
           +++  +   HG+ GE+ ++   ++P +                   R   I  +     R
Sbjct: 3   LVVGRVVKAHGIGGELVVEIRTDDPDNRFAPGTLLRAKSSRDPGHERSYVIDSVRDHGAR 62

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +    G+ +  +A  LR         D    E E D +++  LE +      G+  G V
Sbjct: 63  LLVRLVGVTDRDAADALRGSVFVIDSDDLPPIE-EADTYYDHQLEGLRVRTATGQDVGVV 121

Query: 120 CGVYNFGAGSILEIKNTMEK---TFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
             V +  AG +L ++          L+PF +  V  V+L++  + IDP    L+
Sbjct: 122 AEVLHTAAGELLAVRPADGSQEGEVLVPFVRAIVTSVSLEDGVLQIDPPDGLLD 175


>gi|261346217|ref|ZP_05973861.1| 16S rRNA processing protein RimM [Providencia rustigianii DSM 4541]
 gi|282565523|gb|EFB71058.1| 16S rRNA processing protein RimM [Providencia rustigianii DSM 4541]
          Length = 182

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 31/172 (18%), Positives = 67/172 (38%), Gaps = 12/172 (6%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRFI 61
             +++  +G  +G+ G + + S   +   +  Y  +        + + I      NK  I
Sbjct: 12  NPIVLGKLGAAYGIRGWLKVFSSTEHAESIFDYQPWFIQRSGQWQHIEIEDWKHHNKDII 71

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               G+++  +A+ L + ++        +  LE +E++  DL         G   G V  
Sbjct: 72  VKLKGVEDRDAATLLTNFEIAVDSTQLPE--LENNEYYWKDLMGCHVVTLDGYDLGTVVD 129

Query: 122 VYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILIDPIAA 167
           +   G+  +L IK  ++     K  L+PF     + +V+L    I ++    
Sbjct: 130 MMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLSAQVIEVEWDPG 181


>gi|313623297|gb|EFR93533.1| 16S rRNA processing protein RimM [Listeria innocua FSL J1-023]
          Length = 172

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 39/174 (22%), Positives = 76/174 (43%), Gaps = 9/174 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-------YVLYSNDNRELRILKMYRK 56
           ++K+  +  I  THGL GE+ + +  + P +  +       +   S    +L I    + 
Sbjct: 1   MEKMYNVGKIVNTHGLIGEIRVIATTDFPEERFQVGNTVYLFEKNSKKPEKLIIRSHRKH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
               +  F G+  IH    +++  L  K       +LEE+EF+  ++         G+  
Sbjct: 61  KNFDLLMFEGLTGIHQVERMKEGVLKIKEAQL--TDLEENEFYFHEIIGCTVVTTDGEEL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           G++  +   GA  +  +K T +K  LIP+    V ++N  + KI I+ +   L+
Sbjct: 119 GEITEILTPGANDVWVVKGTDKKEKLIPYIADVVKDINTNDKKITIEVMEGLLD 172


>gi|57234665|ref|YP_181309.1| 16S rRNA processing protein RimM [Dehalococcoides ethenogenes 195]
 gi|109893011|sp|Q3Z8Z0|RIMM_DEHE1 RecName: Full=Ribosome maturation factor rimM
 gi|57225113|gb|AAW40170.1| 16S rRNA processing protein RimM [Dehalococcoides ethenogenes 195]
          Length = 167

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 39/170 (22%), Positives = 74/170 (43%), Gaps = 3/170 (1%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRF 60
           M + ++ +L+  +    G+NG + I+   + P   +             I +   +  + 
Sbjct: 1   MTQEEEYILIGKVLGVWGINGGLKIEVLTDFPERFDAGNELLIGRAPYTISQTSWQKAQV 60

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           I   S I  I +A EL   ++       K  +L +  +++  L  +E  D  G   GQ+ 
Sbjct: 61  IVHLSEITGIDAAEELSGAQVEIPAAALK--KLPKGVYYDFQLIGLEVTDLSGNRIGQIK 118

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
            + +  +  I  + +   K  LIP  K  V E+NLQ+ +++IDPI   L+
Sbjct: 119 EILHMPSNDIY-VSSYGAKEALIPAVKDVVKEINLQKGQVIIDPIPGLLD 167


>gi|254362950|ref|ZP_04979016.1| 16S rRNA processing protein RimM [Mannheimia haemolytica PHL213]
 gi|153094598|gb|EDN75412.1| 16S rRNA processing protein RimM [Mannheimia haemolytica PHL213]
          Length = 175

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 30/165 (18%), Positives = 68/165 (41%), Gaps = 12/165 (7%)

Query: 9   LMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRFIATF 64
           ++  +G+T+G+ G + + S       +  Y  +        +++ +      +   I   
Sbjct: 8   VVGKLGSTYGIRGWLRLYSSTEQTESIFDYQPWFLKIKGQWQQVELESWRYHSNDLIVKL 67

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
            G ++  +A  L + ++      F +  LEE +++  DL      + +G   G V  +  
Sbjct: 68  KGTEDREAAQLLTNAEIGVDLSVFPE--LEEGDYYWHDLIGCSVVNLEGYTMGTVAEMME 125

Query: 125 FGAGSILEIKNT-----MEKTFLIPFT-KFAVLEVNLQENKILID 163
            G+  +L ++N       ++  LIPF  +  V  V+L    I ++
Sbjct: 126 TGSNDVLVVRNNGKDAFGKQERLIPFLYEQVVKRVDLATKTITVE 170


>gi|16800973|ref|NP_471241.1| 16S rRNA-processing protein RimM [Listeria innocua Clip11262]
 gi|21362865|sp|Q92AL5|RIMM_LISIN RecName: Full=Ribosome maturation factor rimM
 gi|16414408|emb|CAC97137.1| lin1907 [Listeria innocua Clip11262]
          Length = 172

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 38/174 (21%), Positives = 75/174 (43%), Gaps = 9/174 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-------YVLYSNDNRELRILKMYRK 56
           ++K+  +  I  THGL GE+ + +  + P +  +       +   S    +L I    + 
Sbjct: 1   MEKMYNVGKIVNTHGLIGEIRVIATTDFPEERFQVGNTVYLFEKNSKKPEKLIIRSHRKH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
               +  F G+  IH    +++  L  K       +LEE+EF+  ++         G+  
Sbjct: 61  KNFDLLMFEGLTGIHQVERMKEGVLKIKEAQL--TDLEENEFYFHEIIGCTVVTTDGEEL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           G++  +   GA  +  +K   +K  LIP+    V ++N  + KI I+ +   L+
Sbjct: 119 GEITEILTPGANDVWVVKGADKKEKLIPYIADVVKDINTNDKKITIEVMEGLLD 172


>gi|261492746|ref|ZP_05989294.1| 16S rRNA processing protein RimM [Mannheimia haemolytica serotype
           A2 str. BOVINE]
 gi|261495640|ref|ZP_05992086.1| 16S rRNA processing protein RimM [Mannheimia haemolytica serotype
           A2 str. OVINE]
 gi|261308747|gb|EEY10004.1| 16S rRNA processing protein RimM [Mannheimia haemolytica serotype
           A2 str. OVINE]
 gi|261311599|gb|EEY12754.1| 16S rRNA processing protein RimM [Mannheimia haemolytica serotype
           A2 str. BOVINE]
          Length = 175

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 29/165 (17%), Positives = 67/165 (40%), Gaps = 12/165 (7%)

Query: 9   LMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRFIATF 64
           ++  +G+T+G+ G + + S       +  Y  +      + + + +      +   I   
Sbjct: 8   VVGKLGSTYGIRGWLRLYSSTEQSESIFDYQPWFLKIKGNWQPVELESWRYHSNDLIVKL 67

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
            G ++  +A  L + ++      F +  LEE +++  DL      + +G   G V  +  
Sbjct: 68  KGTEDREAAQLLTNAEIGVDLSVFPE--LEEGDYYWHDLIGCTVVNLEGYTMGTVTEMME 125

Query: 125 FGAGSILEIKNT-----MEKTFLIPFT-KFAVLEVNLQENKILID 163
            G+  +L ++        ++  LIPF  +  V  V+L    I ++
Sbjct: 126 TGSNDVLVVRANSKDAFGKQERLIPFLYEQVVKRVDLATKAITVE 170


>gi|239631959|ref|ZP_04674990.1| RimM protein [Lactobacillus paracasei subsp. paracasei 8700:2]
 gi|301066645|ref|YP_003788668.1| rimM protein, required for 16S rRNA processing [Lactobacillus casei
           str. Zhang]
 gi|239526424|gb|EEQ65425.1| RimM protein [Lactobacillus paracasei subsp. paracasei 8700:2]
 gi|300439052|gb|ADK18818.1| RimM protein, required for 16S rRNA processing [Lactobacillus casei
           str. Zhang]
          Length = 172

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 33/174 (18%), Positives = 68/174 (39%), Gaps = 6/174 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNRELRILKMYRKNKR 59
           +     + TI  THG+ GEV +    + P D  +      + ++    L I  +      
Sbjct: 1   MPDYYDIGTIVNTHGIRGEVRVLVTTDFPADRFKVGNIVYVATSPKTALTIQSVREHKGL 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            + TF    +I+     +  KL       +   L+E  ++  D+  +   D QG+  G+V
Sbjct: 61  TLLTFKDYTDINQVLPFKGKKLQVTETALQP--LDEGSYYYKDIIGLTVIDEQGQTLGKV 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTT 173
             + + G   +  I  + +   L+PF K  V  ++L +    +      +++  
Sbjct: 119 NEILSPGPNDVWVIPRSGKSDILLPFLKSVVQSIDLDQKVAHVIVPEGLIDDAD 172


>gi|325924837|ref|ZP_08186272.1| 16S rRNA processing protein RimM [Xanthomonas perforans 91-118]
 gi|325544767|gb|EGD16115.1| 16S rRNA processing protein RimM [Xanthomonas perforans 91-118]
          Length = 170

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 34/169 (20%), Positives = 77/169 (45%), Gaps = 10/169 (5%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY-----SNDNRELRILKMYR 55
           M + ++ +L+  I    G+ GE+ ++S+      + RY  +     S     +  ++   
Sbjct: 1   MKQTERRILLGRIVGAFGVKGELKLESWTEPRTAIFRYQPWIVRAPSGQESVVSGVRGRD 60

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
           + K  IA F G+ +  +   +   ++Y  R      + +E  ++  DLEE++    +G  
Sbjct: 61  QGKNLIAVFPGVTDRDTVEAMHGTEIYVARSALPPPKPDE--YYWVDLEELQVETVEGVK 118

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFT-KFAVLEVNLQENKILID 163
            G V  +++ G+  ++ ++   ++  +IPF     V  V+   N I++D
Sbjct: 119 LGTVSHLFSTGSNDVVVVR--GDRERMIPFVFPDFVKSVDFDANLIVVD 165


>gi|228475074|ref|ZP_04059802.1| 16S rRNA processing protein RimM [Staphylococcus hominis SK119]
 gi|228271059|gb|EEK12447.1| 16S rRNA processing protein RimM [Staphylococcus hominis SK119]
          Length = 166

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 42/168 (25%), Positives = 78/168 (46%), Gaps = 9/168 (5%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNR-----YVLYSNDNRELRILKMYRKNKRFIA 62
           V +  I  THG+ GE+ + S ++      +      V + ++  E+ I          + 
Sbjct: 3   VEVGQIVNTHGIKGEIKVKSNSDFTDTRFQPGEVLIVNHHHNEIEMTITSYRIHKGFHML 62

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F GI+NI+   + +   L+ +R   +D EL E+EF+ +D+     F+      G+V  +
Sbjct: 63  KFEGINNINDIEQYKGDYLFQERDH-EDIELNENEFYYSDIIGCTVFN-NDTPIGRVINI 120

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           +  GA  +  +K   +K +LIP+    V EV+++   I I P+   L 
Sbjct: 121 FETGANDVWVVK--GDKEYLIPYIADVVKEVDVEHKTICITPMEGLLE 166


>gi|134093875|ref|YP_001098950.1| 16S rRNA-processing protein RimM [Herminiimonas arsenicoxydans]
 gi|209573562|sp|A4G2T6|RIMM_HERAR RecName: Full=Ribosome maturation factor rimM
 gi|133737778|emb|CAL60823.1| 16S rRNA processing protein [Herminiimonas arsenicoxydans]
          Length = 177

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 43/174 (24%), Positives = 76/174 (43%), Gaps = 13/174 (7%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDL---NRYVLYSNDNRELRILKMYRKN 57
           M   + LVL+  I   +GLNG V +  Y+ +   L     + L   + R++ +++    +
Sbjct: 1   MKVPEDLVLVGYISGAYGLNGWVRVRPYSADADALLNAKTWWLDKPEFRDVAMMQSKIHS 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              +A   G+    +A  L+   +   R  F    L ++EF+  DL  +E  + QG   G
Sbjct: 61  GDVVAQLMGVAGRDAAEALKGATVQIPRSHFPA--LSDNEFYWVDLIGLEVENLQGVRLG 118

Query: 118 QVCGVYNFGAGSILEIK--------NTMEKTFLIPFTKFAVLEVNLQENKILID 163
           QV  + + GA  IL +             +  LIPF +  V+ ++    KI +D
Sbjct: 119 QVSDMMDNGAHPILRVAVPQTSEADPKAAQELLIPFVEQFVITIDQTAKKITVD 172


>gi|254522928|ref|ZP_05134983.1| 16S rRNA processing protein RimM [Stenotrophomonas sp. SKA14]
 gi|219720519|gb|EED39044.1| 16S rRNA processing protein RimM [Stenotrophomonas sp. SKA14]
          Length = 173

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 32/169 (18%), Positives = 78/169 (46%), Gaps = 10/169 (5%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY-----SNDNRELRILKMYR 55
           M  +++ +L+  +    G+ GE+ ++S+      + RY  +     S     +  ++   
Sbjct: 4   MKDIERRILLGRVVGAFGVRGEIKLESWTEPRSAIFRYQPWIVRSPSGVETTIEGVRGRD 63

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
             K  +A F G+++  +   +   ++Y  R      + +E  ++  DLE ++    +G  
Sbjct: 64  SGKHLVARFPGVEDRDTVEAMHGTEVYVARSALPPPKPDE--YYWVDLEGLDVKTTEGVA 121

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFT-KFAVLEVNLQENKILID 163
            GQV  +++ GA  ++ ++   ++  +IPF     V  V+ + N +++D
Sbjct: 122 LGQVSHLFSTGANDVVVVR--GDRERMIPFVQPDFVKSVDFEANLVVVD 168


>gi|325263006|ref|ZP_08129742.1| 16S rRNA processing protein RimM [Clostridium sp. D5]
 gi|324032100|gb|EGB93379.1| 16S rRNA processing protein RimM [Clostridium sp. D5]
          Length = 168

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 39/170 (22%), Positives = 77/170 (45%), Gaps = 7/170 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNR----ELRILKMYRKNKR 59
           +++ + +  I +THG+ GEV +    ++            D       + I  +    + 
Sbjct: 1   MEQFLQVGVISSTHGIRGEVKVFPTTDDAARFKSLKQVILDTGKEHIPMEIQGVKFFKQF 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F GIDNI+   + +  +L   R+D     LEEDE++  DL  M+ +  +G++ G +
Sbjct: 61  VIVKFKGIDNINDVEKYKGKRLLVDRED--AVSLEEDEYYIADLIGMKVYTEEGEF-GML 117

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
             V   GA  +  +++      LIP     +L+VN++E  + +  +   +
Sbjct: 118 KDVIETGANEVYVVESPDHGEVLIPAIHDCILDVNVEEQTMKVHLLEGLI 167


>gi|260101391|ref|ZP_05751628.1| 16S rRNA processing protein RimM [Lactobacillus helveticus DSM
           20075]
 gi|260084802|gb|EEW68922.1| 16S rRNA processing protein RimM [Lactobacillus helveticus DSM
           20075]
          Length = 184

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 41/172 (23%), Positives = 77/172 (44%), Gaps = 7/172 (4%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNR----YVLYSNDNRELRILKMYRKNKRFI 61
           +   +A I TTHGLNGEV ++   + P +         L S+ NR L + K     + ++
Sbjct: 15  EYFDVARILTTHGLNGEVKVNVITDFPEERFAEGMHLSLRSDTNRTLTVEKSRPFKQFWL 74

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMET-FDRQGKYWGQVC 120
             F  I +I  A +LR   L    +D    EL +  ++  D+ + +   +  GK  G++ 
Sbjct: 75  IQFKEITDIDQAEKLRGQILVVSEED--RGELPDGVYYYKDIFDCDVIDEETGKRIGKIV 132

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNT 172
            + + GA  I  ++    K + IP     V +V++   K+ ++ +    +  
Sbjct: 133 DIQSPGANDIWLVREDDGKEYWIPNIADVVKKVDVAAKKVYVELMEGLRDED 184


>gi|331269651|ref|YP_004396143.1| 16S rRNA processing protein RimM [Clostridium botulinum BKT015925]
 gi|329126201|gb|AEB76146.1| 16S rRNA processing protein RimM [Clostridium botulinum BKT015925]
          Length = 162

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 34/163 (20%), Positives = 69/163 (42%), Gaps = 4/163 (2%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIAT 63
           +++ + +  I  THGL GE+ +    ++            D   + I     +  + I  
Sbjct: 1   MEQFLAVGKIINTHGLKGEIKLLPSTDDVERFKELKKAYIDGEVIEIEGCKFQPGKVILK 60

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
              +D+I  A  L++  +   R+D    +L ED ++  D+     +D   +  G+V  + 
Sbjct: 61  IKDVDSIEQAQRLKNKYIKVTRED--AAKLPEDCYYEADIVGCTVYDENDEELGKVDEII 118

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIA 166
             G+  +  IK       LIP  K  ++ +++   KI+I P+ 
Sbjct: 119 RTGSNDVYWIKGKN--EVLIPAIKSVIVSIDVNSKKIVIKPLE 159


>gi|325914813|ref|ZP_08177148.1| 16S rRNA processing protein RimM [Xanthomonas vesicatoria ATCC
           35937]
 gi|325538904|gb|EGD10565.1| 16S rRNA processing protein RimM [Xanthomonas vesicatoria ATCC
           35937]
          Length = 170

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 33/169 (19%), Positives = 75/169 (44%), Gaps = 10/169 (5%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY-----SNDNRELRILKMYR 55
           M   ++ +L+  I    G+ GE+ ++S+      + RY  +     S     +  ++   
Sbjct: 1   MKPTERRILLGRIVGAFGVKGELKLESWTEPRSAIFRYQPWIVRSPSGQETVVSGVRGRD 60

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
           + K  IA F  + +  +   +   ++Y  R        +E  ++  DLEE++    +G  
Sbjct: 61  QGKNLIAVFPDVTDRDTVEAMHGTEIYVARSALPPPNPDE--YYWVDLEELQVETVEGVK 118

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFT-KFAVLEVNLQENKILID 163
            G V  +++ G+  ++ ++   ++  +IPF     V  V+ + N I++D
Sbjct: 119 LGTVSHLFSTGSNDVVVVR--GDRERMIPFVFPEFVKSVDFEANLIVVD 165


>gi|251793944|ref|YP_003008676.1| 16S rRNA-processing protein RimM [Aggregatibacter aphrophilus
           NJ8700]
 gi|247535343|gb|ACS98589.1| 16S rRNA processing protein RimM [Aggregatibacter aphrophilus
           NJ8700]
          Length = 175

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 34/172 (19%), Positives = 70/172 (40%), Gaps = 12/172 (6%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKN 57
           ++  ++  +  +G+T+G+ G + I S       +  Y  +        +   +      N
Sbjct: 1   MQQQRIETVGKLGSTYGIRGWLRIYSSTEQAESIFDYQPWFLKIKGQWQPTELENWRHHN 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              I    G+D+  +A  L ++++      F   +LEE +++  DL      + +G   G
Sbjct: 61  HELIVKLKGVDDREAAQILANVEIGVDLSVFP--QLEEGDYYWHDLIGCAVVNLEGYAMG 118

Query: 118 QVCGVYNFGAGSILEIKNT-----MEKTFLIPFT-KFAVLEVNLQENKILID 163
            V  +   G+  +L +K        ++  LIPF  +  V  V+L    I +D
Sbjct: 119 TVTEMMETGSNDVLVVKANVKDAFGKQERLIPFLYEQVVKRVDLATKTITVD 170


>gi|319406318|emb|CBI79955.1| Ribosome maturation factor rimM [Bartonella sp. AR 15-3]
          Length = 169

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 56/167 (33%), Positives = 92/167 (55%), Gaps = 2/167 (1%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND-NRELRILKMYRKNKRFIA 62
           + K V +A IG  HG+ G+V+I + +  P  L  Y ++ ++  R   ++    +    I 
Sbjct: 1   MKKKVYLAIIGAAHGIKGDVFIKALSTKPHSLKGYSVFYDETGRSYEVVTFRVQKNNAII 60

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F GI+   +A  LR +KLY +R    D+ L EDEF+  DL  +  ++   +  G+V G 
Sbjct: 61  HFKGIEERSAAEALRGIKLYVERSQLADD-LVEDEFYQIDLIGLCVYNCAKQLLGKVSGF 119

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           +NFGAG ++EI+    K  LI F+K  V ++ +    +++DPIAAGL
Sbjct: 120 FNFGAGDLMEIQLVSGKKVLISFSKAVVPKICVSSGFLIVDPIAAGL 166


>gi|90961609|ref|YP_535525.1| 16S rRNA processing protein [Lactobacillus salivarius UCC118]
 gi|227890696|ref|ZP_04008501.1| 16S rRNA processing protein [Lactobacillus salivarius ATCC 11741]
 gi|301299256|ref|ZP_07205542.1| 16S rRNA processing protein RimM [Lactobacillus salivarius
           ACS-116-V-Col5a]
 gi|122449137|sp|Q1WU93|RIMM_LACS1 RecName: Full=Ribosome maturation factor rimM
 gi|90820803|gb|ABD99442.1| 16S rRNA processing protein [Lactobacillus salivarius UCC118]
 gi|227867634|gb|EEJ75055.1| 16S rRNA processing protein [Lactobacillus salivarius ATCC 11741]
 gi|300214423|gb|ADJ78839.1| Ribosome maturation factor rimM [Lactobacillus salivarius CECT
           5713]
 gi|300853100|gb|EFK80698.1| 16S rRNA processing protein RimM [Lactobacillus salivarius
           ACS-116-V-Col5a]
          Length = 168

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 34/168 (20%), Positives = 71/168 (42%), Gaps = 7/168 (4%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-----YVLYSNDNRELRILKMYRKNKRF 60
               +  I  THG+ GE+ I S  + P D  +     Y+  +       I       +  
Sbjct: 2   NYYEVGKIVNTHGIKGELKIISKTDFPEDRFKPGNILYIRDNGKINSYEIKSHRTHKQFE 61

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           + TF G++NI+    L+   L    +    E L +  +++  +  ++ F     Y G + 
Sbjct: 62  MITFKGLENINLVENLKGKILEISEEQ--QENLSDGNYYHHQIIGLDVFSEDNNYIGVIK 119

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAG 168
            + + GA  +  +K       L+P  K  + +++L++NK++I+ +   
Sbjct: 120 EIMSPGANDVWVVKRKGSSDLLLPAIKDVIKKIDLEQNKVIIELLDGL 167


>gi|21957630|gb|AAM84479.1|AE013692_8 hypothetical protein y0895 [Yersinia pestis KIM 10]
 gi|45435105|gb|AAS60665.1| 16S rRNA processing protein [Yersinia pestis biovar Microtus str.
           91001]
          Length = 186

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 31/173 (17%), Positives = 75/173 (43%), Gaps = 12/173 (6%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRF 60
           D+ +++  +G+T+G+ G + + S   N   +  Y  +        + + +    R ++  
Sbjct: 15  DQPIVLGKMGSTYGIRGWLRVFSSTENAESIFDYQPWFIQQAGKWQHVELEDWKRHSQDL 74

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           I    G+D+  +A+ L + ++           LEED+++  DL   +     G   G++ 
Sbjct: 75  IIKVKGVDDREAANLLTNCEIIVDSTQLPA--LEEDDYYWKDLMGCQVVTTTGYELGKII 132

Query: 121 GVYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILIDPIAA 167
            +   G+  ++ +K  ++     K  L+PF     + +V+L   ++ +D    
Sbjct: 133 DMMETGSNDVMVVKANLKDAFGMKERLVPFLHGQVIKKVDLTAQRVEVDWDPG 185


>gi|59798656|sp|Q65VG2|RIMM_MANSM RecName: Full=Ribosome maturation factor rimM
 gi|52306548|gb|AAU37048.1| RimM protein [Mannheimia succiniciproducens MBEL55E]
          Length = 178

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 38/175 (21%), Positives = 74/175 (42%), Gaps = 14/175 (8%)

Query: 1   MVKLDK-LVL-MATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMY 54
           M K+D+  +  +  +G+T+G+ G + I S   N   +  Y  +     +  + + +    
Sbjct: 1   MNKMDRQRIETVGKLGSTYGIRGWLRIYSSTENAESIFDYQPWFLKIKDQWQAIELETWK 60

Query: 55  RKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGK 114
             N   I     I++  +A  L ++++      F    LEE +F+  DL   +  + QG 
Sbjct: 61  HHNHELIVKLKNINDRETAQTLANVEIGVDLSVFPA--LEEGDFYWHDLIGCQVVNLQGY 118

Query: 115 YWGQVCGVYNFGAGSILEIKNT-----MEKTFLIPFT-KFAVLEVNLQENKILID 163
             G V  +   G+  +L ++        ++  LIPF  +  V  V+L    I +D
Sbjct: 119 AMGTVSEMMETGSNDVLVVRANAKDAFGKQERLIPFLYEQVVKRVDLTTKTIEVD 173


>gi|56964055|ref|YP_175786.1| 16S rRNA processing protein [Bacillus clausii KSM-K16]
 gi|56910298|dbj|BAD64825.1| 16S rRNA processing protein [Bacillus clausii KSM-K16]
          Length = 190

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 30/175 (17%), Positives = 66/175 (37%), Gaps = 9/175 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSN-------DNRELRILKMYRK 56
           +     +  +  THG+ GEV + S  + P +                +   + +      
Sbjct: 18  MTNWYNVGRLVNTHGVRGEVRVLSNTDFPEERYANGSVLKVAKSPQAEGTLVTVRSHRTH 77

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
               + TF G ++I+     +   LY         EL+E E++  ++      D +G   
Sbjct: 78  KNFDLLTFEGYNSINEVECFKGSYLYVSEDQL--SELDEHEYYYHEIIGCTVVDEEGTKL 135

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN 171
           G++  +   GA  +  +     K  L+P+ +  V EV+++  +I +  +    + 
Sbjct: 136 GKIKDIIETGANDVWVVDRQQRKDLLLPYIEEVVKEVDVENKRIRVHIMEGLDDE 190


>gi|320530765|ref|ZP_08031809.1| 16S rRNA processing protein RimM [Selenomonas artemidis F0399]
 gi|320137052|gb|EFW28990.1| 16S rRNA processing protein RimM [Selenomonas artemidis F0399]
          Length = 175

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 36/172 (20%), Positives = 67/172 (38%), Gaps = 7/172 (4%)

Query: 1   MVKL-----DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYR 55
           M KL     +  +++  +G  HG+ G+V +    + P    R       +  L I++M  
Sbjct: 1   MTKLSPSAPEGRIVIGRVGAPHGIAGDVRVIPLTDFPERFARLREVVVGDELLHIVRMKE 60

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
           + K F+  F        A  L    L   R D     LEE E++  D+  +  +D+ G  
Sbjct: 61  QGKNFLMQFREYPVREEAQRLTGRLLTVARTD--AAPLEEGEYYVFDIVGLSVYDKAGTL 118

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAA 167
            G V  V   G+  +  ++    +  LIP     V  +++   ++ +     
Sbjct: 119 LGSVENVIRTGSNDVYAVRAEDGRELLIPALHSVVRNIDIAGGRMDVCLPDE 170


>gi|50122280|ref|YP_051447.1| 16S rRNA-processing protein RimM [Pectobacterium atrosepticum
           SCRI1043]
 gi|59798692|sp|Q6D1T9|RIMM_ERWCT RecName: Full=Ribosome maturation factor rimM
 gi|49612806|emb|CAG76256.1| 16S rRNA processing protein [Pectobacterium atrosepticum SCRI1043]
          Length = 182

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 33/172 (19%), Positives = 69/172 (40%), Gaps = 12/172 (6%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRFI 61
             ++M  IG+ +G+ G + + S   +   +  Y  +     +  + + I      N+  I
Sbjct: 12  NPIVMGKIGSAYGIRGWLRVFSSTEDADSIFDYQPWFIQSKSGWQLVEIEGWKYHNQDLI 71

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               G D+  +A+ L + ++        D  L   +++  DL   +     G   G++  
Sbjct: 72  IKVKGADDRDAANLLTNCEIVVDSSQLPD--LGVGDYYWKDLIGCQVVTVTGYELGKIID 129

Query: 122 VYNFGAGSILEIKNTME-----KTFLIPF-TKFAVLEVNLQENKILIDPIAA 167
           +   G+  ++ IK  ++     K  L+PF T+  V  V+L    I +D    
Sbjct: 130 MMETGSNDVMVIKANLKDAFGVKERLVPFLTEQVVKRVDLSAQTIEVDWDPG 181


>gi|15836713|ref|NP_297401.1| 16S rRNA-processing protein RimM [Xylella fastidiosa 9a5c]
 gi|71899241|ref|ZP_00681403.1| RimM protein:PRC-barrel [Xylella fastidiosa Ann-1]
 gi|14423900|sp|Q9PH38|RIMM_XYLFA RecName: Full=Ribosome maturation factor rimM
 gi|9104888|gb|AAF82921.1|AE003864_9 16S rRNA processing protein [Xylella fastidiosa 9a5c]
 gi|71730974|gb|EAO33043.1| RimM protein:PRC-barrel [Xylella fastidiosa Ann-1]
          Length = 170

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 41/169 (24%), Positives = 77/169 (45%), Gaps = 10/169 (5%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY-----SNDNRELRILKMYR 55
           M   ++ +L+  +    GL GE+ I+S+      + RY  +     +     L   + Y 
Sbjct: 1   MKDNERRILLGRVVGGFGLRGEIKIESWTEPRDAIFRYQPWLLRSPTGTESMLNGARGYE 60

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
             KR IATF GI++ ++   +   ++Y  R        +E  ++  DLE ++    +G  
Sbjct: 61  TGKRLIATFPGINDRNAVEAICGTEIYVPRSALPPPHPDE--YYWVDLEGLQVHTLEGVV 118

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFT-KFAVLEVNLQENKILID 163
            G V  +++ GA  ++ I    E+  LIPF     V  V+ +  +I++D
Sbjct: 119 LGSVSHLFSNGANDVIVIH--GERERLIPFVQPDYVKSVDFEAERIVVD 165


>gi|91794104|ref|YP_563755.1| 16S rRNA-processing protein [Shewanella denitrificans OS217]
 gi|122968557|sp|Q12KJ4|RIMM_SHEDO RecName: Full=Ribosome maturation factor rimM
 gi|91716106|gb|ABE56032.1| 16S rRNA processing protein RimM [Shewanella denitrificans OS217]
          Length = 176

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 37/173 (21%), Positives = 82/173 (47%), Gaps = 12/173 (6%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND----NRELRILKMYRK 56
           M    + V++  +G++HG+ G + I +Y ++   +  YV +        RE+++ +   +
Sbjct: 1   MSDNQQPVVLGKLGSSHGIKGWLKITAYTDSVEGIFDYVPWLIKDQGVWREVKVTQWRFQ 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
            K  +A   G+     A  L + ++    +  K+  L++++F++ DL   E  +  G   
Sbjct: 61  GKAVVAELEGVTTREQAQMLTNCEIAILPEQMKE--LDDNDFYHRDLIGCEVTNVNGYNL 118

Query: 117 GQVCGVYNFGAGSILEIKNT-----MEKTFLIPFT-KFAVLEVNLQENKILID 163
           G V  +   G+  +L +K        +   +IPF  +  + +V+LQ  +I++D
Sbjct: 119 GIVDQIVETGSNDVLLVKANAKDAFGKVERMIPFVTEQFIKQVDLQGKQIVVD 171


>gi|161507705|ref|YP_001577661.1| 16S rRNA-processing protein RimM [Lactobacillus helveticus DPC
           4571]
 gi|172048318|sp|A8YVT3|RIMM_LACH4 RecName: Full=Ribosome maturation factor rimM
 gi|160348694|gb|ABX27368.1| rRNA processing protein [Lactobacillus helveticus DPC 4571]
 gi|328465658|gb|EGF36875.1| 16S rRNA-processing protein RimM [Lactobacillus helveticus MTCC
           5463]
          Length = 171

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 41/172 (23%), Positives = 77/172 (44%), Gaps = 7/172 (4%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNR----YVLYSNDNRELRILKMYRKNKRFI 61
           +   +A I TTHGLNGEV ++   + P +         L S+ NR L + K     + ++
Sbjct: 2   EYFDVARILTTHGLNGEVKVNVITDFPEERFAEGMHLSLRSDTNRTLTVEKSRPFKQFWL 61

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMET-FDRQGKYWGQVC 120
             F  I +I  A +LR   L    +D    EL +  ++  D+ + +   +  GK  G++ 
Sbjct: 62  IQFKEITDIDQAEKLRGQILVVSEED--RGELPDGVYYYKDIFDCDVIDEETGKRIGKIV 119

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNT 172
            + + GA  I  ++    K + IP     V +V++   K+ ++ +    +  
Sbjct: 120 DIQSPGANDIWLVREDDGKEYWIPNIADVVKKVDVAAKKVYVELMEGLRDED 171


>gi|289435136|ref|YP_003465008.1| 16S rRNA processing protein [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|289171380|emb|CBH27924.1| 16S rRNA processing protein [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
          Length = 172

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 36/174 (20%), Positives = 73/174 (41%), Gaps = 9/174 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-------YVLYSNDNRELRILKMYRK 56
           ++K+  +  I  THGL GE+ + +  +   +  +       +   S    +L I    + 
Sbjct: 1   MEKMYNVGKIVNTHGLIGEIRVIATTDFADERFQVGNTVYLFEKNSKKPEKLIIRSHRKH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
               +  F G   IH    +++  L    +     +LEE+E++  ++         G+  
Sbjct: 61  KNFDLLMFEGFTGIHQVERMKEGTLKITEKQL--TDLEENEYYFHEIIGCIVVTTDGEEL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           G++  +   GA  +  +K    K  LIP+ +  V E+N+ + KI I  +   L+
Sbjct: 119 GEITEILTPGANDVWVVKGKDNKEKLIPYIEEVVKEINISDKKITIKVMEGLLD 172


>gi|170759832|ref|YP_001787758.1| 16S rRNA-processing protein RimM [Clostridium botulinum A3 str.
           Loch Maree]
 gi|169406821|gb|ACA55232.1| 16S rRNA processing protein RimM [Clostridium botulinum A3 str.
           Loch Maree]
          Length = 164

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 38/163 (23%), Positives = 71/163 (43%), Gaps = 4/163 (2%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIAT 63
           + + + +  I  THG+ GEV +    ++     +      D  + +IL    +    +  
Sbjct: 1   MKEFLAVGEIINTHGIKGEVKVYPLTDDMKRFKKLKEVLIDGEKRKILSCKLQPNNVVLK 60

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
             GID+I  A++ R   L  KR++    +L +  +F  DL      D  GK  GQ+  V 
Sbjct: 61  IEGIDSIEEANKYRKKLLEIKREN--SVKLPKGSYFIADLIGCRVIDEDGKEIGQISDVI 118

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIA 166
             G+  + E+K   +   L+P  K  V  ++++   + I P+ 
Sbjct: 119 KTGSNDVYEVK--GKSEVLVPAIKDIVTNIDIENKTVTIKPLE 159


>gi|257438678|ref|ZP_05614433.1| 16S rRNA processing protein RimM [Faecalibacterium prausnitzii
           A2-165]
 gi|257198907|gb|EEU97191.1| 16S rRNA processing protein RimM [Faecalibacterium prausnitzii
           A2-165]
          Length = 184

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 40/181 (22%), Positives = 74/181 (40%), Gaps = 7/181 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYAN---NPIDLNRYVLYSNDNRELRILKMYRKNKRF 60
           + K +    + TTHG+ GE+ ++ + +       + R        R  +I  +  + +  
Sbjct: 7   MQKYLEAGKVVTTHGVRGEMKLELWCDGVAFLKKVGRLYTTPQGGRCYKITSIRPQGQMA 66

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFD-RQGKYWGQV 119
           +    G+ ++ +A  LR    Y  R D     L   +++  DL   E  D   GK +G V
Sbjct: 67  LLQLEGVSDMDAARALRGQVFYFDRDD---ATLPAGKWYVADLIGCEVRDADTGKVYGVV 123

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQY 179
             V + GA  I  +K    K ++ P     + E N  E  +L+ PI   L++      + 
Sbjct: 124 TSVDHPGAQDIYTVKAPSGKEYMFPGVDAFLKERNPPEGYLLVTPIPGLLDDDFDSEREE 183

Query: 180 D 180
           +
Sbjct: 184 E 184


>gi|319786604|ref|YP_004146079.1| 16S rRNA processing protein RimM [Pseudoxanthomonas suwonensis
           11-1]
 gi|317465116|gb|ADV26848.1| 16S rRNA processing protein RimM [Pseudoxanthomonas suwonensis
           11-1]
          Length = 190

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 40/164 (24%), Positives = 73/164 (44%), Gaps = 10/164 (6%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY-----SNDNRELRILKMYRKNKRF 60
           K++L+  +    G+ G+V ++S+      + RY  +     +   RELR  K     K  
Sbjct: 26  KMILLGRVTGAFGVRGDVKVESWTEPRAQIFRYQPWILRAPNGAERELRGAKGRDTGKHV 85

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +AT  G D+  +A  LR  +++  R         E  ++  DLE ++    +G   G+V 
Sbjct: 86  VATLPGCDDRDAAEALRGTEIWVPRDVLPPPAPGE--YYWVDLEGLKVVTVEGVALGEVS 143

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFT-KFAVLEVNLQENKILID 163
            + + GA  +L ++   E+  +IPF     V  V+     I +D
Sbjct: 144 HLLSTGANDVLVVR--GERERMIPFVQPDYVTSVDFDTATITVD 185


>gi|213964701|ref|ZP_03392901.1| 16S rRNA processing protein RimM [Corynebacterium amycolatum SK46]
 gi|213952894|gb|EEB64276.1| 16S rRNA processing protein RimM [Corynebacterium amycolatum SK46]
          Length = 169

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 37/175 (21%), Positives = 73/175 (41%), Gaps = 13/175 (7%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-----YVLYSNDNRELRILKMYRK 56
           + +  +VL+  +   HG+ GEV +D+  ++P            + +    +L +      
Sbjct: 1   MSVADMVLIGRVIKPHGVRGEVVVDATTDDPEGRFAVGTTLLGVQAGREEQLTVKTARPH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
             R +  F  I   + A   R +K YA      +   E+++F++ +L  +      G   
Sbjct: 61  QGRLLVRFEEIPGRNEAERHRGMKFYA------EPVFEDEDFYDFELVGLHVVH-NGTDI 113

Query: 117 GQVCGVYNFGAGSILEIK-NTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           G+V  +    A  +LE+  +   +  LIP  +  V EV+L+ + + I P    L 
Sbjct: 114 GEVTSIVRAPAHRLLEVTLDAGGREVLIPLVEEIVPEVDLENSTVTITPPEGLLE 168


>gi|307132201|ref|YP_003884217.1| 16S rRNA processing protein [Dickeya dadantii 3937]
 gi|306529730|gb|ADM99660.1| 16S rRNA processing protein [Dickeya dadantii 3937]
          Length = 182

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 31/172 (18%), Positives = 72/172 (41%), Gaps = 12/172 (6%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND----NRELRILKMYRKNKRFI 61
             + +  +G+T+G+ G + + S   +   +  Y  +        + + I      N+  +
Sbjct: 12  NPITLGKMGSTYGIKGWLRVFSSTEDAESIFDYQPWFIRNKGLWQPIEIESWRHHNQDLV 71

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
                ID+  +A+ L + ++        +  L+E +++  DL   +     G   G+V  
Sbjct: 72  IKIKDIDDRDAANLLTNCEIVVDSAQLPE--LDEGDYYWKDLIGCDVVTIGGYELGKVID 129

Query: 122 VYNFGAGSILEIKNTME-----KTFLIPF-TKFAVLEVNLQENKILIDPIAA 167
           +   G+  +L ++  ++     K  LIPF T+  +  V+L  ++I +D    
Sbjct: 130 MMETGSNDVLVVRANLKDAYGVKERLIPFLTEQVIKHVDLSTHRIDVDWDPG 181


>gi|260913368|ref|ZP_05919849.1| 16S rRNA processing protein RimM [Pasteurella dagmatis ATCC 43325]
 gi|260632599|gb|EEX50769.1| 16S rRNA processing protein RimM [Pasteurella dagmatis ATCC 43325]
          Length = 177

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 33/174 (18%), Positives = 73/174 (41%), Gaps = 14/174 (8%)

Query: 2   VKLD-KLV-LMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYR 55
           + ++ + + ++  +G+T+G+ G + I S       +  Y  +        +   +     
Sbjct: 1   MNMESQRIEVVGKLGSTYGIRGWLRIYSSTEYAESIFDYQPWFLKIKGQWQPTELESWRY 60

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
            N   I    G+D+  +A  L ++++      F +  LEE +++  DL      + +G  
Sbjct: 61  HNNDLIVKLKGVDDREAAQTLANIEIGVDLAVFPE--LEEGDYYWHDLIGCNVVNLEGYS 118

Query: 116 WGQVCGVYNFGAGSILEIKNT-----MEKTFLIPFT-KFAVLEVNLQENKILID 163
            G V  +   G+  +L ++        ++  LIPF  +  V  V+L    I++D
Sbjct: 119 MGSVTEMMETGSNDVLVVRANAKDAFGKQERLIPFLYEQVVKRVDLNTKTIIVD 172


>gi|293390719|ref|ZP_06635053.1| 16S rRNA processing protein RimM [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|290951253|gb|EFE01372.1| 16S rRNA processing protein RimM [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 175

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 34/172 (19%), Positives = 68/172 (39%), Gaps = 12/172 (6%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKN 57
           ++  ++  +  +G+T+G+ G + I S       +  Y  +        R          N
Sbjct: 1   MQQQRIETVGKLGSTYGIRGWLRIYSSTEQAESIFDYQPWFLKIKGQWRPTEPENWRHHN 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              I    G+D+  +A  L ++++      F   +L+E +++  DL      +  G   G
Sbjct: 61  HELIVKLKGVDDREAAQILANVEIGVDLSVFP--QLKEGDYYWHDLIGCTVVNLAGYAMG 118

Query: 118 QVCGVYNFGAGSILEIKNT-----MEKTFLIPFT-KFAVLEVNLQENKILID 163
            V  +   G+  +L +K        ++  LIPF  +  V  V+L    I +D
Sbjct: 119 TVTEMMETGSNDVLVVKTNVKDAFGKQERLIPFLYEQVVKRVDLATKMITVD 170


>gi|87122823|ref|ZP_01078694.1| 16S rRNA processing protein RimM [Marinomonas sp. MED121]
 gi|86161875|gb|EAQ63169.1| 16S rRNA processing protein RimM [Marinomonas sp. MED121]
          Length = 181

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 32/168 (19%), Positives = 78/168 (46%), Gaps = 11/168 (6%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRF 60
           ++ + +  I + +G+ G V I S+ +    + +Y  +        + + + +   + +  
Sbjct: 11  EQPLAVGRITSVYGVKGWVKIYSHTDPIEGIFKYSHWWLKTRTGWQAIELNQGRLQGRGL 70

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +A   G  +     E+  + +Y + QD  D  L+E +++ + LE ++    +G   G+V 
Sbjct: 71  VAAVKGYTDRDLVKEICGMDIYIEAQDLPD--LDEGDYYWSQLEGLKVITEEGVLLGKVA 128

Query: 121 GVYNFGAGSILEIKNTME----KTFLIPFTKF-AVLEVNLQENKILID 163
            +   GA  +L ++        +  LIP+     VL V+L++ ++L++
Sbjct: 129 QMMETGANDVLVVRACEGSLDREERLIPYVPDMYVLNVDLKQGQMLVN 176


>gi|256847351|ref|ZP_05552797.1| 16S rRNA processing protein RimM [Lactobacillus coleohominis
           101-4-CHN]
 gi|256716015|gb|EEU30990.1| 16S rRNA processing protein RimM [Lactobacillus coleohominis
           101-4-CHN]
          Length = 171

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 28/172 (16%), Positives = 69/172 (40%), Gaps = 7/172 (4%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-----YVLYSNDNRELRILKMYRK 56
           +       +  I  THG+ GEV +    +   +  +      +  +++   + I K    
Sbjct: 1   MPKPNYYHVGKIVNTHGIRGEVRVVPITDFADERFKAGSQLVIEKNHEYIPVTIEKARPH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
               +  F G DNI+   + RD  L         +EL + E++   +  ++     G++ 
Sbjct: 61  KGMELVKFQGFDNINEVEKFRDCFLAVSGDQ--QDELADGEYYYHQIIGLDVVTVDGRHL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAG 168
           G++  + + GA  +  ++   +   L+P     + +V+L +  + ++ +   
Sbjct: 119 GKIKEIMSPGANDVWVVQRENQSDLLLPVINDVIKDVDLAKQVVTVELLEGL 170


>gi|59798128|sp|Q5WFN5|RIMM_BACSK RecName: Full=Ribosome maturation factor rimM
          Length = 173

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 30/175 (17%), Positives = 66/175 (37%), Gaps = 9/175 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSN-------DNRELRILKMYRK 56
           +     +  +  THG+ GEV + S  + P +                +   + +      
Sbjct: 1   MTNWYNVGRLVNTHGVRGEVRVLSNTDFPEERYANGSVLKVAKSPQAEGTLVTVRSHRTH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
               + TF G ++I+     +   LY         EL+E E++  ++      D +G   
Sbjct: 61  KNFDLLTFEGYNSINEVECFKGSYLYVSEDQL--SELDEHEYYYHEIIGCTVVDEEGTKL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN 171
           G++  +   GA  +  +     K  L+P+ +  V EV+++  +I +  +    + 
Sbjct: 119 GKIKDIIETGANDVWVVDRQQRKDLLLPYIEEVVKEVDVENKRIRVHIMEGLDDE 173


>gi|283782824|ref|YP_003373578.1| 16S rRNA processing protein RimM [Gardnerella vaginalis 409-05]
 gi|283441158|gb|ADB13624.1| 16S rRNA processing protein RimM [Gardnerella vaginalis 409-05]
          Length = 199

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 43/180 (23%), Positives = 75/180 (41%), Gaps = 17/180 (9%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR---YVLYSNDNRELRILKMYRKNKRFI 61
           + L+ +  IG   GL GEV +  + + P +       +  ++  RE  I        R+I
Sbjct: 18  NDLLRVCRIGKAQGLKGEVTVQIFTDEPYERFEPGNVLCTADGEREFVIENARTFKNRWI 77

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG---- 117
             F    N + A  L   +LY   +D ++   E   +   DL  ++    +    G    
Sbjct: 78  LLFEESQNRNDAEALNGTELYVHAEDAQELAAENAWYIK-DLVGLQARLCEENQLGLPAC 136

Query: 118 ---QVCGVYNFGAGSILEIK-----NTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
              +V  V + GA S+L+I+     +   KT L+PF +  V EV++    + IDP    +
Sbjct: 137 TIGKVVDVLD-GAQSLLKIRLNNPIDDDNKTALVPFVEALVPEVDVANGYLTIDPPGGLI 195


>gi|170077861|ref|YP_001734499.1| 16S rRNA processing protein RimM [Synechococcus sp. PCC 7002]
 gi|209573625|sp|B1XKY8|RIMM_SYNP2 RecName: Full=Ribosome maturation factor rimM
 gi|169885530|gb|ACA99243.1| 16S rRNA processing protein RimM [Synechococcus sp. PCC 7002]
          Length = 175

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 42/177 (23%), Positives = 75/177 (42%), Gaps = 11/177 (6%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLN-----RYVLYSNDNRELRILKMYRK 56
           +     +++  +    GL GEV I+   + P            L + D + + + +  + 
Sbjct: 1   MAEQDWIIIGQVVAAQGLKGEVRINPSTDFPERFEVPGQRWLQLPNQDPQSVELERGRQI 60

Query: 57  --NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGK 114
                F+  F  I +   A  +R  K+  +  D  +  LE DE+  +DL  +E FD   +
Sbjct: 61  PGKNLFVVKFEHIQDRTQAENIRGAKVLVRAGDRPE--LEADEYHVSDLIGLEVFDYNTQ 118

Query: 115 -YWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
              G V  +Y   A  +LE+ +  +K  L+PF K  V  V+L EN++ +D       
Sbjct: 119 AKLGIVSDLY-TAAQDVLEVTDANQKKHLVPFVKAIVPVVDLVENRLEVDAPPGLFE 174


>gi|187778961|ref|ZP_02995434.1| hypothetical protein CLOSPO_02556 [Clostridium sporogenes ATCC
           15579]
 gi|187772586|gb|EDU36388.1| hypothetical protein CLOSPO_02556 [Clostridium sporogenes ATCC
           15579]
          Length = 164

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 38/163 (23%), Positives = 73/163 (44%), Gaps = 4/163 (2%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIAT 63
           + + + +  I  THG+ GEV +    ++     +      D  E +I+    +    +  
Sbjct: 1   MKEFLAVGEIINTHGIKGEVKVYPLTDDMKRFKKLKEVFIDGEERKIVSCKLQPNNVVLK 60

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
             GID+I  A++ R   L  KR++    +L +  +F  DL E    D +G+  GQ+  V 
Sbjct: 61  IDGIDSIEEANKYRKKLLEIKREN--SVKLPKGSYFIADLMECRVIDEEGREIGQISDVI 118

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIA 166
             G+  + E+K   +   L+P  K  V  ++++   + I P+ 
Sbjct: 119 KTGSNDVYEVK--GKIEVLVPAIKDIVTNIDIENKTVTIKPLE 159


>gi|90407076|ref|ZP_01215265.1| 16S rRNA-processing protein [Psychromonas sp. CNPT3]
 gi|90311798|gb|EAS39894.1| 16S rRNA-processing protein [Psychromonas sp. CNPT3]
          Length = 175

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 39/173 (22%), Positives = 75/173 (43%), Gaps = 13/173 (7%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNRELRILKMYRK 56
           M  + + +++   G  HG+ G + I SY ++   + +Y    + Y+   +E+ I      
Sbjct: 1   MSNVAEPIVIGKFGAVHGIKGWLKIHSYTDDAESIFQYKPLLMKYNGVMQEVNITDWKAH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           +  F+A     D    +  L  ++L     +  D E +   F+  DL   +    +G + 
Sbjct: 61  SGTFVAKIKSFDVREESQALVGVELLVNINELPDLEDD---FYWRDLIGCQVETDKGYHL 117

Query: 117 GQVCGVYNFGAGSILEIKNT-----MEKTFLIPFTKF-AVLEVNLQENKILID 163
           G V  +   G+  +L +K        +K  LIPF K   VL+VN+    I+++
Sbjct: 118 GAVTDMMETGSKDVLVVKANANDAFGQKQRLIPFIKEQVVLDVNITGKLIIVN 170


>gi|144898176|emb|CAM75040.1| 16S rRNA-processing protein RimM [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 180

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 47/166 (28%), Positives = 82/166 (49%), Gaps = 4/166 (2%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND--NRELRILKMYRKNKR 59
           + +   V +  I   HG+ G V + S+  +P+D+  Y    ++   R  ++         
Sbjct: 1   MAVSARVCIGAIVGAHGVRGAVRVKSFTADPLDVVAYGPVEDEAGKRRFKLKVTGEAKGF 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +AT  G+++  +A  L+   LY  R    + E +E  F  TDL  +      G+  G V
Sbjct: 61  VLATLDGVNDRDAAEALKGTGLYVSRDRLPEVEEDE--FLYTDLVGLSALGLDGQVIGTV 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPI 165
            GV NFGAG +L+I    + + L+PFTK AV  V++ + ++++DP 
Sbjct: 119 KGVANFGAGDLLDIIRPGQGSLLVPFTKVAVPVVDMVKRQVVVDPP 164


>gi|81428332|ref|YP_395332.1| 16S rRNA processing protein, RimM [Lactobacillus sakei subsp. sakei
           23K]
 gi|109893021|sp|Q38XQ8|RIMM_LACSS RecName: Full=Ribosome maturation factor rimM
 gi|78609974|emb|CAI55021.1| 16S rRNA processing protein, RimM [Lactobacillus sakei subsp. sakei
           23K]
          Length = 176

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 34/175 (19%), Positives = 77/175 (44%), Gaps = 7/175 (4%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY-----SNDNRELRILKMYRKNKR 59
           +K   +  I  THG+ GEV + +  +   +  +   +      N    + +  M +  + 
Sbjct: 3   EKYYQVGKIVNTHGIRGEVRVIATTDFTEERFKKGTHLAVEMPNGLTPVTVSAMRQHKQF 62

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDR-QGKYWGQ 118
           ++  F G+ NI+     +   L     +  D++LE+DE++  D+  +E  +   G  +G+
Sbjct: 63  YLLQFEGLGNINDVELFKGHNLKIAASER-DDQLEDDEYYYGDIIGLEVIEESDGTSYGK 121

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTT 173
           V  + + G   +  IK       L+PF K  + +++++  K  ++     ++N  
Sbjct: 122 VSEIIDPGPNDVWVIKRRGRSDLLLPFLKSVIKKIDIEAGKAYVEVPEGLIDNED 176


>gi|146297157|ref|YP_001180928.1| 16S rRNA processing protein RimM [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|166226429|sp|A4XLF2|RIMM_CALS8 RecName: Full=Ribosome maturation factor rimM
 gi|145410733|gb|ABP67737.1| 16S rRNA processing protein RimM [Caldicellulosiruptor
           saccharolyticus DSM 8903]
          Length = 169

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 44/171 (25%), Positives = 82/171 (47%), Gaps = 6/171 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDN---RELRILKMYRKNKRF 60
           + K + +  I  T GL GEV +    ++P   +       ++   ++L I +   K+   
Sbjct: 1   MYKYLQVGKIVNTFGLKGEVKVIPLTDSPDRFSELNYVLLEDNLSQKLTIERYRVKDNIV 60

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           I  F  I +I  A +L++  L  +R+  + ++L ED +F  D+  +E +D  G+  G+V 
Sbjct: 61  IMKFREISSIDEALKLKNRFLVIERE--RAKKLPEDTYFICDIIGLEVYDLDGRKLGKVK 118

Query: 121 GVYNFGAGSILEIKNT-MEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
            V   G+  +   ++   +K  LIP  K  V EVN+++  + I  I   L+
Sbjct: 119 DVLQTGSNDVYICQSYIGKKDLLIPALKDIVKEVNIEQGYMKIKVIEGLLD 169


>gi|207725343|ref|YP_002255739.1| 16S rRNA processing protein RimM [Ralstonia solanacearum MolK2]
 gi|206590579|emb|CAQ37541.1| probable 16s rrna processing protein rimm [Ralstonia solanacearum
           MolK2]
          Length = 213

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 37/168 (22%), Positives = 70/168 (41%), Gaps = 12/168 (7%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----------SNDNRELRILKMYR 55
            LV +  +G  +G+ G + +  + +    L+    +          S+D R L +     
Sbjct: 43  DLVEVGYVGGAYGIRGWIKVQPHGDAEALLHAGTWWLKPAAGAPAVSSDWRVLPVGTSRE 102

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
            +   +A    + + + A  LR   ++  R DF     +E  F+  DL      + Q + 
Sbjct: 103 HSGSVVAGSPAVPDRNVAEALRGCAVWVSRADFPAPADDE--FYWVDLIGSAVVNEQQES 160

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
            G V G+ + GA  IL I +      L+PF +  V  V++   +I++D
Sbjct: 161 LGTVAGLLDNGAHQILRIVDEGGTERLVPFVEVYVKSVDVAGKRIVVD 208


>gi|28198019|ref|NP_778333.1| 16S rRNA-processing protein [Xylella fastidiosa Temecula1]
 gi|182680645|ref|YP_001828805.1| 16S rRNA-processing protein RimM [Xylella fastidiosa M23]
 gi|32129955|sp|Q87F55|RIMM_XYLFT RecName: Full=Ribosome maturation factor rimM
 gi|238691052|sp|B2I6A7|RIMM_XYLF2 RecName: Full=Ribosome maturation factor rimM
 gi|28056079|gb|AAO27982.1| 16S rRNA processing protein [Xylella fastidiosa Temecula1]
 gi|182630755|gb|ACB91531.1| 16S rRNA processing protein RimM [Xylella fastidiosa M23]
 gi|307579104|gb|ADN63073.1| 16S rRNA-processing protein RimM [Xylella fastidiosa subsp.
           fastidiosa GB514]
          Length = 170

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 41/169 (24%), Positives = 76/169 (44%), Gaps = 10/169 (5%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY-----SNDNRELRILKMYR 55
           M   ++ +L+  +    GL GE+ I+S+      + RY  +     +     L   + Y 
Sbjct: 1   MKDNERRILLGRVVGGFGLRGEIKIESWTEPRDAIFRYQPWLLRSPTGTESMLNGARGYE 60

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
             KR IATF GI++ +    +   ++Y  R        +E  ++  DLE ++    +G  
Sbjct: 61  TGKRLIATFPGINDRNGVEAICGTEIYVPRSALPPPHPDE--YYWVDLEGLQVHTLEGVV 118

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFT-KFAVLEVNLQENKILID 163
            G V  +++ GA  ++ I    E+  LIPF     V  V+ +  +I++D
Sbjct: 119 LGSVSHLFSNGANDVIVIH--GERERLIPFVQPDYVKSVDFEAERIVVD 165


>gi|207743715|ref|YP_002260107.1| 16s rrna processing protein rimm [Ralstonia solanacearum IPO1609]
 gi|206595114|emb|CAQ62041.1| probable 16s rrna processing protein rimm [Ralstonia solanacearum
           IPO1609]
          Length = 184

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 38/169 (22%), Positives = 71/169 (42%), Gaps = 12/169 (7%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----------SNDNRELRILKMY 54
           D LV +  +G  +G+ G + +  + +    L+    +          S+D R L +    
Sbjct: 13  DDLVEVGYVGGAYGIRGWIKVQPHGDAEALLHAGTWWLKPAAGAPAVSSDWRVLPVGTSR 72

Query: 55  RKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGK 114
             +   +A    + + + A  LR   ++  R DF     +E  F+  DL      + Q +
Sbjct: 73  EHSGSVVAGSPAVPDRNVAEALRGCAVWVSRADFPAPADDE--FYWVDLIGSAVVNEQQE 130

Query: 115 YWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
             G V G+ + GA  IL I +      L+PF +  V  V++   +I++D
Sbjct: 131 SLGTVAGLLDNGAHQILRIVDEGGTERLVPFVEVYVKSVDVAGKRIVVD 179


>gi|322806711|emb|CBZ04280.1| 16s rRNAprocessing protein RimM [Clostridium botulinum H04402 065]
          Length = 164

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 39/163 (23%), Positives = 71/163 (43%), Gaps = 4/163 (2%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIAT 63
           + + + +  I  THG+ GEV +    ++     +      D  E +IL    +    +  
Sbjct: 1   MKEFLAVGEIINTHGIKGEVKVYPLTDDMKRFKKLKEVFIDGEERKILSCKLQPNNVVLK 60

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
             GID+I  A++ R   L  KR++    +L +  +F  DL E    D  G+  GQ+  V 
Sbjct: 61  IEGIDSIEEANKYRKKLLEIKREN--SVKLPKGSYFIADLIECRVIDEDGREIGQISDVI 118

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIA 166
             G   + E+K   +   L+P  K  V  ++++   + I P+ 
Sbjct: 119 KTGNNDVYEVK--GKSEVLVPAIKDIVTNIDIESKTVTIKPLE 159


>gi|166713047|ref|ZP_02244254.1| 16S rRNA-processing protein [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 170

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 33/169 (19%), Positives = 78/169 (46%), Gaps = 10/169 (5%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY-----SNDNRELRILKMYR 55
           M + ++ +L+  +    G+ GE+ ++S+      + RY  +     S     +  ++   
Sbjct: 1   MKQTERRILLGRVVGAFGVKGELKLESWTEPRSAIFRYQPWIVRAPSGQESVISGVRGRD 60

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
           + K  IA F G+ +  +   +   ++Y  R      + +E  ++  DLEE++    +G  
Sbjct: 61  QGKNLIAVFPGVADRDTVEAMHGTEIYVARGALPPPKPDE--YYWVDLEELQVETVEGVK 118

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFT-KFAVLEVNLQENKILID 163
            G V  +++ G+  ++ ++   ++  +IPF     V  V+ + N I++D
Sbjct: 119 LGTVSHLFSTGSNDVVVVR--GDRERMIPFVFPDFVKSVDFEANLIVVD 165


>gi|33152926|ref|NP_874279.1| 16S rRNA-processing protein [Haemophilus ducreyi 35000HP]
 gi|38372435|sp|Q7VKG1|RIMM_HAEDU RecName: Full=Ribosome maturation factor rimM
 gi|33149151|gb|AAP96668.1| 16S rRNA processing protein RimM [Haemophilus ducreyi 35000HP]
          Length = 175

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 29/165 (17%), Positives = 66/165 (40%), Gaps = 12/165 (7%)

Query: 9   LMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRFIATF 64
           ++  +G+T+G+ G + + S       +  Y  +        + + +      +   I   
Sbjct: 8   VVGKLGSTYGIRGWLRLYSSTEKAESIFDYQPWFLKIKGQWQLIELESWRYHSNDLIVKL 67

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
            G ++  +A  L + ++      F   +L E++++  DL   +  + +    G V  +  
Sbjct: 68  KGTEDREAAQLLTNAEIGVDLSVFP--KLGEEDYYWHDLINCQVVNLENYTMGVVTELME 125

Query: 125 FGAGSILEIKNT-----MEKTFLIPFT-KFAVLEVNLQENKILID 163
            G+  +L ++        ++  LIPF  K  V  V+L    I +D
Sbjct: 126 TGSNDVLVVRANSKDAFGKQERLIPFLYKQVVKRVDLSTKTITVD 170


>gi|256824951|ref|YP_003148911.1| 16S rRNA processing protein RimM [Kytococcus sedentarius DSM 20547]
 gi|256688344|gb|ACV06146.1| 16S rRNA processing protein RimM [Kytococcus sedentarius DSM 20547]
          Length = 182

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 41/171 (23%), Positives = 68/171 (39%), Gaps = 8/171 (4%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDL----NRYVLYSNDNRELRILKMYRKNKRF 60
           + +V +A IG  H L GEV +  + + P               +   L I          
Sbjct: 14  EGMVRLARIGKPHALKGEVTVQLHTDEPEVRLAVGTAVQTVPAEEGPLTIASRRVHQGVT 73

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +  F  +     A  LR + L A   +    EL+ + F+  DL  +E  D QG+  G V 
Sbjct: 74  LLGFEQVTGRDGAEALRGVVLVAPADE----ELDGEGFYPEDLRGLEVVDGQGEPLGAVK 129

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN 171
            ++   A  +LE+  T     L+PF +  V  V+L+  ++ +   A  L  
Sbjct: 130 DLHLRPAQDLLEVTTTAGHDVLVPFVEELVPHVDLEAGQVTVTAPAGLLEP 180


>gi|153938104|ref|YP_001391744.1| 16S rRNA-processing protein RimM [Clostridium botulinum F str.
           Langeland]
 gi|170756645|ref|YP_001781989.1| 16S rRNA-processing protein RimM [Clostridium botulinum B1 str.
           Okra]
 gi|166226435|sp|A7GG34|RIMM_CLOBL RecName: Full=Ribosome maturation factor rimM
 gi|152934000|gb|ABS39498.1| 16S rRNA processing protein RimM [Clostridium botulinum F str.
           Langeland]
 gi|169121857|gb|ACA45693.1| 16S rRNA processing protein RimM [Clostridium botulinum B1 str.
           Okra]
 gi|295319769|gb|ADG00147.1| 16S rRNA processing protein RimM [Clostridium botulinum F str.
           230613]
          Length = 164

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 38/163 (23%), Positives = 71/163 (43%), Gaps = 4/163 (2%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIAT 63
           + + + +  I  THG+ GEV +    ++     +      D    +IL    +    +  
Sbjct: 1   MKEFLAVGEIINTHGIKGEVKVYPLTDDMKRFKKLKEVFIDGEGRKILSCKLQPNNVVLK 60

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
             GID+I  A++ R   L  KR++    +L +  +F  DL E    D  G+  GQ+  V 
Sbjct: 61  IEGIDSIEEANKYRKKLLEIKREN--SVKLPKGSYFIADLIECRVIDENGREIGQISDVI 118

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIA 166
             G+  + E+K   +   L+P  K  V  ++++   + I P+ 
Sbjct: 119 KTGSNDVYEVK--GKSEVLVPAIKDIVTNIDIENKTVTIKPLE 159


>gi|114330464|ref|YP_746686.1| 16S rRNA processing protein RimM [Nitrosomonas eutropha C91]
 gi|122314522|sp|Q0AIV0|RIMM_NITEC RecName: Full=Ribosome maturation factor rimM
 gi|114307478|gb|ABI58721.1| 16S rRNA processing protein RimM [Nitrosomonas eutropha C91]
          Length = 168

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 33/163 (20%), Positives = 71/163 (43%), Gaps = 6/163 (3%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS-----NDNRELRILKMYRKNKRFI 61
           +V++  +   HG+ G++ +  +  +   L  Y ++         + +        +   I
Sbjct: 1   MVVLGRVIGPHGIRGQIKVTPFTEHIDGLMEYPVWWLSNDEKSWQIVHPTSFSVHDSLLI 60

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDE-FFNTDLEEMETFDRQGKYWGQVC 120
            T     +  +AS L+   +   R        +  E ++ +DL  +   + QG++ G V 
Sbjct: 61  ITLEEYSDRTNASGLKGWLIAVPRSQLPQLSEDGKEGYYWSDLIGISVVNTQGEFIGTVA 120

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
           G++  GA  +L I+    K  LIPF    V +V+++  +I++D
Sbjct: 121 GLFETGANDVLRIQLPGGKEELIPFVDQVVRQVDMRSRQIMVD 163


>gi|21230657|ref|NP_636574.1| 16S rRNA-processing protein RimM [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66769348|ref|YP_244110.1| 16S rRNA-processing protein RimM [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|24418648|sp|Q8PBC2|RIMM_XANCP RecName: Full=Ribosome maturation factor rimM
 gi|81304695|sp|Q4US83|RIMM_XANC8 RecName: Full=Ribosome maturation factor rimM
 gi|21112243|gb|AAM40498.1| 16S rRNA processing protein RimM [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66574680|gb|AAY50090.1| 16S rRNA processing protein RimM [Xanthomonas campestris pv.
           campestris str. 8004]
          Length = 170

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 34/169 (20%), Positives = 75/169 (44%), Gaps = 10/169 (5%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY-----SNDNRELRILKMYR 55
           M   ++ +L+  I    G+ GE+ ++S+      + RY  +     S     L  ++   
Sbjct: 1   MKPTERRILLGRIVGAFGVKGELKLESWTEPRSAIFRYQPWIVRTPSGQESVLSGVRGRD 60

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
           + K  IA F  I +  +   +   ++Y  R      + +E  ++  DLE ++    +G  
Sbjct: 61  QGKNLIAVFPDITDRDTVEAMHGTEIYVARSALPPPKPDE--YYWVDLEGLQVETVEGVK 118

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFT-KFAVLEVNLQENKILID 163
            G V  +++ G+  ++ ++   ++  +IPF     V  V+ + N I++D
Sbjct: 119 LGTVSHLFSTGSNDVVVVR--GDRERMIPFVLPEYVKSVDFEANLIVVD 165


>gi|160943019|ref|ZP_02090257.1| hypothetical protein FAEPRAM212_00496 [Faecalibacterium prausnitzii
           M21/2]
 gi|158445713|gb|EDP22716.1| hypothetical protein FAEPRAM212_00496 [Faecalibacterium prausnitzii
           M21/2]
          Length = 178

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 40/181 (22%), Positives = 75/181 (41%), Gaps = 7/181 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYAN---NPIDLNRYVLYSNDNRELRILKMYRKNKRF 60
           + + +    + TTHG+ GE+ ++ + +       + R    +   +  +IL +  + +  
Sbjct: 1   MQQYLEAGKVVTTHGVRGEMKLELWCDGVDFLKKVGRLYPSAQGGKAYKILSIRPQGQMA 60

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFD-RQGKYWGQV 119
           +    G+ ++ +A  LR    Y  R D     L    ++  DL   E  D   GK +G V
Sbjct: 61  LLQLEGVSDMDAARALRGQVFYFDRND---ATLPAGRWYVADLIGCEVRDADTGKVYGVV 117

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQY 179
             V + GA  I  +K    K ++ P     + E N  E  IL+ PI   L++      + 
Sbjct: 118 TSVDHPGAQDIYTVKAPGGKEYMFPGVDAFLKERNPPEGYILVTPIPGLLDDDFDSEREE 177

Query: 180 D 180
           +
Sbjct: 178 E 178


>gi|25028513|ref|NP_738567.1| 16S rRNA-processing protein [Corynebacterium efficiens YS-314]
 gi|259507567|ref|ZP_05750467.1| 16S rRNA processing protein RimM [Corynebacterium efficiens YS-314]
 gi|46397692|sp|Q8FP33|RIMM_COREF RecName: Full=Ribosome maturation factor rimM
 gi|23493798|dbj|BAC18767.1| putative 16S rRNA processing protein [Corynebacterium efficiens
           YS-314]
 gi|259164841|gb|EEW49395.1| 16S rRNA processing protein RimM [Corynebacterium efficiens YS-314]
          Length = 169

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 43/168 (25%), Positives = 73/168 (43%), Gaps = 9/168 (5%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNR-----YVLYSNDNRELRILKMYRKNKRFIA 62
           + +  +  +HG+ GEV ++   ++P          +   +     L I        R + 
Sbjct: 5   LQIGRVIKSHGIRGEVVVEVTTDDPDIRYAPGEVLHGRQTGREHTLTIDTARAHQGRLLI 64

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F  I +  +A  LR  + +A   + +D   +E+ F++ +LE +      G   G V GV
Sbjct: 65  KFEEIPDRTAADSLRGTRFFAPPLERED---DEEGFYDHELEGLRIIH-DGADIGVVTGV 120

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
            +  AG ILE++ T  K  LIPF    V EV+L+     I P    L+
Sbjct: 121 MHGPAGEILEVELTSGKEVLIPFVHAIVPEVDLEAGTATITPPDGLLD 168


>gi|313884836|ref|ZP_07818588.1| 16S rRNA processing protein RimM [Eremococcus coleocola
           ACS-139-V-Col8]
 gi|312619527|gb|EFR30964.1| 16S rRNA processing protein RimM [Eremococcus coleocola
           ACS-139-V-Col8]
          Length = 175

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 32/176 (18%), Positives = 77/176 (43%), Gaps = 10/176 (5%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLN----RYVLYSNDNR--ELRILKMYRKNKR 59
           +   +  +  THG+ G++ + +  + P        +  +  +D    ++ +L   +    
Sbjct: 2   EYYRIGRVVNTHGIRGQIKVIADTDFPESRFASGNKLYILKDDQALAQVTVLDSRQAKGT 61

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
           +I +F   DNI+     +   L     +   EELE+D +++  +  +E    QG   G++
Sbjct: 62  YILSFEEFDNINQVEGFKGSWLAIDSSN--QEELEDDVYYHHQIIGLEVVTHQGLKLGKI 119

Query: 120 CGVYNFGAGSILEIKN--TMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTT 173
             +   G+  +  +K     +   LIP+    V EV+L++ +++I  +   +++  
Sbjct: 120 KEILQLGSNDVWVVKRHENNKADALIPYIDDVVKEVDLEKGQVIISLMEGLIDDED 175


>gi|295103454|emb|CBL00998.1| 16S rRNA processing protein RimM [Faecalibacterium prausnitzii
           SL3/3]
          Length = 178

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 41/181 (22%), Positives = 75/181 (41%), Gaps = 7/181 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYAN---NPIDLNRYVLYSNDNRELRILKMYRKNKRF 60
           + + +    + TTHG+ GE+ ++ + +       + R    +   +  +IL +  + +  
Sbjct: 1   MQQYLEAGKVVTTHGVRGEMKLELWCDGVDFLKKVGRLYPSAQGGKAYKILSIRPQGQMA 60

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFD-RQGKYWGQV 119
           +    GI ++ +A  LR    Y  R D     L    ++  DL   E  D   GK +G V
Sbjct: 61  LLQLEGISDMDAARALRGQVFYFDRND---ATLPAGRWYVADLIGCEVRDADTGKVYGVV 117

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQY 179
             V + GA  I  +K    K ++ P     + E N  E  IL+ PI   L++      + 
Sbjct: 118 TSVDHPGAQDIYTVKAPGGKEYMFPGVDAFLKERNPPEGYILVTPIPGLLDDDFDSEREE 177

Query: 180 D 180
           +
Sbjct: 178 E 178


>gi|291299690|ref|YP_003510968.1| 16S rRNA processing protein RimM [Stackebrandtia nassauensis DSM
           44728]
 gi|290568910|gb|ADD41875.1| 16S rRNA processing protein RimM [Stackebrandtia nassauensis DSM
           44728]
          Length = 169

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 30/168 (17%), Positives = 68/168 (40%), Gaps = 5/168 (2%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNR----YVLYSNDNRELRILKMYRKNKRFIA 62
            +++  I  +HG+ G++ ++   + P                   + + ++    +R + 
Sbjct: 2   KLVVGRIVRSHGVRGDLIVEVRTDEPEQRFAGGSVLHTDPPRFGPVTVERVRWYQERLLL 61

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
           T  G+ +  +A  +R + L    +D +  E  ++ F + DL  +   +  G   G V  V
Sbjct: 62  TLEGVADRDAAEAMRGVALTVDSEDVEVPEDPDE-FRDLDLVGLSVVEESGAEIGTVVRV 120

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
            +  A  +L +        LIPF +  V  V++   +I++      L+
Sbjct: 121 EHAPAHDLLVVDRPGANQALIPFIQAMVPTVDVAGGRIVVTLPEGLLD 168


>gi|82701704|ref|YP_411270.1| 16S rRNA processing protein RimM [Nitrosospira multiformis ATCC
           25196]
 gi|109893025|sp|Q2YBJ3|RIMM_NITMU RecName: Full=Ribosome maturation factor rimM
 gi|82409769|gb|ABB73878.1| 16S rRNA processing protein RimM [Nitrosospira multiformis ATCC
           25196]
          Length = 168

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 34/163 (20%), Positives = 74/163 (45%), Gaps = 6/163 (3%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS-----NDNRELRILKMYRKNKRFI 61
           +V+M  +   + + G + +  Y      L  Y  +          + ++++        +
Sbjct: 1   MVIMGRVAGPYAVAGWIKVFPYTEYVDGLLDYPDWWLGSEGGKWHKFKVIEGEVHGSVLL 60

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKD-EELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           A+     +  +A+ L+ LK+   R+      E  E+ ++ +DL  +   + QG+  G+V 
Sbjct: 61  ASLEQCADRDAAARLKGLKIAIPRRLLPALPESGEEGYYWSDLIGLAVINLQGEVLGKVA 120

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
           G+   GA  +L+++N  E   LIPF    +++V+L   +I +D
Sbjct: 121 GLLETGANDVLQVQNPEETERLIPFIDQVIIKVDLAAGRITVD 163


>gi|145600322|ref|YP_001164398.1| 16S rRNA-processing protein RimM [Yersinia pestis Pestoides F]
 gi|166226489|sp|A4TQ63|RIMM_YERPP RecName: Full=Ribosome maturation factor rimM
 gi|145212018|gb|ABP41425.1| 16S rRNA processing protein RimM [Yersinia pestis Pestoides F]
          Length = 182

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 33/183 (18%), Positives = 77/183 (42%), Gaps = 18/183 (9%)

Query: 1   MVKL------DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRI 50
           M K       D+ +++  +G+T+G+ G + + S   N   +  Y  +        + + +
Sbjct: 1   MSKQLNPAVPDQPIVLGKMGSTYGIRGWLRVFSSTENAESIFDYQPWFIQQAGKWQHVEL 60

Query: 51  LKMYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFD 110
               R ++  I    G+D+  +A+ L + ++           LEED+++  DL   +   
Sbjct: 61  EDWKRHSQDLIIKVKGVDDREAANLLTNCEIIVDSTQLPA--LEEDDYYWKDLMGCQVVT 118

Query: 111 RQGKYWGQVCGVYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILIDP 164
             G   G++  +   G+  ++ +K  ++     K  L+PF     + +V+L   ++ +D 
Sbjct: 119 TTGYELGKIIDMMETGSNDVMLVKANLKDAFGMKERLVPFLHGQVIKKVDLTAQRVEVDW 178

Query: 165 IAA 167
              
Sbjct: 179 DPG 181


>gi|13431802|sp|P57935|RIMM_PASMU RecName: Full=Ribosome maturation factor rimM
 gi|12721657|gb|AAK03380.1| RimM [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 178

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 33/175 (18%), Positives = 72/175 (41%), Gaps = 14/175 (8%)

Query: 1   MVKLDK-LV-LMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMY 54
           MV +++  + ++  +G+T+G+ G + I S       +  Y  +        +   +    
Sbjct: 1   MVNMEQQRIEVVGKLGSTYGIRGWLRIYSSTEYAESIFDYQPWFLKIKGQWQPTELESWR 60

Query: 55  RKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGK 114
             N   I     +D+  +A  L ++++      F +  LEE +++  DL      + +  
Sbjct: 61  YHNNDLIVKLKHVDDRETAQTLANIEIGVDLAVFPE--LEEGDYYWHDLIGCNVVNLENY 118

Query: 115 YWGQVCGVYNFGAGSILEIKNT-----MEKTFLIPFT-KFAVLEVNLQENKILID 163
             G V  +   G+  +L ++        ++  LIPF  +  V  V+L    I++D
Sbjct: 119 AMGTVTEMMETGSNDVLVVRAKSKDAFGKQERLIPFLYEQVVKRVDLNTKTIVVD 173


>gi|167769123|ref|ZP_02441176.1| hypothetical protein ANACOL_00446 [Anaerotruncus colihominis DSM
           17241]
 gi|167668763|gb|EDS12893.1| hypothetical protein ANACOL_00446 [Anaerotruncus colihominis DSM
           17241]
          Length = 185

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 46/172 (26%), Positives = 72/172 (41%), Gaps = 7/172 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNR---ELRILKMYRKNKRF 60
             + +    I TTHG+ GEV +  + + P  L ++     D R      + +        
Sbjct: 17  KKQYLESGKIVTTHGVRGEVRVQPWCDTPGFLTQFACLYLDARGSQARVVERARVHKNIV 76

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFD-RQGKYWGQV 119
           I  F G++N+  A+ LR   +Y  R D    ELEE E F  DL      D   G  +GQV
Sbjct: 77  IVKFEGVENVEDAAGLRGKTVYIDRAD---VELEEGECFVQDLIGCTVRDADTGADYGQV 133

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN 171
             V   GA  +  +++   +  L+P     VL  +L    I I P+    ++
Sbjct: 134 YDVRATGANDVYYLRDAAGRERLVPAIADVVLAKDLDAGIITIRPLEGLFDD 185


>gi|260582422|ref|ZP_05850214.1| 16S rRNA processing protein RimM [Haemophilus influenzae NT127]
 gi|260094573|gb|EEW78469.1| 16S rRNA processing protein RimM [Haemophilus influenzae NT127]
          Length = 178

 Score =  128 bits (322), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 35/175 (20%), Positives = 74/175 (42%), Gaps = 14/175 (8%)

Query: 1   MVKLDK--LVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMY 54
           M  +++  + ++  +G+T+G+ G + I S       +  Y  +      + + + +    
Sbjct: 1   MKNMEQQHIEVVGKLGSTYGIRGWLRIYSSTEQAESIFDYQPWFLKIKGEWQSIELENWR 60

Query: 55  RKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGK 114
             N   I    G+D+  +A  L ++++      F +  LEE +++  DL      + +G 
Sbjct: 61  YHNHEIIVKLKGVDDREAAQILANVEIGVDLSVFPE--LEEGDYYWHDLIGCTVVNLEGY 118

Query: 115 YWGQVCGVYNFGAGSILEIKNT-----MEKTFLIPFT-KFAVLEVNLQENKILID 163
             G V  +   G+  +L +K        ++  LIPF  +  V  V+L    I +D
Sbjct: 119 TMGTVTEIMETGSNDVLVVKANTKDAFGKQERLIPFLYEQVVKRVDLTTKTIEVD 173


>gi|52840642|ref|YP_094441.1| 16S rRNA processing protein RimM [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|67461349|sp|Q5ZYH5|RIMM_LEGPH RecName: Full=Ribosome maturation factor rimM
 gi|52627753|gb|AAU26494.1| 16S rRNA processing protein RimM [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
          Length = 169

 Score =  128 bits (322), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 37/168 (22%), Positives = 72/168 (42%), Gaps = 9/168 (5%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRK 56
           M      V++   G  HG+ G V + S+ +   ++ RY  +    +   + L++L +  +
Sbjct: 1   MNNKTNWVIIGRFGRPHGIKGFVTVHSFTDPADNILRYNDWHVFLNKQWQPLKLLTIEVR 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           +K  IA   G       S L +L +  +        L   E++   L  M   + +G  +
Sbjct: 61  SKAIIAQIEGYPKRELVSALTNLDIGVQESQLAA--LAPGEYYWYQLIGMSVINSKGDLF 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTK-FAVLEVNLQENKILID 163
           G+V  +   G+  +L ++   EK  LIP+     V+ V+  +  I +D
Sbjct: 119 GKVVEIMPTGSNDVLVVE--GEKRHLIPYLPGQFVINVDESQQVITVD 164


>gi|126173449|ref|YP_001049598.1| 16S rRNA-processing protein RimM [Shewanella baltica OS155]
 gi|152999788|ref|YP_001365469.1| 16S rRNA-processing protein RimM [Shewanella baltica OS185]
 gi|160874407|ref|YP_001553723.1| 16S rRNA-processing protein RimM [Shewanella baltica OS195]
 gi|217974259|ref|YP_002359010.1| 16S rRNA-processing protein RimM [Shewanella baltica OS223]
 gi|304409372|ref|ZP_07390992.1| 16S rRNA processing protein RimM [Shewanella baltica OS183]
 gi|307303730|ref|ZP_07583483.1| 16S rRNA processing protein RimM [Shewanella baltica BA175]
 gi|171704554|sp|A6WKR7|RIMM_SHEB8 RecName: Full=Ribosome maturation factor rimM
 gi|171769975|sp|A3D1W6|RIMM_SHEB5 RecName: Full=Ribosome maturation factor rimM
 gi|189040852|sp|A9L5P6|RIMM_SHEB9 RecName: Full=Ribosome maturation factor rimM
 gi|254797761|sp|B8EBP2|RIMM_SHEB2 RecName: Full=Ribosome maturation factor rimM
 gi|125996654|gb|ABN60729.1| 16S rRNA processing protein RimM [Shewanella baltica OS155]
 gi|151364406|gb|ABS07406.1| 16S rRNA processing protein RimM [Shewanella baltica OS185]
 gi|160859929|gb|ABX48463.1| 16S rRNA processing protein RimM [Shewanella baltica OS195]
 gi|217499394|gb|ACK47587.1| 16S rRNA processing protein RimM [Shewanella baltica OS223]
 gi|304351890|gb|EFM16288.1| 16S rRNA processing protein RimM [Shewanella baltica OS183]
 gi|306912628|gb|EFN43051.1| 16S rRNA processing protein RimM [Shewanella baltica BA175]
 gi|315266642|gb|ADT93495.1| 16S rRNA processing protein RimM [Shewanella baltica OS678]
          Length = 176

 Score =  128 bits (322), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 39/173 (22%), Positives = 77/173 (44%), Gaps = 12/173 (6%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRK 56
           M    + V++  +G+ HG+ G + I +Y ++   +  Y  +    + + RE+++ +   +
Sbjct: 1   MSSNQQPVVLGKLGSCHGIKGWLKITAYTDSVEGIFDYSPWLIKENGEWREIKVTQWRYQ 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
            K  +A   G++    A  L + ++    +   D  L  DEF+  DL   E  +  G   
Sbjct: 61  GKAVVALLDGVETREQAQMLTNCEIAILPEQMND--LPADEFYWRDLIGCEVVNTTGYNM 118

Query: 117 GQVCGVYNFGAGSILEIKNT-----MEKTFLIPFTKF-AVLEVNLQENKILID 163
           G V  +   G+  +L +K        +   +IPF     +  V+LQ  +IL+D
Sbjct: 119 GIVDQIVETGSNDVLLVKANAKDSFGKVERMIPFVPEQFIKTVDLQGKQILVD 171


>gi|255020745|ref|ZP_05292804.1| 16S rRNA processing protein RimM [Acidithiobacillus caldus ATCC
           51756]
 gi|254969807|gb|EET27310.1| 16S rRNA processing protein RimM [Acidithiobacillus caldus ATCC
           51756]
          Length = 169

 Score =  128 bits (322), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 35/166 (21%), Positives = 72/166 (43%), Gaps = 5/166 (3%)

Query: 1   MVKLDK-LVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDN--RELRILKMYRKN 57
           M + +    ++  I   +G+ G V + S+  +   +  Y L+   +  R +R+L+   + 
Sbjct: 1   MPQPEDAWTVLGRISGVYGVRGWVKVFSFTQSREGILDYPLWHLGSARRPVRVLEGRLQA 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              +A   GID+  +A+ L    +           L + EF+   L+ +   +   +  G
Sbjct: 61  GGVVAHLEGIDDRDTAAALVGQDITVPVSALPA--LPDGEFYWFQLQGLAVVNLDDERLG 118

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
            V G+   GA  +L + +      LIP+   A   V+L++ +I +D
Sbjct: 119 TVAGLLETGANDVLVVHDAQGTEILIPWDAHAAAGVDLEQGRITVD 164


>gi|302670921|ref|YP_003830881.1| 16S rRNA processing protein RimM [Butyrivibrio proteoclasticus
           B316]
 gi|302395394|gb|ADL34299.1| 16S rRNA processing protein RimM [Butyrivibrio proteoclasticus
           B316]
          Length = 170

 Score =  128 bits (322), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 40/172 (23%), Positives = 69/172 (40%), Gaps = 8/172 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-----YVLYSNDNRELRILKMYRKNK 58
           +     +  I +THGL GEV +     +P    +           +  EL +       K
Sbjct: 1   MTDRFQVGVIASTHGLQGEVNVFPTTEDPNRFKKLKKVTLHTQRGEEIELDVQSARFFKK 60

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
             I  F   +NI+   + R  +L  +R+D    +LE  E++  DL  ++  D  G   G 
Sbjct: 61  FVIVKFKQYNNINDVEKFRGCELTIERKD--AIKLEPGEYYCADLMGLDIVDEDGNKLGV 118

Query: 119 VCGVYNFGAGSILEI-KNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           V  +   GA  + E+ +   ++   IP  K  V  +++   KI I  +   L
Sbjct: 119 VTDIIQTGANDVYEMAREGSDEKVYIPVIKDCVRNIDVNGGKITIHVLEGLL 170


>gi|168188035|ref|ZP_02622670.1| 16S rRNA processing protein RimM [Clostridium botulinum C str.
           Eklund]
 gi|169294123|gb|EDS76256.1| 16S rRNA processing protein RimM [Clostridium botulinum C str.
           Eklund]
          Length = 162

 Score =  128 bits (322), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 36/163 (22%), Positives = 70/163 (42%), Gaps = 4/163 (2%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIAT 63
           +++ + +  I  THG+ GEV +    +N            D   + I     +  + I  
Sbjct: 1   MEQFLAVGKIINTHGIKGEVKVMPSTDNVERFKELNEAYIDGNMMEIEGCKFQPGKVILK 60

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
              ID+I  A +L++  +   R+  K   L+ED ++  D+     +D   K  G +  + 
Sbjct: 61  IKDIDSIEDAQKLKNKYIKVNRK--KAVALDEDCYYEADIIGCTVYDENEKQLGTIDEII 118

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIA 166
             G+  +  IK       LIP  K  ++++++   KI+I P+ 
Sbjct: 119 RTGSNDVYWIKGEN--EILIPAIKSIIVDIDVTNKKIIIKPLE 159


>gi|315634967|ref|ZP_07890248.1| 16S rRNA processing protein RimM [Aggregatibacter segnis ATCC
           33393]
 gi|315476229|gb|EFU66980.1| 16S rRNA processing protein RimM [Aggregatibacter segnis ATCC
           33393]
          Length = 177

 Score =  128 bits (322), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 34/174 (19%), Positives = 68/174 (39%), Gaps = 13/174 (7%)

Query: 1   MVKLDKLVL-MATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYR 55
           M    + +  +  +G+T+G+ G + I S       +  Y  +        +   +     
Sbjct: 1   MNMQQQRIETVGKLGSTYGIRGWLRIYSSTEQAESIFDYQPWFLKIKGQWQPTELENWRH 60

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
            N   I    G+D+  +A  L ++++      F   +LEE +++  DL      + +G  
Sbjct: 61  HNHELIVKLKGVDDREAAQTLANVEIGVDLSVFP--QLEEGDYYWHDLIGCAVVNLEGYA 118

Query: 116 WGQVCGVYNFGAGSILEIKNT-----MEKTFLIPFT-KFAVLEVNLQENKILID 163
            G V  +   G+  +L +K        ++  LIPF  +  V  V+     I +D
Sbjct: 119 MGTVTEMMETGSNDVLVVKANVKDAFGKQERLIPFLYEQVVKRVDPATKTITVD 172


>gi|289662768|ref|ZP_06484349.1| 16S rRNA-processing protein RimM [Xanthomonas campestris pv.
           vasculorum NCPPB702]
 gi|289670358|ref|ZP_06491433.1| 16S rRNA-processing protein RimM [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 170

 Score =  128 bits (322), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 32/169 (18%), Positives = 77/169 (45%), Gaps = 10/169 (5%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY-----SNDNRELRILKMYR 55
           M + ++ +L+  +    G+ GE+ ++S+      + RY  +     S     +  ++   
Sbjct: 1   MKQTERRILLGRVVGAFGVKGELKLESWTEPRNAIFRYQPWIVRAPSGQESVISGVRGRD 60

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
           + K  IA F  + +  +   +   ++Y  R      + +E  ++  DLEE++    +G  
Sbjct: 61  QGKNLIAVFPDVTDRDTVEAMHGTEIYVARSALPPPKPDE--YYWVDLEELQVETVEGVK 118

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFT-KFAVLEVNLQENKILID 163
            G V  +++ G+  ++ ++   ++  +IPF     V  V+ + N I++D
Sbjct: 119 LGTVSHLFSTGSNDVVVVR--GDRERMIPFVFPDFVKSVDFEANLIVVD 165


>gi|16078665|ref|NP_389484.1| 16S rRNA-processing protein RimM [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|221309477|ref|ZP_03591324.1| 16S rRNA-processing protein [Bacillus subtilis subsp. subtilis str.
           168]
 gi|221313802|ref|ZP_03595607.1| 16S rRNA-processing protein [Bacillus subtilis subsp. subtilis str.
           NCIB 3610]
 gi|221318726|ref|ZP_03600020.1| 16S rRNA-processing protein [Bacillus subtilis subsp. subtilis str.
           JH642]
 gi|221322997|ref|ZP_03604291.1| 16S rRNA-processing protein [Bacillus subtilis subsp. subtilis str.
           SMY]
 gi|3914642|sp|O31740|RIMM_BACSU RecName: Full=Ribosome maturation factor rimM
 gi|2633974|emb|CAB13475.1| 16S rRNA processing protein [Bacillus subtilis subsp. subtilis str.
           168]
 gi|291484153|dbj|BAI85228.1| 16S rRNA processing protein [Bacillus subtilis subsp. natto
           BEST195]
          Length = 174

 Score =  128 bits (322), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 38/178 (21%), Positives = 78/178 (43%), Gaps = 11/178 (6%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-------YVLYSNDNRELRILKM 53
           M K  +   +  I  THG+ GEV + S  +   +  +       ++   N+  E+ +   
Sbjct: 1   MTK--RWFNVGKIVNTHGIKGEVRVISKTDFAEERYKPGNTLYLFMDGRNEPVEVTVNTH 58

Query: 54  YRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQG 113
               +  +  F    N++   EL++  +    ++    EL E EF+  ++   E F  +G
Sbjct: 59  RLHKQFHLLQFKERQNLNEVEELKNAIIKVPEEE--LGELNEGEFYFHEIIGCEVFTEEG 116

Query: 114 KYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN 171
           +  G+V  +   GA  +  I    +K  LIP+ +  V  ++++E KI I+ +   ++ 
Sbjct: 117 ELIGKVKEILTPGANDVWVIGRKGKKDALIPYIESVVKHIDVREKKIEIELMEGLIDE 174


>gi|307609207|emb|CBW98671.1| hypothetical protein LPW_04801 [Legionella pneumophila 130b]
          Length = 169

 Score =  128 bits (322), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 35/168 (20%), Positives = 72/168 (42%), Gaps = 9/168 (5%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRK 56
           M      V++   G  HG+ G V + S+ +   ++ RY  +    +   + +++L +  +
Sbjct: 1   MNNKTNWVIIGRFGRPHGIKGFVTVHSFTDPADNILRYNDWHVFLNKQWQPVKLLTIEVR 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           +K  IA   G       S L +L +  +        L   E++   L  M   + +G  +
Sbjct: 61  SKAIIAQIEGYPERELVSALTNLDIGVQESQLAA--LAPGEYYWYQLIGMSVINSKGDLF 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTK-FAVLEVNLQENKILID 163
           G+V  +   G+  +L ++   EK  LIP+     V+ ++  +  I +D
Sbjct: 119 GKVVEIMPTGSNDVLVVE--GEKRHLIPYLPGQFVINIDESQQIITVD 164


>gi|54293392|ref|YP_125807.1| hypothetical protein lpl0441 [Legionella pneumophila str. Lens]
 gi|54296434|ref|YP_122803.1| hypothetical protein lpp0465 [Legionella pneumophila str. Paris]
 gi|148360985|ref|YP_001252192.1| 16S rRNA processing protein RimM [Legionella pneumophila str.
           Corby]
 gi|296105949|ref|YP_003617649.1| 16S rRNA processing protein RimM [Legionella pneumophila 2300/99
           Alcoy]
 gi|67461336|sp|Q5WZE1|RIMM_LEGPL RecName: Full=Ribosome maturation factor rimM
 gi|67461341|sp|Q5X7Z0|RIMM_LEGPA RecName: Full=Ribosome maturation factor rimM
 gi|166226448|sp|A5IHJ6|RIMM_LEGPC RecName: Full=Ribosome maturation factor rimM
 gi|53750219|emb|CAH11613.1| hypothetical protein lpp0465 [Legionella pneumophila str. Paris]
 gi|53753224|emb|CAH14671.1| hypothetical protein lpl0441 [Legionella pneumophila str. Lens]
 gi|148282758|gb|ABQ56846.1| 16S rRNA processing protein RimM [Legionella pneumophila str.
           Corby]
 gi|295647850|gb|ADG23697.1| 16S rRNA processing protein RimM [Legionella pneumophila 2300/99
           Alcoy]
          Length = 169

 Score =  128 bits (322), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 36/168 (21%), Positives = 72/168 (42%), Gaps = 9/168 (5%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRK 56
           M      V++   G  HG+ G V + S+ +   ++ RY  +    +   + L++L +  +
Sbjct: 1   MNNKTNWVIIGRFGRPHGIKGFVTVHSFTDPADNILRYNDWHVFLNKQWQPLKLLTIEVR 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           +K  IA   G       S L +L +  +        L   E++   L  M   + +G  +
Sbjct: 61  SKAIIAQIEGYPERELVSALTNLDIGVQESQLAA--LAPGEYYWYQLIGMSVINSKGDLF 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTK-FAVLEVNLQENKILID 163
           G+V  +   G+  +L ++   EK  LIP+     V+ ++  +  I +D
Sbjct: 119 GKVVEIMPTGSNDVLVVE--GEKRHLIPYLPGQFVINIDESQQVITVD 164


>gi|293392759|ref|ZP_06637077.1| 16S rRNA processing protein RimM [Serratia odorifera DSM 4582]
 gi|291424618|gb|EFE97829.1| 16S rRNA processing protein RimM [Serratia odorifera DSM 4582]
          Length = 182

 Score =  128 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 31/173 (17%), Positives = 71/173 (41%), Gaps = 12/173 (6%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRF 60
            + +++  +G+T+G+ G + + S   N   +  Y  +        + + +    R N+  
Sbjct: 11  KQPLVLGKMGSTYGIRGWLRVFSSTENAESIFDYQPWLIQKAGQWQVVELESWKRHNQDL 70

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           I     ID+  +A+ L + ++    +      LE D+++  DL   +     G   G+V 
Sbjct: 71  IIKIKDIDDRDAANLLTNCEIVVDSEQLPP--LEGDDYYWKDLMGCQVVTTSGYELGKVI 128

Query: 121 GVYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILIDPIAA 167
            +   G+  ++ ++  ++     K  L+PF     + +V+L    I  D    
Sbjct: 129 DMMETGSNDVMVVRANLKDAFGMKERLVPFLHGQVIKKVDLAAKVIEADWDPG 181


>gi|113866920|ref|YP_725409.1| 16S rRNA-processing protein RimM [Ralstonia eutropha H16]
 gi|123134305|sp|Q0KD80|RIMM_RALEH RecName: Full=Ribosome maturation factor rimM
 gi|113525696|emb|CAJ92041.1| RimM protein required for 16S rRNA processing [Ralstonia eutropha
           H16]
          Length = 222

 Score =  128 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 41/179 (22%), Positives = 78/179 (43%), Gaps = 22/179 (12%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLN---RYVLY-------------SNDNREL 48
           + LV +  IG  +G+ G + +  +A++   L    R+ L                    +
Sbjct: 41  EDLVEVGYIGAAYGIRGWIKVLPHADDASALLHARRWWLLAPPQAGLVAADASRAQPVCV 100

Query: 49  RILKMYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMET 108
           +I +    +   +A  SG+ + + A  L+  +++ +R DF   E +E  F+  DL     
Sbjct: 101 KIAQSREHSGTVVAQASGVADRNLAEALKGRRVWIRRADFPAPEEDE--FYWVDLIGCTV 158

Query: 109 FDRQGKYWGQVCGVYNFGAGSILEIK--NTMEK--TFLIPFTKFAVLEVNLQENKILID 163
            + QG+  G+V G+ + GA  IL++       K    LIPF    +  V+    +I++D
Sbjct: 159 SNEQGELLGEVSGLIDNGAHQILQVACVLPDGKAGERLIPFVDAFLRSVDTAGKRIVVD 217


>gi|120599792|ref|YP_964366.1| 16S rRNA-processing protein RimM [Shewanella sp. W3-18-1]
 gi|146292272|ref|YP_001182696.1| 16S rRNA-processing protein RimM [Shewanella putrefaciens CN-32]
 gi|171704633|sp|A1RMB7|RIMM_SHESW RecName: Full=Ribosome maturation factor rimM
 gi|172046867|sp|A4Y4L4|RIMM_SHEPC RecName: Full=Ribosome maturation factor rimM
 gi|120559885|gb|ABM25812.1| 16S rRNA processing protein RimM [Shewanella sp. W3-18-1]
 gi|145563962|gb|ABP74897.1| 16S rRNA processing protein RimM [Shewanella putrefaciens CN-32]
 gi|319425571|gb|ADV53645.1| 16S rRNA processing protein RimM [Shewanella putrefaciens 200]
          Length = 176

 Score =  128 bits (321), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 38/173 (21%), Positives = 77/173 (44%), Gaps = 12/173 (6%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRK 56
           M    + V++  +G+ HG+ G + I +Y ++   +  Y  +    + + RE+++ +   +
Sbjct: 1   MSSNQQPVVLGKLGSCHGIKGWLRITAYTDSVEGIFDYSPWLIKENGEWREVKVTQWRYQ 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
            K  +A   G++    A  L + ++    +      L EDEF+  DL   E  +  G   
Sbjct: 61  GKAVVAELEGVNTREQAQMLTNCEIAILPEQMDA--LPEDEFYWRDLIGCEVVNTTGYNM 118

Query: 117 GQVCGVYNFGAGSILEIKNT-----MEKTFLIPFTKF-AVLEVNLQENKILID 163
           G V  +   G+  +L +K        +   +IPF     +  V++Q  +IL+D
Sbjct: 119 GIVDQIVETGSNDVLLVKANAKDSFGKVERMIPFVPEQFIKTVDVQGKQILVD 171


>gi|321315368|ref|YP_004207655.1| 16S rRNA-processing protein RimM [Bacillus subtilis BSn5]
 gi|320021642|gb|ADV96628.1| 16S rRNA-processing protein RimM [Bacillus subtilis BSn5]
          Length = 174

 Score =  128 bits (321), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 38/178 (21%), Positives = 78/178 (43%), Gaps = 11/178 (6%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-------YVLYSNDNRELRILKM 53
           M K  +   +  I  THG+ GEV + S  +   +  +       ++   N+  E+ +   
Sbjct: 1   MTK--RWFNVGKIVNTHGIKGEVRVISKTDFAEERYKPGNTLYLFMDGHNEPVEVTVNTH 58

Query: 54  YRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQG 113
               +  +  F    N++   EL++  +    ++    EL E EF+  ++   E F  +G
Sbjct: 59  RLHKQFHLLQFKERQNLNEVEELKNAIIKVPEEE--LGELNEGEFYFHEIIGCEVFTEEG 116

Query: 114 KYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNN 171
           +  G+V  +   GA  +  I    +K  LIP+ +  V  ++++E KI I+ +   ++ 
Sbjct: 117 ELIGKVKEILTPGANDVWVIGRKGKKDALIPYIESVVKHIDVREKKIEIELMEGLIDE 174


>gi|295102424|emb|CBK99969.1| 16S rRNA processing protein RimM [Faecalibacterium prausnitzii
           L2-6]
          Length = 178

 Score =  128 bits (321), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 40/181 (22%), Positives = 77/181 (42%), Gaps = 7/181 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLN---RYVLYSNDNRELRILKMYRKNKRF 60
           + + +    + TTHG+ GE+ ++ + +    L    R    +   +   I+ +  + +  
Sbjct: 1   MQQYLEAGKVVTTHGVRGEMKLELWCDGVDFLKKTGRLYASAKGGKCYNIISIRPQGQMA 60

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFD-RQGKYWGQV 119
           +    G++++ +A  LR    Y  R D     L E  ++  DL   E  D   GK +G V
Sbjct: 61  LLQLEGVNDMDAARALRGQVFYFDRSD---ATLPEGRWYVADLIGCEVRDADTGKVYGVV 117

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQY 179
             V + GA  I  +K+   + ++ P     + E N  E  IL+ PI   L++      + 
Sbjct: 118 TSVDHPGAQDIYTVKSPSGREYMFPGVDAFLKERNPPEGYILVTPIPGLLDDDFDSEREE 177

Query: 180 D 180
           +
Sbjct: 178 E 178


>gi|307264847|ref|ZP_07546409.1| 16S rRNA processing protein RimM [Thermoanaerobacter wiegelii
           Rt8.B1]
 gi|306920105|gb|EFN50317.1| 16S rRNA processing protein RimM [Thermoanaerobacter wiegelii
           Rt8.B1]
          Length = 167

 Score =  128 bits (321), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 43/170 (25%), Positives = 72/170 (42%), Gaps = 8/170 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLN--RYVLYSNDNRELR---ILKMYRKNK 58
           +     +  + + HG+ GEV +    N P       YV   +D + L    I  +   +K
Sbjct: 1   MADYYNVGKVTSAHGIKGEVKVYPLTNVPERFYDLEYVWIFDDQQRLHKYDIEYVKIISK 60

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
                  GID    A +L+   L    Q+    ELEE+E+F  DL  M+ +  +G + G 
Sbjct: 61  GVCVKLKGIDTRGDAEKLKGAFLKVDSQN--ALELEENEYFIKDLVGMKVYTEEGSFLGT 118

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAG 168
           +  V   GA  +  IK   E+  LIP  K  V +V++    +++  +   
Sbjct: 119 LVEVLKTGANDVYVIKTE-EREILIPAIKEVVKKVDVDNKVMVVHLLEGL 167


>gi|118463723|ref|YP_882934.1| 16S rRNA-processing protein RimM [Mycobacterium avium 104]
 gi|166226451|sp|A0QJ46|RIMM_MYCA1 RecName: Full=Ribosome maturation factor rimM
 gi|118165010|gb|ABK65907.1| 16S rRNA processing protein RimM [Mycobacterium avium 104]
          Length = 175

 Score =  128 bits (321), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 33/173 (19%), Positives = 67/173 (38%), Gaps = 11/173 (6%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNR-------YVLYSNDNRELRILKMYRKNKRF 60
           + +  +   HG++GE+ ++   ++P                    R   I        R 
Sbjct: 3   LTVGRVVKAHGISGEIVVEIRTDDPAARFAPGNTLRAKPSRGGPERSCVIESAREHGGRL 62

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +   +G+ +  +A  LR         +  D +  +  + +  LE ++     G+  G V 
Sbjct: 63  LVRLAGVTDRDAADALRGTLFVVDSAELPDIDEPDTYYDH-QLEGLQVRTTGGQRVGAVA 121

Query: 121 GVYNFGAGSILEIKNTME---KTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
            V +  AG +L +++  +   +  L+PF    V  V+L +  I IDP    L+
Sbjct: 122 EVLHTAAGELLAVRDDADGAPREVLVPFVSAIVTAVSLDDGLIEIDPPDGLLD 174


>gi|156932850|ref|YP_001436766.1| 16S rRNA-processing protein RimM [Cronobacter sakazakii ATCC
           BAA-894]
 gi|166226439|sp|A7MEG3|RIMM_ENTS8 RecName: Full=Ribosome maturation factor rimM
 gi|156531104|gb|ABU75930.1| hypothetical protein ESA_00647 [Cronobacter sakazakii ATCC BAA-894]
          Length = 183

 Score =  128 bits (321), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 34/183 (18%), Positives = 72/183 (39%), Gaps = 18/183 (9%)

Query: 1   MVKLD------KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRI---- 50
           M K D        +++  +G+++G+ G + + S   +   +  Y  +             
Sbjct: 2   MSKQDAAKAPVNPIVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQQAGQWQQVQL 61

Query: 51  LKMYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFD 110
                 N+  I    G+D+  +A+ L + ++        D  LEE +++  DL   +   
Sbjct: 62  ESWKHHNQDMIIKLKGVDDRDAANLLTNCEIVVDSSQLPD--LEEGDYYWKDLIGCQVVT 119

Query: 111 RQGKYWGQVCGVYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILIDP 164
            +G   G+V  +   G+  +L +K  ++     K  L+PF     + +V+L    I +D 
Sbjct: 120 TEGYSLGKVIDMMETGSNDVLVVKANLKDAFGIKERLLPFLDGQVIKKVDLATQTIEVDW 179

Query: 165 IAA 167
              
Sbjct: 180 DPG 182


>gi|256831067|ref|YP_003159795.1| 16S rRNA processing protein RimM [Desulfomicrobium baculatum DSM
           4028]
 gi|256580243|gb|ACU91379.1| 16S rRNA processing protein RimM [Desulfomicrobium baculatum DSM
           4028]
          Length = 182

 Score =  128 bits (321), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 39/170 (22%), Positives = 65/170 (38%), Gaps = 7/170 (4%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNP---IDLNRYVLYSNDNRELRI--LKMYRKNKRF 60
           KLV +  +   HGL GE+ I+ YA++P     L R  L     +              R 
Sbjct: 10  KLVELGRVQKPHGLRGELCIEPYADSPFIFEGLTRVYLRLPGKKPKPCVLEGWRAHQGRA 69

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           + T         A   R   + A+ +D     L+EDEF   DL  +      G   G + 
Sbjct: 70  LITVDRSQGRDQAEAWRGADVLARERDLPP--LDEDEFRPEDLLGLPVMHVNGSRIGVLE 127

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
            + +     +  I +      ++P     +L+++L+   IL+DP    L 
Sbjct: 128 DIRDVAGQELWFILDDAGNEIMLPAVDEFILDIDLEAGVILVDPPDGLLE 177


>gi|227833408|ref|YP_002835115.1| 16S rRNA processing protein [Corynebacterium aurimucosum ATCC
           700975]
 gi|262184396|ref|ZP_06043817.1| 16S rRNA-processing protein RimM [Corynebacterium aurimucosum ATCC
           700975]
 gi|227454424|gb|ACP33177.1| 16S rRNA processing protein [Corynebacterium aurimucosum ATCC
           700975]
          Length = 166

 Score =  128 bits (321), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 42/168 (25%), Positives = 73/168 (43%), Gaps = 10/168 (5%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNR-----YVLYSNDNRELRILKMYRKNKRFIA 62
           +L+  +  +HG+ GEV ++   ++P          +        EL I  +     R + 
Sbjct: 3   LLIGRVVKSHGIKGEVSVEVTTDSPETRFAVGEVLHGTQGKKEHELTIAAVRAHKGRLLI 62

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
           TF  I +  +A  LR  + +A+  D      E+D F++ +LE +       K  G+V GV
Sbjct: 63  TFKEIPDRTAADSLRGTQFFAEPLDDP----EDDGFYDHELEGLRV-LLDRKEVGEVTGV 117

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
            +    S+LE+     K  L+PF +  V E++L      I P    L+
Sbjct: 118 THGPTQSLLEVTLAEGKEALVPFVEEIVPEIDLDAGTCTITPPEGLLD 165


>gi|289675161|ref|ZP_06496051.1| 16S rRNA-processing protein RimM [Pseudomonas syringae pv. syringae
           FF5]
          Length = 171

 Score =  128 bits (321), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 33/163 (20%), Positives = 80/163 (49%), Gaps = 11/163 (6%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND-----NRELRILKMYRKNKR 59
           D L+++  I + HG+ GEV + S+ +   +L  Y  ++       ++++ ++    ++K 
Sbjct: 9   DDLIVIGKIYSVHGVRGEVKVYSFTDPIGNLLDYKTWTLRREGSVDKQVELVSGRLQSKF 68

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +    G+D+   A  L   ++   R  F D  L++ E++   LE ++  D+ G+  G++
Sbjct: 69  LVTKLKGLDDREEARLLSGYEICVPRNLFPD--LDDGEYYWYQLEGLKVIDQLGQLLGKI 126

Query: 120 CGVYNFGAGSILEIKNT----MEKTFLIPFTKFAVLEVNLQEN 158
             +   G+  ++ +K       ++  L+P+T+  VL +++   
Sbjct: 127 DHLLETGSNDVMVVKPCAGSLDDRERLLPYTEQCVLAIDMAAG 169


>gi|238791384|ref|ZP_04635023.1| Ribosome maturation factor rimM [Yersinia intermedia ATCC 29909]
 gi|238729517|gb|EEQ21032.1| Ribosome maturation factor rimM [Yersinia intermedia ATCC 29909]
          Length = 186

 Score =  128 bits (321), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 31/173 (17%), Positives = 76/173 (43%), Gaps = 12/173 (6%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRF 60
           D+ +++  +G+T+G+ G + + S   N   +  Y  +        + + +    R ++  
Sbjct: 15  DQPIVLGKMGSTYGIRGWLRVFSSTENAESIFDYQPWFIQQAGKWQHVELEDWKRHSQDL 74

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           I    G+D+  +A+ L + ++    +      LEED+++  DL   +     G   G++ 
Sbjct: 75  IIKVKGVDDRDAANLLTNCEIIVDSKQLPA--LEEDDYYWKDLMGCQVVTTTGYELGKII 132

Query: 121 GVYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILIDPIAA 167
            +   G+  ++ +K  ++     K  L+PF     + +V+L   ++ +D    
Sbjct: 133 DMMETGSNDVMVVKANLKDAFGMKERLVPFLHGQVIKKVDLTAQRVEVDWDPG 185


>gi|119962451|ref|YP_948176.1| 16S rRNA-processing protein RimM [Arthrobacter aurescens TC1]
 gi|119949310|gb|ABM08221.1| 16S rRNA processing protein RimM [Arthrobacter aurescens TC1]
          Length = 213

 Score =  128 bits (321), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 43/184 (23%), Positives = 73/184 (39%), Gaps = 7/184 (3%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLN----RYVLYSNDNRELRILKMYRKNKRFIAT 63
           + +A IG  HG+ GEV +    + P +       +V+       L I          +  
Sbjct: 32  LQVARIGKPHGIRGEVTVQVLTDAPSERFVAGTEFVVEPASAGPLTIRSARWNKDILLLG 91

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F  I + ++A  +R  KL+ + ++  DE+ +E  +   +L  +E      +  G+V  + 
Sbjct: 92  FEEIADRNAAEVIRGAKLFIETEELSDEDDDEGWY-EHELVGLEARVGS-QVVGKVAALS 149

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN-NTTMKNPQYDCP 182
                 +L +     K  LIPF    V EVN++   ILI P +     N        D  
Sbjct: 150 TLPVQDLLTVTTEEGKEILIPFVDEIVPEVNVEGGYILITPPSGLFEINDENAKEPKDGA 209

Query: 183 LDSA 186
            D A
Sbjct: 210 GDDA 213


>gi|330807706|ref|YP_004352168.1| 16S rRNA processing protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327375814|gb|AEA67164.1| Putative 16S rRNA processing protein [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
          Length = 178

 Score =  128 bits (321), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 33/169 (19%), Positives = 79/169 (46%), Gaps = 10/169 (5%)

Query: 3   KLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDN----RELRILKMYRKNK 58
             D L+++  I + HG+ GEV + S+ +   +L  Y  ++       +++ ++     +K
Sbjct: 7   DADDLIVVGKIYSVHGVRGEVKVYSFTDPIKNLLDYKTWTLKREGSVKQVELVSGRGNDK 66

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
             +A    +D+   A  L   ++   R  F +  L + E++   L  ++  D  G+  G+
Sbjct: 67  FLVAKLKDLDDREEARLLAGYEICVPRNLFPE--LTDGEYYWYQLVGLKVIDHLGQLLGK 124

Query: 119 VCGVYNFGAGSILEIKNT----MEKTFLIPFTKFAVLEVNLQENKILID 163
           +  +   G+  ++ +K       ++  L+P+T+  VL V+L   ++ ++
Sbjct: 125 IDHLLETGSNDVMVVKPCVGSLDDRERLLPYTEQCVLAVDLAAGEMKVE 173


>gi|323705462|ref|ZP_08117037.1| 16S rRNA processing protein RimM [Thermoanaerobacterium
           xylanolyticum LX-11]
 gi|323535364|gb|EGB25140.1| 16S rRNA processing protein RimM [Thermoanaerobacterium
           xylanolyticum LX-11]
          Length = 166

 Score =  128 bits (321), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 35/169 (20%), Positives = 75/169 (44%), Gaps = 7/169 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR----YVLYSNDNRELRILKMYRKNKR 59
           +D  + +  I + +G+NGEV +    ++          Y+   +   + +I  +      
Sbjct: 1   MDNYLSVGKITSAYGVNGEVKVYPLTDHLDRFYDLDYVYIFDDDKRVQYQIESVRFIKNL 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +  F  +++ + A +L++  +     D    ELEEDE+F  DL +M+ +    +  G +
Sbjct: 61  VLIKFYEVNDRNEAEKLKNKFIKITMDD--AVELEEDEYFIKDLIDMKVYTEDKRELGVL 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAG 168
             V   GA  +  +K   E+  LIP  K  + +V++   K+++  +   
Sbjct: 119 KEVLKTGANDVYVVKT-DERDILIPAIKDVIKDVDINGKKMIVHLLEGL 166


>gi|288942188|ref|YP_003444428.1| 16S rRNA processing protein RimM [Allochromatium vinosum DSM 180]
 gi|288897560|gb|ADC63396.1| 16S rRNA processing protein RimM [Allochromatium vinosum DSM 180]
          Length = 169

 Score =  128 bits (321), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 35/159 (22%), Positives = 71/159 (44%), Gaps = 7/159 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRY--VLYSNDNRELRILKMYRKNKRFIATFS 65
           +++  +   +G+ G V + S  +    + RY   L   D    R+ +     K  +A   
Sbjct: 10  IVLGRVSGLYGVKGWVKVYSETDPREGILRYSPWLLGPDGVARRVAEGRMHGKGLVARLD 69

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNF 125
           G ++   A+ L   ++  +R        +E  F+  DLE +    + G  +G+V  +++ 
Sbjct: 70  GCEDRDQAAALIGQEIAIRRDQLPPPRPDE--FYWIDLEGLAVVTQAGVEFGRVSHLFST 127

Query: 126 GAGSILEIKNTMEKTFLIPFT-KFAVLEVNLQENKILID 163
           GA  +L ++   E+  LIPF     +L+V+  +  I +D
Sbjct: 128 GANDVLVVQ--GERERLIPFVWGDVILDVDFDQRLIRVD 164


>gi|226365998|ref|YP_002783781.1| 16S rRNA-processing protein RimM [Rhodococcus opacus B4]
 gi|254797760|sp|C1B2R9|RIMM_RHOOB RecName: Full=Ribosome maturation factor rimM
 gi|226244488|dbj|BAH54836.1| putative 16S rRNA processing protein RimM [Rhodococcus opacus B4]
          Length = 183

 Score =  128 bits (321), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 35/181 (19%), Positives = 72/181 (39%), Gaps = 10/181 (5%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRE-------LRILKMYRKNKRF 60
           +++  +  +HG+ GE+ ++   + P D          ++         R+      + R 
Sbjct: 3   LVVGRVAKSHGIKGEIVVEVRTDEPEDRFAVGAVLRGHKPREQTVNTYRVEAAREHSGRL 62

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +    G+ +  +A  LR         +      + DEF++ +LE +      G   G V 
Sbjct: 63  LLRLEGVPDRTAADALRGTLFVIDSAEL-VPSDDPDEFYDHELEGLSVRLADGTELGAVI 121

Query: 121 GVYNFGAGSILEIKNTMEK--TFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQ 178
            V +  AG +L I+   E+    L+PF    V  V++ +  ++IDP    L+    ++  
Sbjct: 122 EVLHSAAGELLSIRRAGEQSGELLVPFVAAIVTSVSVADGVVVIDPPEGLLDPDFGESAD 181

Query: 179 Y 179
            
Sbjct: 182 G 182


>gi|238785843|ref|ZP_04629812.1| Ribosome maturation factor rimM [Yersinia bercovieri ATCC 43970]
 gi|238713256|gb|EEQ05299.1| Ribosome maturation factor rimM [Yersinia bercovieri ATCC 43970]
          Length = 186

 Score =  127 bits (320), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 31/173 (17%), Positives = 75/173 (43%), Gaps = 12/173 (6%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRF 60
           D+ +++  +G+T+G+ G + + S   N   +  Y  +        + + +    R ++  
Sbjct: 15  DQPIVLGKMGSTYGIRGWLRVFSSTENAESIFDYQPWFIQQAGKWQHVELEDWKRHSQDL 74

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           I    G+D+  +A+ L + ++    +      LEED+++  DL   +     G   G++ 
Sbjct: 75  IIKVKGVDDRDAANLLTNCEIIVDSKQLP--TLEEDDYYWKDLMGCQVVTTTGYELGKII 132

Query: 121 GVYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILIDPIAA 167
            +   G+  ++ +K  ++     K  L+PF     +  V+L   ++ +D    
Sbjct: 133 DMMETGSNDVMVVKANLKDAFGMKERLVPFLHGQVIKSVDLTAQRVEVDWDPG 185


>gi|284047849|ref|YP_003398188.1| 16S rRNA processing protein RimM [Acidaminococcus fermentans DSM
           20731]
 gi|283952070|gb|ADB46873.1| 16S rRNA processing protein RimM [Acidaminococcus fermentans DSM
           20731]
          Length = 164

 Score =  127 bits (320), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 26/164 (15%), Positives = 70/164 (42%), Gaps = 3/164 (1%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS-NDNRELRILKMYRKNKRFIA 62
           +++ +++  I   HG+ GE  I    ++P    +    + ++ RE  ++ + +    ++ 
Sbjct: 1   MEQHIVIGKIVAPHGVRGEFRIMPQTDHPERYAKMKKITLDNGREYTVVSLRQHKNVYLM 60

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
              GID+++ A  LR   +  + ++     L E +F+  D+        +G+  G +  V
Sbjct: 61  KVEGIDSMNDAETLRGRTIVLRPEELPP--LPEGQFYVRDIIGFAAVTPEGETVGTLKDV 118

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIA 166
            + G+  +  I     +  L+      +  ++ ++ +I +    
Sbjct: 119 LSPGSTDVFVIAPPQGEDILVAAIGDNIRNIDWEKKQITVVLPE 162


>gi|188588501|ref|YP_001920593.1| 16S rRNA-processing protein RimM [Clostridium botulinum E3 str.
           Alaska E43]
 gi|238689674|sp|B2V4E4|RIMM_CLOBA RecName: Full=Ribosome maturation factor rimM
 gi|188498782|gb|ACD51918.1| 16S rRNA processing protein RimM [Clostridium botulinum E3 str.
           Alaska E43]
          Length = 165

 Score =  127 bits (320), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 36/169 (21%), Positives = 69/169 (40%), Gaps = 4/169 (2%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIAT 63
           ++++  +  I  THG+ GEV +     +     +      D     I  +  +  R I  
Sbjct: 1   MEEIFKIGQIVNTHGIKGEVKVYPLTEDVNKFKKLKTVLIDGEHRNIQSVKFQKDRVILK 60

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
             GID ++ A   +   +   R +  +  LE D  +  DL     +D      G++  V 
Sbjct: 61  IEGIDTMNDAETYKQKYIEIFRSNAPE--LEADTHYIVDLIGCMVYDADNMELGKIFDVI 118

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNT 172
           +  +  +  IK    K  LIP  K  VL+++++  KI++ P+    +  
Sbjct: 119 STPSNDVYWIKQP--KELLIPVLKDIVLDIDIENKKIVVKPVRQWQDED 165


>gi|123441195|ref|YP_001005182.1| 16S rRNA-processing protein RimM [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|332160292|ref|YP_004296869.1| 16S rRNA-processing protein RimM [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|166226488|sp|A1JK24|RIMM_YERE8 RecName: Full=Ribosome maturation factor rimM
 gi|122088156|emb|CAL10944.1| 16S rRNA processing protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|318604477|emb|CBY25975.1| 16S rRNA processing protein RimM [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325664522|gb|ADZ41166.1| 16S rRNA-processing protein RimM [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330862668|emb|CBX72816.1| ribosome maturation factor rimM [Yersinia enterocolitica W22703]
          Length = 182

 Score =  127 bits (320), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 30/173 (17%), Positives = 76/173 (43%), Gaps = 12/173 (6%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRF 60
           ++ +++  +G+T+G+ G + + S   N   +  Y  +        + + +    R ++  
Sbjct: 11  EQPIVLGKMGSTYGIRGWLRVFSSTENAESIFDYQPWFIQQGGKWQHVELEDWKRHSQDL 70

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           I    G+D+  +A+ L + ++    +   +  LEED+++  DL   +     G   G++ 
Sbjct: 71  IIKVKGVDDRDAANLLTNCEIVVDSKQLPE--LEEDDYYWKDLMGCQVVTTAGYELGKII 128

Query: 121 GVYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILIDPIAA 167
            +   G+  ++ +K  ++     K  L+PF     +  V+L   ++ +D    
Sbjct: 129 DMMETGSNDVMVVKANLKDAFGMKERLVPFLHGQVIKNVDLTAQRVEVDWDPG 181


>gi|253578960|ref|ZP_04856231.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|251849903|gb|EES77862.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA]
          Length = 167

 Score =  127 bits (320), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 44/169 (26%), Positives = 83/169 (49%), Gaps = 5/169 (2%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYAN-NPIDLNRYVLYSN--DNRELRILKMYRKNKRF 60
           ++ L+ +  I TTHG+ GEV +    + +      YVL     + R+L I  +       
Sbjct: 1   MEDLLKVGVITTTHGIRGEVKVYPTTDADRFLDLEYVLLDTGREKRKLEIENVKYFKNLV 60

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           I  F GIDNI+     +  +L+  R++   +ELEEDE++  DL  M+     G  +G + 
Sbjct: 61  ILKFRGIDNINDIEMYKKRELWIPREE--AQELEEDEYYIADLIGMDVVLEDGSKFGTLK 118

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
            V   GA  +  +++   +  L+P  +  +L+V++++N + I  +   +
Sbjct: 119 DVMETGANDVYVVEDAKGEEILLPAIRECILDVDVEKNVMTIHLMKGLI 167


>gi|291615193|ref|YP_003525350.1| 16S rRNA processing protein RimM [Sideroxydans lithotrophicus ES-1]
 gi|291585305|gb|ADE12963.1| 16S rRNA processing protein RimM [Sideroxydans lithotrophicus ES-1]
          Length = 166

 Score =  127 bits (320), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 36/162 (22%), Positives = 71/162 (43%), Gaps = 8/162 (4%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND----NRELRILKMYRKNKR-FI 61
           +V+M  +    G+ G V + ++      L  Y  +        R L +L+      +  I
Sbjct: 1   MVVMGKVVGAQGIQGWVKVQAFTEYLDSLLDYSTWYVGNEQSWRPLEVLEANVHGGKVLI 60

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
           A   GI +  +A + + L +   R    +++  E E++ +DL  +   +  G+ +G V  
Sbjct: 61  AKLQGIVDRTAAEKCKGLLIAVPRDSLPEQQ--EGEYYWSDLIGLSVENLAGEKFGTVDS 118

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
           +   GA  +L +K    +T + PF    + +V+LQ   I +D
Sbjct: 119 LLETGANDVLVVKGEGGETLM-PFIASVIRQVDLQNKLIRVD 159


>gi|254492677|ref|ZP_05105848.1| 16S rRNA processing protein RimM [Methylophaga thiooxidans DMS010]
 gi|224462198|gb|EEF78476.1| 16S rRNA processing protein RimM [Methylophaga thiooxydans DMS010]
          Length = 172

 Score =  127 bits (320), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 34/169 (20%), Positives = 73/169 (43%), Gaps = 8/169 (4%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRK 56
           M   ++ + +  I    G+ G V + S+ +   ++  Y         +  E+++   + +
Sbjct: 1   MATSEEFIPVGKISGAFGIKGWVKVFSFTDPRTNILEYSPLFLSRQGEWIEIKVSGGHLQ 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
            K  +   + + +      L   +L  K++  +  E +E  F+ +DL+ +   + + +  
Sbjct: 61  GKGVVMGIANVTDRDQVQPLIGSELAIKKEQLEPAEEDE--FYWSDLQGLTVMNLEDETL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEK-TFLIPFT-KFAVLEVNLQENKILID 163
           GQV  +   GA  +L +K   E    LIPF  +  V  V+L +  I +D
Sbjct: 119 GQVDHLLETGANDVLVVKAKGENTERLIPFVMEEIVKAVDLDKQLIQVD 167


>gi|28378336|ref|NP_785228.1| 16S rRNA processing protein [Lactobacillus plantarum WCFS1]
 gi|300767273|ref|ZP_07077185.1| 16S rRNA processing protein RimM [Lactobacillus plantarum subsp.
           plantarum ATCC 14917]
 gi|308180487|ref|YP_003924615.1| 16S rRNA processing protein [Lactobacillus plantarum subsp.
           plantarum ST-III]
 gi|38258523|sp|Q88WJ3|RIMM_LACPL RecName: Full=Ribosome maturation factor rimM
 gi|28271171|emb|CAD64076.1| 16S rRNA processing protein [Lactobacillus plantarum WCFS1]
 gi|300495092|gb|EFK30248.1| 16S rRNA processing protein RimM [Lactobacillus plantarum subsp.
           plantarum ATCC 14917]
 gi|308045978|gb|ADN98521.1| 16S rRNA processing protein [Lactobacillus plantarum subsp.
           plantarum ST-III]
          Length = 174

 Score =  127 bits (320), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 26/175 (14%), Positives = 65/175 (37%), Gaps = 12/175 (6%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY---------SNDNRELRILKMYRK 56
               + T+  THG+ GEV +    + P +  +             +     ++I K   +
Sbjct: 2   DYYRVGTLVNTHGIRGEVKVVVVTDFPEERFKVGQQLSLFKTPDETTGGITVKIAKAREQ 61

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
              +  TF G+DNI+     +   +    +      L   E++   +  ++      +  
Sbjct: 62  KGLYFLTFEGLDNINDVERYKGWTIKVPAEAL--HALPAGEYYYHQIVGLQVVTTADEPL 119

Query: 117 GQVCGVYNFGAGSILEIKNTMEK-TFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           G +  + + GA  +  +K    +   L+P     + +V+L    + ++ +   ++
Sbjct: 120 GTIKEILSPGANDVWVVKRDHGQSDVLLPKIPQVIKDVDLDAGVVTVELMEGLID 174


>gi|289704589|ref|ZP_06501022.1| 16S rRNA processing protein RimM [Micrococcus luteus SK58]
 gi|289558709|gb|EFD51967.1| 16S rRNA processing protein RimM [Micrococcus luteus SK58]
          Length = 200

 Score =  127 bits (320), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 41/187 (21%), Positives = 76/187 (40%), Gaps = 13/187 (6%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLN----RYVLYSNDNR---ELRILKMYRK 56
            D LV +A IG  HG+ GEV +  + ++P        R V+         EL + +    
Sbjct: 6   QDDLVRVARIGKPHGIRGEVTVQVFTDDPDARFAPGERLVVRDGAPGLPAELTVTRARWN 65

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
            +  +  F+   + + A  LR  +L+A          E DE++  DL ++E     G+  
Sbjct: 66  KQILVVGFAESPDRNVAETLRGAQLFAV----PAAPEESDEWYEEDLVDLEVRVE-GERV 120

Query: 117 GQVCGVYNFGAGSILEIKNTM-EKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMK 175
           G V  +       +L +     E+  L+PF +  V E++ +   +++ P    L   T +
Sbjct: 121 GVVTALTTGAVQDLLHVALDGVEEEALVPFVEEIVPEIDPEAGVLVLTPPPGLLELATGE 180

Query: 176 NPQYDCP 182
           +      
Sbjct: 181 DEDAADG 187


>gi|254556544|ref|YP_003062961.1| 16S rRNA processing protein [Lactobacillus plantarum JDM1]
 gi|254045471|gb|ACT62264.1| 16S rRNA processing protein [Lactobacillus plantarum JDM1]
          Length = 174

 Score =  127 bits (320), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 26/175 (14%), Positives = 65/175 (37%), Gaps = 12/175 (6%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY---------SNDNRELRILKMYRK 56
               + T+  THG+ GEV +    + P +  +             +     ++I K   +
Sbjct: 2   DYYRVGTLVNTHGIRGEVKVVVVTDFPEERFKVGQQLSLFKTPDETTGGITVKIAKAREQ 61

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
              +  TF G+DNI+     +   +    +      L   E++   +  ++      +  
Sbjct: 62  KGLYFLTFEGLDNINDVERYKGWTIKVPAEAL--HPLPAGEYYYHQIVGLQVVTTADEPL 119

Query: 117 GQVCGVYNFGAGSILEIKNTMEK-TFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           G +  + + GA  +  +K    +   L+P     + +V+L    + ++ +   ++
Sbjct: 120 GTIKEILSPGANDVWVVKRDHGQSDVLLPKIPQVIKDVDLDAGVVTVELMEGLID 174


>gi|120555193|ref|YP_959544.1| 16S rRNA-processing protein RimM [Marinobacter aquaeolei VT8]
 gi|171769205|sp|A1U2Y8|RIMM_MARAV RecName: Full=Ribosome maturation factor rimM
 gi|120325042|gb|ABM19357.1| 16S rRNA processing protein RimM [Marinobacter aquaeolei VT8]
 gi|302608134|emb|CBW44416.1| 16S rRNA processing protein [Marinobacter hydrocarbonoclasticus]
          Length = 175

 Score =  127 bits (320), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 33/172 (19%), Positives = 75/172 (43%), Gaps = 11/172 (6%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRK 56
           M +  +  ++  I +  G+ G + + SY +    +  Y  +          +R+ +  R+
Sbjct: 1   MTQNSQETVIGRITSVFGVKGWLKVFSYTDPKDGILNYRDWTLLLDGKRIPIRLEEGRRQ 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
            +  +    GID+   A      ++    +   +  L E EF+   LE ++ F  +G+  
Sbjct: 61  GQGIVVRLKGIDDREVARTYCGAEIRVPTEQLPE--LPEGEFYWHQLEGLDVFTVEGECL 118

Query: 117 GQVCGVYNFGAGSILEIKNTME----KTFLIPFT-KFAVLEVNLQENKILID 163
           G+V  +   G+  +L +  T      +  LIP+     V +V+L+ +++++D
Sbjct: 119 GKVHHLLETGSNDVLVVHATAGSIDQRERLIPYLPDQVVQQVDLKGSRMVVD 170


>gi|308177296|ref|YP_003916702.1| 16S rRNA-processing protein RimM [Arthrobacter arilaitensis Re117]
 gi|307744759|emb|CBT75731.1| 16S rRNA-processing protein RimM [Arthrobacter arilaitensis Re117]
          Length = 180

 Score =  127 bits (320), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 32/166 (19%), Positives = 70/166 (42%), Gaps = 7/166 (4%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLN----RYVLYSNDNRELRILKMYRKNKRFIAT 63
           + +A IG  HG+ GEV      + P +        ++     + L +          + +
Sbjct: 3   LQVARIGKPHGIRGEVTAQVMTDTPDERFTSGEELIVVDGPVKTLTVKSARWNKTILLLS 62

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F  I++ + A  LR  +L     +  ++  + DE++  +L +++     G+  G +  + 
Sbjct: 63  FKEINDRNQAETLRGARLEIDVSEEPED--DSDEWYEHELLDLKVML-DGEQVGVITALR 119

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
              A  +L  +N+  +   +PF    V E++ +   ++I P A  L
Sbjct: 120 TNPAQDLLVFENSEGQEIYLPFVDEFVPEIDPEAGIVVITPPAGLL 165


>gi|38234108|ref|NP_939875.1| 16S rRNA-processing protein [Corynebacterium diphtheriae NCTC
           13129]
 gi|59798748|sp|Q6NGI4|RIMM_CORDI RecName: Full=Ribosome maturation factor rimM
 gi|38200370|emb|CAE50057.1| Putative 16s rRNA processing protein [Corynebacterium diphtheriae]
          Length = 166

 Score =  127 bits (320), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 41/168 (24%), Positives = 68/168 (40%), Gaps = 10/168 (5%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND-----NRELRILKMYRKNKRFIA 62
           +++  +  +HG+ GEV I+     P          N         L I  +     R + 
Sbjct: 3   LMIGRVVKSHGIRGEVAIEVTTEEPEIRFAQGEVLNGRQGGKEHSLTIASVRPHQNRLLV 62

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F  I +  +A  LR  + +A       ++  +D F++ +LE +       +  G+V GV
Sbjct: 63  KFKEIADRTAADSLRGTRFFAA----PLDDDVDDGFYDHELEGLAVIH-GEEKIGEVSGV 117

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
            +  A S+LE+     K  LIPF    V EV+L     +I P    L 
Sbjct: 118 IHGPAQSLLEVTLESGKEVLIPFVHDIVPEVDLDAGTCVITPPEGLLE 165


>gi|305681419|ref|ZP_07404226.1| 16S rRNA processing protein RimM [Corynebacterium matruchotii ATCC
           14266]
 gi|305659624|gb|EFM49124.1| 16S rRNA processing protein RimM [Corynebacterium matruchotii ATCC
           14266]
          Length = 169

 Score =  127 bits (320), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 42/174 (24%), Positives = 76/174 (43%), Gaps = 11/174 (6%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNR-----ELRILKMYRK 56
           + ++  +++  +   HG+ GEV +D   + P          +  +      L +      
Sbjct: 1   MLME--LMIGRVIKAHGIRGEVVVDPTTDEPDIRYAPGTVLHGKQGKREHTLTVAHARPH 58

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
             R + TF  + +  +A  LR  + +A++ D  D   +E+ F++ DL  +      G   
Sbjct: 59  QGRLLVTFDEVPDRTAAESLRGTQFWAEQLDIDD---DEEGFYDHDLTGLRVIHE-GAEI 114

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           G V GV +  AG+ILE++    K  L+PF    V EV+L+     I P    L+
Sbjct: 115 GTVTGVMSGPAGTILEVELAGGKQALVPFVFDIVPEVDLEAGTCTITPPDGLLD 168


>gi|257055029|ref|YP_003132861.1| 16S rRNA processing protein RimM [Saccharomonospora viridis DSM
           43017]
 gi|256584901|gb|ACU96034.1| 16S rRNA processing protein RimM [Saccharomonospora viridis DSM
           43017]
          Length = 174

 Score =  127 bits (320), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 35/172 (20%), Positives = 70/172 (40%), Gaps = 10/172 (5%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNR------YVLYSNDNRELRILKMYRKNKRFI 61
           V++  I   HG+ GEV +D   ++P +           +     R L +  +     R +
Sbjct: 3   VVVGRIVKPHGIRGEVAVDVRTDSPEERFAPETVLTGKMRDGRTRPLTVAAVRPHGGRLL 62

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
             F  + +  +A E+R   L     +    +  ++ F++ +LE +      G   G V  
Sbjct: 63  VRFLEVPDRTAAEEIRGATLLIDVDELPPIDDPDE-FYDHELEGLRAELDDGTVVGTVRE 121

Query: 122 VYNFGAGSILEIK---NTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           V +   G +L ++   +   +  L+PF    V  V +   +I++DP    L+
Sbjct: 122 VVHSPGGELLAVEVEESGRRREVLVPFVAAIVPRVEVDRGRIVLDPPEGLLD 173


>gi|41409073|ref|NP_961909.1| 16S rRNA-processing protein [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|59798798|sp|Q73VN8|RIMM_MYCPA RecName: Full=Ribosome maturation factor rimM
 gi|41397432|gb|AAS05292.1| RimM [Mycobacterium avium subsp. paratuberculosis K-10]
          Length = 175

 Score =  127 bits (320), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 33/173 (19%), Positives = 67/173 (38%), Gaps = 11/173 (6%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNR-------YVLYSNDNRELRILKMYRKNKRF 60
           + +  +   HG++GE+ ++   ++P                    R   I        R 
Sbjct: 3   LTVGRVVKAHGISGEIVVEIRTDDPAARFAPGNTLRAKPSRGGPERSCVIESAREHGGRL 62

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +   +G+ +  +A  LR         +  D +  +  + +  LE ++     G+  G V 
Sbjct: 63  LVRLAGVTDRDAADALRGTLFVVDSAELPDIDEPDTYYDH-QLEGLQVRTTGGRRVGAVA 121

Query: 121 GVYNFGAGSILEIKNTME---KTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
            V +  AG +L +++  +   +  L+PF    V  V+L +  I IDP    L+
Sbjct: 122 EVLHTAAGELLAVRDDADGAPREVLVPFVSAIVTAVSLDDGLIEIDPPDGLLD 174


>gi|226328728|ref|ZP_03804246.1| hypothetical protein PROPEN_02623 [Proteus penneri ATCC 35198]
 gi|225201914|gb|EEG84268.1| hypothetical protein PROPEN_02623 [Proteus penneri ATCC 35198]
          Length = 181

 Score =  127 bits (320), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 32/172 (18%), Positives = 69/172 (40%), Gaps = 13/172 (7%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRFI 61
           + ++M  +G+ +G+ G + + S   +  ++  Y  +          + I      N+  I
Sbjct: 12  EPIVMGKLGSPYGIRGWLRVFSSTEHAENIFEYQPWFIQRHGQWETIEIESWKHHNQDII 71

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               GID+  +A+ L + ++        +    E E++  DL        +G   G V  
Sbjct: 72  VKLKGIDDRDAANFLTNFEIVVNASQLPEL---EGEYYWKDLMGCHVETDKGYDLGVVTD 128

Query: 122 VYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILIDPIAA 167
           +   G+  ++ IK  ++        L+PF     + +V+L   KI++D    
Sbjct: 129 MMETGSNDVMVIKANLKDAFGIGERLVPFLDGQVIKKVDLSAKKIIVDWDPG 180


>gi|88930448|sp|Q4QNY7|RIMM_HAEI8 RecName: Full=Ribosome maturation factor rimM
          Length = 178

 Score =  127 bits (320), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 35/175 (20%), Positives = 74/175 (42%), Gaps = 14/175 (8%)

Query: 1   MVKLDK--LVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMY 54
           M  +++  + ++  +G+T+G+ G + I S       +  Y  +      + + + +    
Sbjct: 1   MKNMEQQHIEVVGKLGSTYGIRGWLRIYSSTEQAESIFDYQPWFLKIKGEWQSIELENWR 60

Query: 55  RKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGK 114
             N   I    G+D+  +A  L ++++      F +  LEE +++  DL      + +G 
Sbjct: 61  YHNHEIIVKLKGVDDRETAQILANVEIGVDLSVFPE--LEEGDYYWHDLIGCTVVNLEGY 118

Query: 115 YWGQVCGVYNFGAGSILEIKNT-----MEKTFLIPFT-KFAVLEVNLQENKILID 163
             G V  +   G+  +L +K        ++  LIPF  +  V  V+L    I +D
Sbjct: 119 TMGTVTEMMETGSNDVLVVKANTKDAFGKQERLIPFLYEQVVKRVDLTTKTIEVD 173


>gi|260580915|ref|ZP_05848739.1| 16S rRNA processing protein RimM [Haemophilus influenzae RdAW]
 gi|1176008|sp|P44568|RIMM_HAEIN RecName: Full=Ribosome maturation factor rimM
 gi|1573163|gb|AAC21872.1| conserved hypothetical protein [Haemophilus influenzae Rd KW20]
 gi|260092404|gb|EEW76343.1| 16S rRNA processing protein RimM [Haemophilus influenzae RdAW]
          Length = 178

 Score =  127 bits (320), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 35/175 (20%), Positives = 74/175 (42%), Gaps = 14/175 (8%)

Query: 1   MVKLDK--LVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMY 54
           M  +++  + ++  +G+T+G+ G + I S       +  Y  +      + + + +    
Sbjct: 1   MKNMEQQHIEVVGKLGSTYGIRGWLRIYSSTEQAESIFDYQPWFLKIKGEWQSIELENWR 60

Query: 55  RKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGK 114
             N   I    G+D+  +A  L ++++      F +  LEE +++  DL      + +G 
Sbjct: 61  YHNHEIIVKLKGVDDREAAQILANVEIGVDLSVFPE--LEEGDYYWHDLIGCTVVNLEGY 118

Query: 115 YWGQVCGVYNFGAGSILEIKNT-----MEKTFLIPFT-KFAVLEVNLQENKILID 163
             G V  +   G+  +L +K        ++  LIPF  +  V  V+L    I +D
Sbjct: 119 TMGTVTEMMETGSNDVLVVKANTKDAFGKQERLIPFLYEQVVKRVDLTTKTIEVD 173


>gi|238798964|ref|ZP_04642427.1| Ribosome maturation factor rimM [Yersinia mollaretii ATCC 43969]
 gi|238717193|gb|EEQ09046.1| Ribosome maturation factor rimM [Yersinia mollaretii ATCC 43969]
          Length = 186

 Score =  127 bits (320), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 30/173 (17%), Positives = 75/173 (43%), Gaps = 12/173 (6%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRF 60
           ++ +++  +G+T+G+ G + + S   N   +  Y  +        + + +    R ++  
Sbjct: 15  EQPIVLGKMGSTYGIRGWLRVFSSTENAESIFDYQPWFIQQAGKWQHVELEDWKRHSQDL 74

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           I    G+D+  +A+ L + ++    +      LEED+++  DL   +     G   G++ 
Sbjct: 75  IIKVKGVDDRDAANLLTNCEIIVDSKQLPA--LEEDDYYWKDLMGCQVVTTTGYELGKII 132

Query: 121 GVYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILIDPIAA 167
            +   G+  ++ +K  ++     K  L+PF     +  V+L   ++ +D    
Sbjct: 133 DMMETGSNDVMVVKANLKDAFGMKERLVPFLHGQVIKNVDLTAQRVEVDWDPG 185


>gi|289578451|ref|YP_003477078.1| 16S rRNA processing protein RimM [Thermoanaerobacter italicus Ab9]
 gi|297544727|ref|YP_003677029.1| 16S rRNA processing protein RimM [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
 gi|289528164|gb|ADD02516.1| 16S rRNA processing protein RimM [Thermoanaerobacter italicus Ab9]
 gi|296842502|gb|ADH61018.1| 16S rRNA processing protein RimM [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
          Length = 167

 Score =  127 bits (320), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 44/170 (25%), Positives = 74/170 (43%), Gaps = 8/170 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLN--RYVLYSND---NRELRILKMYRKNK 58
           +     +  + + HG+ GEV +    N P       YV   +D    R+  I  +   +K
Sbjct: 1   MADYYNVGKVTSAHGIKGEVKVYPLTNVPERFYELEYVWVFDDQQRPRKYDIEYVKIISK 60

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
           R      GIDN   A +L+   L    Q+    +LE+DE+F  DL  M+ +  +G + G 
Sbjct: 61  RVCVKLKGIDNRDEAEKLKGAFLKVDSQN--ALKLEKDEYFIKDLIGMKVYTEEGDFVGT 118

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAG 168
           +  V   GA  +  IK   E+  LIP  K  V +V++    +++  +   
Sbjct: 119 LVEVLQTGANDVYVIKGE-EREILIPAIKEVVKKVDVDNKVMVVHLLEGL 167


>gi|254776207|ref|ZP_05217723.1| 16S rRNA-processing protein RimM [Mycobacterium avium subsp. avium
           ATCC 25291]
          Length = 175

 Score =  127 bits (320), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 34/173 (19%), Positives = 69/173 (39%), Gaps = 11/173 (6%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPID-------LNRYVLYSNDNRELRILKMYRKNKRF 60
           + +  +   HG++GE+ ++   ++P         L          R   I        R 
Sbjct: 3   LTVGRVVKAHGISGEIVVEIRTDDPAARLAPGNTLRAKPSRGGPERSCVIESAREHGGRL 62

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           +   +G+ +  +A  LR         +  D +  +  + +  LE ++     G+  G V 
Sbjct: 63  LVRLAGVTDRDAADALRGTLFVVDSAELPDIDEPDTYYDH-QLEGLQVRTTGGRRVGAVA 121

Query: 121 GVYNFGAGSILEIKNTME---KTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
            V +  AG +L +++  +   +  L+PF    V  V+L++  I IDP    L+
Sbjct: 122 EVLHTAAGELLAVRDDADGAPREVLVPFVSAIVTAVSLEDGLIEIDPPDGLLD 174


>gi|281412660|ref|YP_003346739.1| 16S rRNA processing protein RimM [Thermotoga naphthophila RKU-10]
 gi|281373763|gb|ADA67325.1| 16S rRNA processing protein RimM [Thermotoga naphthophila RKU-10]
          Length = 176

 Score =  127 bits (320), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 44/169 (26%), Positives = 87/169 (51%), Gaps = 9/169 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPI---DLNRYVLYSNDNRELRI---LKMYRKN 57
           LD+ V +  I  THGL GEV    Y N+     +L+  +LY+++ +         + R N
Sbjct: 9   LDERVAIGKIVNTHGLKGEVKFFPYTNSEEIVKNLSDVILYNSEKKAFYNLTVESVRRMN 68

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
           K F+  F  ID I +A +++  +++ K ++    +L EDE++  ++ + + F   G+  G
Sbjct: 69  KLFLIRFKSIDTIEAAEKIKGCEVFVKYEELP--KLNEDEYYFYEILDCDVFYESGENVG 126

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIA 166
           +V  +   G+  +L ++   +K  LIP TK  ++E++    +I+   + 
Sbjct: 127 KVVDIIETGSNDVLVVR-KKKKETLIPMTKDCIVEIDKGAKRIIAKEME 174


>gi|332981638|ref|YP_004463079.1| 16S rRNA processing protein RimM [Mahella australiensis 50-1 BON]
 gi|332699316|gb|AEE96257.1| 16S rRNA processing protein RimM [Mahella australiensis 50-1 BON]
          Length = 168

 Score =  127 bits (320), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 37/171 (21%), Positives = 80/171 (46%), Gaps = 7/171 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR----YVLYSNDNRELRILKMYRKNKR 59
           + + +++  I   HG++GE+ I    ++    +     Y+   +D    R+ ++   N  
Sbjct: 1   MQEYLIIGRILKPHGVSGEMKIQPLTDDIRRFDDLKCAYIKDKDDMFPHRVERVKYGNDV 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
                 GID++++A EL +  L+  RQ      L E  ++  D+     +   G Y G+V
Sbjct: 61  VYIKLEGIDDMNAARELVNKHLWVDRQH--AAPLPEGSYYVGDIIGCRVYTVDGVYLGEV 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
             V   G+  + ++ +  +K  LIP  K  +  ++++  +I+I+P+   L+
Sbjct: 119 KEVLPTGSNDVYDVVD-GQKQVLIPAIKDVIKTIDIEGERIVIEPMEGLLD 168


>gi|262089685|gb|ACY24780.1| RimM 16S rRNA processing protein [uncultured organism]
          Length = 179

 Score =  127 bits (320), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 36/176 (20%), Positives = 73/176 (41%), Gaps = 15/176 (8%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDN----RELRILKMYRK 56
           M     LV +  I   +G+ G V + SY +   +L  Y  +        +++ I +    
Sbjct: 1   MSAESNLVNVGRITAVYGVKGWVKVHSYTDPQENLFEYHPWFLKTKHGVKKIEIDEARPH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQ---- 112
              F+A   GID+   A +     +        +  L++ E++ + LE +  F +     
Sbjct: 61  GDAFVAHIVGIDDRDLALQYTAADIAVDSDLLPE--LDDGEYYWSQLEGLVVFAQFDGGE 118

Query: 113 GKYWGQVCGVYNFGAGSILEI----KNTMEKTFLIPFTKF-AVLEVNLQENKILID 163
            +  G +  +   GA  +L +    ++  ++  LIP+     VL V+L   ++L+D
Sbjct: 119 RQRLGVISKLMETGANDVLVVVADAESIDQRERLIPYVPEQFVLSVDLGAGEMLVD 174


>gi|167037686|ref|YP_001665264.1| 16S rRNA-processing protein RimM [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|167040347|ref|YP_001663332.1| 16S rRNA-processing protein RimM [Thermoanaerobacter sp. X514]
 gi|256750720|ref|ZP_05491605.1| 16S rRNA processing protein RimM [Thermoanaerobacter ethanolicus
           CCSD1]
 gi|300914431|ref|ZP_07131747.1| 16S rRNA processing protein RimM [Thermoanaerobacter sp. X561]
 gi|307724333|ref|YP_003904084.1| 16S rRNA processing protein RimM [Thermoanaerobacter sp. X513]
 gi|320116101|ref|YP_004186260.1| 16S rRNA processing protein RimM [Thermoanaerobacter brockii subsp.
           finnii Ako-1]
 gi|326389500|ref|ZP_08211067.1| 16S rRNA processing protein RimM [Thermoanaerobacter ethanolicus JW
           200]
 gi|238687582|sp|B0K1U8|RIMM_THEPX RecName: Full=Ribosome maturation factor rimM
 gi|238687661|sp|B0K9W5|RIMM_THEP3 RecName: Full=Ribosome maturation factor rimM
 gi|166854587|gb|ABY92996.1| 16S rRNA processing protein RimM [Thermoanaerobacter sp. X514]
 gi|166856520|gb|ABY94928.1| 16S rRNA processing protein RimM [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|256750303|gb|EEU63322.1| 16S rRNA processing protein RimM [Thermoanaerobacter ethanolicus
           CCSD1]
 gi|300889366|gb|EFK84512.1| 16S rRNA processing protein RimM [Thermoanaerobacter sp. X561]
 gi|307581394|gb|ADN54793.1| 16S rRNA processing protein RimM [Thermoanaerobacter sp. X513]
 gi|319929192|gb|ADV79877.1| 16S rRNA processing protein RimM [Thermoanaerobacter brockii subsp.
           finnii Ako-1]
 gi|325994505|gb|EGD52930.1| 16S rRNA processing protein RimM [Thermoanaerobacter ethanolicus JW
           200]
          Length = 167

 Score =  127 bits (320), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 39/170 (22%), Positives = 70/170 (41%), Gaps = 8/170 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY---VLYSNDNRELRI--LKMYRKNK 58
           +     +  + + HG+ GEV +    N P          ++ +  R  +     +   +K
Sbjct: 1   MADYYNVGKVTSAHGIKGEVKVYPLTNVPERFYDLEYVWIFDDQQRPHKYDIEYVKIISK 60

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
                  GID    A +L+   L    Q+    ELEE+E+F  DL  M+ +  +G + G 
Sbjct: 61  GVCVKLKGIDTRGDAEKLKGAFLKVDSQN--ALELEENEYFIKDLVGMKVYTEEGSFLGT 118

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAG 168
           +  V   GA  +  IK   E+  LIP  K  V +V++    +++  +   
Sbjct: 119 LVEVLKTGANDVYVIKTE-EREILIPAIKEVVKKVDVDNKVMVVHLLEGL 167


>gi|297242900|ref|ZP_06926838.1| 16S rRNA-processing protein rimM [Gardnerella vaginalis AMD]
 gi|296889111|gb|EFH27845.1| 16S rRNA-processing protein rimM [Gardnerella vaginalis AMD]
          Length = 199

 Score =  127 bits (320), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 44/180 (24%), Positives = 76/180 (42%), Gaps = 17/180 (9%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR---YVLYSNDNRELRILKMYRKNKRFI 61
           + L+ +  IG   GL GEV +  + + P +       +  ++  RE  I        R+I
Sbjct: 18  NDLLRVCRIGKAQGLKGEVTVQIFTDEPYERFEPGNVLCTADGEREFVIENARTFKNRWI 77

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQG-------K 114
             F    N + A  L   +LY   +D ++   E   +   DL  ++    +        K
Sbjct: 78  LLFEESQNRNDAEALNGTELYVHAEDAQELAAENAWYIK-DLVGLQARLCEENQLGLTPK 136

Query: 115 YWGQVCGVYNFGAGSILEIK-----NTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
             G+V  V + GA S+L+I+     +   KT L+PF +  V EV++    + IDP    +
Sbjct: 137 VIGKVVDVLD-GAQSLLKIRLDHPIDEENKTALVPFVEAIVPEVDVANGYLTIDPPGGLI 195


>gi|253682584|ref|ZP_04863381.1| 16S rRNA processing protein RimM [Clostridium botulinum D str.
           1873]
 gi|253562296|gb|EES91748.1| 16S rRNA processing protein RimM [Clostridium botulinum D str.
           1873]
          Length = 162

 Score =  127 bits (319), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 32/163 (19%), Positives = 69/163 (42%), Gaps = 4/163 (2%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIAT 63
           +++ + +  I  THGL GE+ +    ++     +      D   + I     +  + I  
Sbjct: 1   MEQFLAVGKIINTHGLKGEIKLLPSTDDVERFKQLKKAYIDGEVIEIEGCKFQPGKVILK 60

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
              +D+I  A  L++  +   R++    +L E  ++  D+     +D   K  G++  + 
Sbjct: 61  IKDVDSIEQAQRLKNKYIKVSREN--AAKLPEGCYYEADIVGCIVYDENDKELGKIDEII 118

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIA 166
             G+  +  IK       LIP  K  ++ +++   KI+I P+ 
Sbjct: 119 RTGSNDVYWIKGKN--ELLIPAIKSVIVTIDVNSKKIVIKPLE 159


>gi|309811487|ref|ZP_07705269.1| 16S rRNA processing protein RimM [Dermacoccus sp. Ellin185]
 gi|308434538|gb|EFP58388.1| 16S rRNA processing protein RimM [Dermacoccus sp. Ellin185]
          Length = 190

 Score =  127 bits (319), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 43/191 (22%), Positives = 77/191 (40%), Gaps = 12/191 (6%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLN----RYVLYSNDNRELRILKMYRKNKR 59
           +D  V++A IG  HGL GEV +  + ++P         +         L +      N  
Sbjct: 1   MDD-VVVARIGKAHGLKGEVTVQLHTDSPEQRFVPGETFETEPASRGPLTLRLARVHNGL 59

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +  F    +  +A  LR +KL A+     D+  E+D ++  DL   +     G+  G V
Sbjct: 60  HLLAFDEAPDRTAAEGLRGIKLLAEA----DDLDEDDAWYEEDLLGFDV-VVAGEKVGVV 114

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQY 179
             + +     +L +        L+PF +  V E++     +++ P    L+      P  
Sbjct: 115 KALESREVQDLLVVDGVEGYDILVPFVEEIVPEIDEDARVVVVTPPPGLLDLARPDAP-- 172

Query: 180 DCPLDSAGKKS 190
           D P DSA  ++
Sbjct: 173 DAPDDSAALEA 183


>gi|225022024|ref|ZP_03711216.1| hypothetical protein CORMATOL_02056 [Corynebacterium matruchotii
           ATCC 33806]
 gi|224945221|gb|EEG26430.1| hypothetical protein CORMATOL_02056 [Corynebacterium matruchotii
           ATCC 33806]
          Length = 169

 Score =  127 bits (319), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 41/174 (23%), Positives = 76/174 (43%), Gaps = 11/174 (6%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNR-----ELRILKMYRK 56
           + ++  +++  +   HG+ GEV +D   + P          +  +      L +      
Sbjct: 1   MLME--LMIGRVIKAHGIRGEVVVDPTTDEPDIRYAPGTVLHGKQGKREYTLTVAHARPH 58

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
             R + TF  + +  +A  LR  + +A++ D  D   +E+ F++ DL  +      G   
Sbjct: 59  QGRLLVTFDEVPDRTAAESLRGTQFWAEQLDIDD---DEEGFYDHDLTGLRVIHE-GAEI 114

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           G V GV +  AG+ILE++    K  L+PF    V +V+L+     I P    L+
Sbjct: 115 GTVTGVMSGPAGTILEVELAGGKQALVPFVFDIVPDVDLEAGTCTITPPDGLLD 168


>gi|258543989|ref|ZP_05704223.1| 16S rRNA processing protein RimM [Cardiobacterium hominis ATCC
           15826]
 gi|258520767|gb|EEV89626.1| 16S rRNA processing protein RimM [Cardiobacterium hominis ATCC
           15826]
          Length = 182

 Score =  127 bits (319), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 43/170 (25%), Positives = 74/170 (43%), Gaps = 9/170 (5%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS--NDNRE---LRILKMYR 55
           M      +++  I   HG+ G+V + S       L +Y  +    + R    L++L+   
Sbjct: 1   MSHDSADIIVGRIVGVHGIRGQVKVHSDCRPRESLFQYRQFIARQNGRPDIALQLLRGQT 60

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
             K  +A F+GI++   A  L    LY  R      +  + E++  DL  +   +RQG  
Sbjct: 61  SGKGLVAAFTGINDRDQALALGGYTLYISRDQLPAPQ--DGEYYWADLIGLRVENRQGIT 118

Query: 116 WGQVCGVYNFGAGSILEIKNTMEK-TFLIPFTKF-AVLEVNLQENKILID 163
            G+V  ++  GA  IL +K    K   LIPF +   V  ++L    + +D
Sbjct: 119 LGRVSELFETGANDILVVKADNSKAEILIPFVRPRYVEAIDLANGLMRVD 168


>gi|296394373|ref|YP_003659257.1| 16S rRNA processing protein RimM [Segniliparus rotundus DSM 44985]
 gi|296181520|gb|ADG98426.1| 16S rRNA processing protein RimM [Segniliparus rotundus DSM 44985]
          Length = 171

 Score =  127 bits (319), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 34/169 (20%), Positives = 65/169 (38%), Gaps = 8/169 (4%)

Query: 10  MATIGTTHGLNGEVYIDSYANNPIDLN--------RYVLYSNDNRELRILKMYRKNKRFI 61
           +  I  +HGL GEV ++   ++P            R       ++ L +L         +
Sbjct: 2   VGRIAKSHGLTGEVAVEIRTDDPERRFAPGSTLLLRMPKAKQADKALHVLSAREHASHLL 61

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
            TF+ + +  +A  LR   L  + +D    E  ++ + +  +         G   G+V  
Sbjct: 62  VTFAEVMDRAAADSLRGALLVVRTEDLPPSEDPDEFYDHELVGLRIVDRAGGGELGEVAD 121

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           V +   G  L  +    +  L+PF    V+EV+L E    ++     L+
Sbjct: 122 VVHSAGGDWLVARVEGGREVLVPFVAAIVVEVSLAEKTAWVELPEGLLD 170


>gi|251779615|ref|ZP_04822535.1| 16S rRNA processing protein RimM [Clostridium botulinum E1 str.
           'BoNT E Beluga']
 gi|243083930|gb|EES49820.1| 16S rRNA processing protein RimM [Clostridium botulinum E1 str.
           'BoNT E Beluga']
          Length = 165

 Score =  127 bits (319), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 36/169 (21%), Positives = 70/169 (41%), Gaps = 4/169 (2%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIAT 63
           ++++  +  I  THG+ GEV +     +     +      D  +  I  +  +  R I  
Sbjct: 1   MEEIFKIGQIVNTHGIKGEVKVYPLTEDVNKFKKLKTVLIDGEDRNIQSVKFQKDRVILK 60

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
             GID ++ A   +   +   R +  +  LE D  +  DL     +D      G++  V 
Sbjct: 61  IEGIDTMNDAETYKQKYIEIFRSNAPE--LEADTHYIVDLIGCMVYDADNMELGKIFDVI 118

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNT 172
           +  +  +  IK    K  LIP  K  VL+++++  KI++ P+    +  
Sbjct: 119 STPSNDVYWIKQP--KELLIPVLKDIVLDIDIENKKIVVKPVRQWQDED 165


>gi|188992534|ref|YP_001904544.1| 16S rRNA-processing protein RimM [Xanthomonas campestris pv.
           campestris str. B100]
 gi|229890157|sp|B0RXD8|RIMM_XANCB RecName: Full=Ribosome maturation factor rimM
 gi|167734294|emb|CAP52504.1| 16S rRNA processing protein RimM [Xanthomonas campestris pv.
           campestris]
          Length = 170

 Score =  127 bits (319), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 34/169 (20%), Positives = 75/169 (44%), Gaps = 10/169 (5%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY-----SNDNRELRILKMYR 55
           M   ++ +L+  I    G+ GE+ ++S+      + RY  +     S     L  ++   
Sbjct: 1   MKPTERRILLGRIVGAFGVKGELKLESWTEPRSAIFRYQPWIVRTPSGQESVLSGVRGRD 60

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
           + K  IA F  I +  +   +   ++Y  R      + +E  ++  DLE ++    +G  
Sbjct: 61  QGKNLIAVFPDITDRDTVEAMHGTEIYVARSALPPPKPDE--YYWVDLEGLQVETVEGIK 118

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFT-KFAVLEVNLQENKILID 163
            G V  +++ G+  ++ ++   ++  +IPF     V  V+ + N I++D
Sbjct: 119 LGAVSHLFSTGSNDVVVVR--GDRERMIPFVLPEYVKSVDFEANLIVVD 165


>gi|284802239|ref|YP_003414104.1| hypothetical protein LM5578_1995 [Listeria monocytogenes 08-5578]
 gi|284995381|ref|YP_003417149.1| hypothetical protein LM5923_1946 [Listeria monocytogenes 08-5923]
 gi|284057801|gb|ADB68742.1| hypothetical protein LM5578_1995 [Listeria monocytogenes 08-5578]
 gi|284060848|gb|ADB71787.1| hypothetical protein LM5923_1946 [Listeria monocytogenes 08-5923]
          Length = 169

 Score =  127 bits (319), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 38/171 (22%), Positives = 71/171 (41%), Gaps = 9/171 (5%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNR-------YVLYSNDNRELRILKMYRKNKR 59
           +  +  I  THGL GE+ + +  + P +  +       +   S    +L I    +    
Sbjct: 1   MYNVGKIVNTHGLIGEIRVIATTDFPEERFQVGNTVYLFEKNSKKPEKLIIRSHRKHKNF 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +  F G   IH    +++  L  K        LEE+EF+  ++         G+  G++
Sbjct: 61  DLLMFEGFTGIHQVERMKEGVLKIKETQL--TNLEENEFYFHEIIGCTVVTTDGEELGEI 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
             +   GA  +  +K   +K  LIP+    V E+N+ + KI I+ +   L+
Sbjct: 119 TEILTPGANDVWVVKGADKKEKLIPYIADVVKEINIDDQKITIEVMEGLLD 169


>gi|290893076|ref|ZP_06556065.1| 16S rRNA processing protein RimM [Listeria monocytogenes FSL
           J2-071]
 gi|290557436|gb|EFD90961.1| 16S rRNA processing protein RimM [Listeria monocytogenes FSL
           J2-071]
 gi|307571375|emb|CAR84554.1| 16S rRNA processing protein [Listeria monocytogenes L99]
          Length = 169

 Score =  127 bits (319), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 38/171 (22%), Positives = 73/171 (42%), Gaps = 9/171 (5%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNR-------YVLYSNDNRELRILKMYRKNKR 59
           +  +  I  THGL GE+ + +  + P +  +       +   S    +L I    +    
Sbjct: 1   MYNVGKIVNTHGLIGEIRVIATTDFPEERFQVGNTVYLFEKNSKKPEKLIIRSHRKHKNF 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +  F G   IH    +++  L  K       +LEE+EF+  ++         G+  G++
Sbjct: 61  DLLMFEGFTGIHQVERMKEGVLKIKEAQL--TDLEENEFYFHEIIGCTVVTTDGEELGEI 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
             +   GA  +  +K + +K  LIP+    V E+N+ + KI I+ +   L+
Sbjct: 119 TEILTPGANDVWVVKGSDKKEKLIPYIADVVKEININDKKITIEVMEGLLD 169


>gi|313115223|ref|ZP_07800706.1| 16S rRNA processing protein RimM [Faecalibacterium cf. prausnitzii
           KLE1255]
 gi|310622452|gb|EFQ05924.1| 16S rRNA processing protein RimM [Faecalibacterium cf. prausnitzii
           KLE1255]
          Length = 178

 Score =  127 bits (319), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 39/181 (21%), Positives = 76/181 (41%), Gaps = 7/181 (3%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYAN---NPIDLNRYVLYSNDNRELRILKMYRKNKRF 60
           + + +    + TTHG+ GE+ ++ + +       + R    +   R  +I+ +  + +  
Sbjct: 1   MQQYLEAGKVVTTHGVRGEMKLELWCDGVNFLKKVGRLYPSAQGGRAYKIVSIRAQGQMA 60

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFD-RQGKYWGQV 119
           +    G+D++ +A  LR    Y  R D     L    ++  DL   E  D   G+ +G V
Sbjct: 61  LLQLEGVDDMDAARALRGQVFYFDRND---ATLPAGRWYVADLIGCEVRDADTGRVYGVV 117

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQY 179
             V + GA  I  +K    K ++ P     + E N  E  +L+ PI   L++      + 
Sbjct: 118 TSVDHPGAQDIYTVKAPNGKEYMFPGVDAFLKERNPPEGYLLVTPIPGLLDDDFDSEREE 177

Query: 180 D 180
           +
Sbjct: 178 E 178


>gi|220934026|ref|YP_002512925.1| 16S rRNA processing protein RimM [Thioalkalivibrio sp. HL-EbGR7]
 gi|219995336|gb|ACL71938.1| 16S rRNA processing protein RimM [Thioalkalivibrio sp. HL-EbGR7]
          Length = 167

 Score =  127 bits (319), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 34/166 (20%), Positives = 75/166 (45%), Gaps = 10/166 (6%)

Query: 4   LDKL-VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVL----YSNDNRELRILKMYRKNK 58
           +++  +++  +   +G+ G V + S      ++ RY      +    RE R++      K
Sbjct: 1   MERRSIVLGRVTGLYGVQGWVKVFSETRPREEIVRYNPVLLGHEGQWRETRVVGGKAHGK 60

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
             +  F G D+  +A+ L   ++   R+      L + E++  DL  +E     G+  G 
Sbjct: 61  GVVMKFQGCDDRDAAAALMGQEIAVWREQL--ARLPKGEYYWADLVGLEVVTTGGESLGV 118

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTK-FAVLEVNLQENKILID 163
           V  ++  GA  ++ +K   ++  LIP+ +   V +V+L+   + +D
Sbjct: 119 VDSLFETGANDVIVVK--GDRERLIPYVRGEFVRDVDLEAGTLTVD 162


>gi|253997438|ref|YP_003049502.1| 16S rRNA processing protein RimM [Methylotenera mobilis JLW8]
 gi|253984117|gb|ACT48975.1| 16S rRNA processing protein RimM [Methylotenera mobilis JLW8]
          Length = 196

 Score =  127 bits (319), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 39/193 (20%), Positives = 75/193 (38%), Gaps = 33/193 (17%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKN 57
           + +D +V+M  I   +G+ G + +         L  Y  +     +D RE+ +      N
Sbjct: 1   MAVDNMVVMGRIVAPYGVYGWLKVVPDTEAIDGLFDYDSWWLGKGDDWREMVVETAKIHN 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              +    GID+  +A   +  ++   R    +   +E+E++ +DL  +   + QG  +G
Sbjct: 61  DVIVVKLVGIDDRDAAFACKGKQIAVPRAQLPEP--DENEYYWSDLVGLRVTNSQGVDFG 118

Query: 118 QVCGVYNFGAGSILEIKN---------------------------TMEKTFLIPFTKFAV 150
            +  V+  GA  +L +K                               +  LIPF    V
Sbjct: 119 VITEVFETGANDVLVVKPDALVKPDSSAKADSKAKSDAVPVEAGKDKPQERLIPFVADVV 178

Query: 151 LEVNLQENKILID 163
           L V+L+   +L+D
Sbjct: 179 LTVDLEAKSMLVD 191


>gi|317133000|ref|YP_004092314.1| 16S rRNA processing protein RimM [Ethanoligenens harbinense YUAN-3]
 gi|315470979|gb|ADU27583.1| 16S rRNA processing protein RimM [Ethanoligenens harbinense YUAN-3]
          Length = 173

 Score =  127 bits (319), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 39/176 (22%), Positives = 67/176 (38%), Gaps = 7/176 (3%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY--VLYSNDNRELRIL-KMYRKNK 58
           +   + +    I  T GL GEV +  + ++P  L ++       + +  R +        
Sbjct: 1   MARKRFLETGKIVATQGLRGEVRVQPWCDSPDFLLQFGGFFLDGEGKNYRKVTDARVHKH 60

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDR-QGKYWG 117
             +  F G + +  A  L    LY  R   K  +L E   F  DL  M+  D   G  +G
Sbjct: 61  MAVLKFEGAETVEDAMALLRRVLYIDR---KTVDLPEGSHFEQDLIGMDVVDAGDGHAYG 117

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTT 173
           ++  V   GA  +  + +   K  LIP     V EV+     + I P+    ++  
Sbjct: 118 KLTEVLRTGANDVYTVTDAAGKEVLIPAIPDVVREVDTDAGVMHITPLKGLFDDAD 173


>gi|114328348|ref|YP_745505.1| 16S rRNA processing protein rimM [Granulibacter bethesdensis
           CGDNIH1]
 gi|122326694|sp|Q0BRH0|RIMM_GRABC RecName: Full=Ribosome maturation factor rimM
 gi|114316522|gb|ABI62582.1| 16S rRNA processing protein rimM [Granulibacter bethesdensis
           CGDNIH1]
          Length = 186

 Score =  127 bits (319), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 52/192 (27%), Positives = 90/192 (46%), Gaps = 8/192 (4%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRF 60
           M +   L+L+  IG  HG+ G V++ SY  +P DL  Y L  ++     +L         
Sbjct: 1   MSR--DLILLGVIGRPHGVRGLVHVVSYTADPDDLTAYGLLHDEAGRQIMLDWRADGLAG 58

Query: 61  I-ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGK-YWGQ 118
           I      + +  +A  L + +L+  R      E +ED+F+  DL  +E      +   GQ
Sbjct: 59  ITIDGVPVQDRSAAERLTNTRLFINRDALPPVE-DEDDFYLVDLIGLEARLVADETLLGQ 117

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQ 178
           V  V+++GAG+ LEI  +   + L+PFT+ AV  V++   ++LIDP          +  +
Sbjct: 118 VAQVHDYGAGASLEITRSGGASLLVPFTRAAVPVVDIAAGRVLIDPPQ---EENAPEFGR 174

Query: 179 YDCPLDSAGKKS 190
            +   D  G+ +
Sbjct: 175 NELGHDDGGEAA 186


>gi|15644316|ref|NP_229368.1| 16S rRNA processing protein, putative [Thermotoga maritima MSB8]
 gi|148270354|ref|YP_001244814.1| 16S rRNA processing protein RimM [Thermotoga petrophila RKU-1]
 gi|170289020|ref|YP_001739258.1| 16S rRNA processing protein RimM [Thermotoga sp. RQ2]
 gi|6685868|sp|Q9X1Q4|RIMM_THEMA RecName: Full=Ribosome maturation factor rimM
 gi|166226486|sp|A5IM15|RIMM_THEP1 RecName: Full=Ribosome maturation factor rimM
 gi|4982137|gb|AAD36635.1|AE001802_4 16S rRNA processing protein, putative [Thermotoga maritima MSB8]
 gi|147735898|gb|ABQ47238.1| 16S rRNA processing protein RimM [Thermotoga petrophila RKU-1]
 gi|170176523|gb|ACB09575.1| 16S rRNA processing protein RimM [Thermotoga sp. RQ2]
          Length = 176

 Score =  127 bits (319), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 45/169 (26%), Positives = 86/169 (50%), Gaps = 9/169 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPI---DLNRYVLYSNDNRELRI---LKMYRKN 57
           L++ V +  I  THGL GEV    Y N+     +L+  VLY+++ +         + R N
Sbjct: 9   LNERVAIGKIVNTHGLKGEVKFFPYTNSEEIVKNLSSVVLYNSEKKAFYNLTVESVRRMN 68

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
           K F+  F  ID I +A  ++  +++ K ++    +L EDE++  ++ + + F   G+  G
Sbjct: 69  KLFLIRFKSIDTIEAAERIKGCEVFIKYEELP--KLSEDEYYFYEILDCDVFYESGENVG 126

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIA 166
           +V  +   G+  +L ++   +K  LIP TK  ++E++    KI+   + 
Sbjct: 127 KVVDIIETGSNDVLVVR-KKKKETLIPMTKDCIVEIDKGAKKIIAKEME 174


>gi|284007747|emb|CBA73567.1| 16S rRNA processing protein [Arsenophonus nasoniae]
          Length = 185

 Score =  127 bits (319), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 35/172 (20%), Positives = 68/172 (39%), Gaps = 12/172 (6%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRFI 61
             +++  +G+ HG+ G + + S      D+  Y  +        ++L +      N+  I
Sbjct: 15  NPIVLGKLGSAHGIRGWLRVFSSTEYTEDIFEYQPWFIQRSGQWQQLELEGWKHHNQDII 74

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
                ID+  +A+ + + ++           LE +E++  DL   +    +G   G V  
Sbjct: 75  IKIKHIDDRSAANSMTNCEIIVDSAQLP--VLEGNEYYWKDLIGCQVITTKGYSLGFVQD 132

Query: 122 VYNFGAGSILEIKNTME-----KTFLIPFTKF-AVLEVNLQENKILIDPIAA 167
           +   G+  +L IK  ++     K  LIPF     V  V+L    I +D    
Sbjct: 133 LMETGSNDVLVIKANLKDAFGIKERLIPFLDEQVVKNVDLTTKIIEVDWDPG 184


>gi|290476250|ref|YP_003469150.1| 16S rRNA processing protein [Xenorhabdus bovienii SS-2004]
 gi|289175583|emb|CBJ82386.1| 16S rRNA processing protein [Xenorhabdus bovienii SS-2004]
          Length = 182

 Score =  126 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 29/168 (17%), Positives = 67/168 (39%), Gaps = 12/168 (7%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRFI 61
             +++  +G+T+G+ G + + S      D+  Y  +        + + +      N+  I
Sbjct: 12  DPIVLGKLGSTYGIRGWLRVFSSTERTEDIFEYQPWFIQRSGQWQHVELETWKYHNQDLI 71

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
                ID+  +A+   + ++        +  LE  +++  DL   +     G   G +  
Sbjct: 72  IKIKDIDDRDAANLFTNCEVVVDSTKLPE--LETGDYYWKDLMGCQVISIAGYNLGTIND 129

Query: 122 VYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILID 163
           +   G+  ++ IK  ++     K  L+PF     + +V+L    I +D
Sbjct: 130 MMETGSNDVMVIKANLKDAFGIKERLVPFLDGQVIKKVDLATKTIEVD 177


>gi|42568351|ref|NP_568663.2| 16S rRNA processing protein RimM family [Arabidopsis thaliana]
 gi|10177579|dbj|BAB10810.1| unnamed protein product [Arabidopsis thaliana]
 gi|332008000|gb|AED95383.1| RimM-like 16S rRNA processing protein [Arabidopsis thaliana]
          Length = 653

 Score =  126 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 45/199 (22%), Positives = 77/199 (38%), Gaps = 25/199 (12%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYV---------LYSNDNRELRILKMYRK 56
            LV +  +   HGL GE+ I    + P                L  +   E+ +++    
Sbjct: 79  DLVEVGFLSGVHGLQGEICIKPNTDFPDLRFSKPGRRWLKQQLLGQDKIDEVELVEGRPH 138

Query: 57  --NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETF-DRQG 113
              K +I  F G+D++    +L    L A+  D  +  L+E EF++ DL  M       G
Sbjct: 139 PAQKSWILKFRGLDDVDQVRQLVGATLLAEDDDRPE--LDEGEFYSRDLVGMRVLLKETG 196

Query: 114 KYWGQVCGVYNFGAGSIL--------EIKNTMEKT---FLIPFTKFAVLEVNLQENKILI 162
           +  G V  +++ G   +L        E+ N   KT     IPF    V +V+L+  ++ I
Sbjct: 197 QLVGTVANIFDNGGNDLLHVLLDSSMEVCNGNAKTNQLVWIPFVDAIVPDVDLERKEMYI 256

Query: 163 DPIAAGLNNTTMKNPQYDC 181
            P    L      + +   
Sbjct: 257 TPPKGLLEVNMRADDRSKK 275


>gi|145641542|ref|ZP_01797120.1| 16S rRNA-processing protein [Haemophilus influenzae R3021]
 gi|145273833|gb|EDK13701.1| 16S rRNA-processing protein [Haemophilus influenzae 22.4-21]
          Length = 175

 Score =  126 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 34/165 (20%), Positives = 70/165 (42%), Gaps = 12/165 (7%)

Query: 9   LMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRFIATF 64
           ++  +G+T+G+ G + I S       +  Y  +      + + + +      N   I   
Sbjct: 8   VVGKLGSTYGIRGWLRIYSSTEQAESIFDYQPWFLKIKGEWQSIELENWRYHNHEIIVKL 67

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
            G+D+  +A  L ++++      F +  LEE +++  DL      + +G   G V  +  
Sbjct: 68  KGVDDRETAQILANVEIGVDLSVFPE--LEEGDYYWHDLIGCTVVNLEGYTMGTVTEMME 125

Query: 125 FGAGSILEIKNT-----MEKTFLIPFT-KFAVLEVNLQENKILID 163
            G+  +L +K        ++  LIPF  +  V  V+L   +I +D
Sbjct: 126 TGSNDVLVVKANTKDAFGKQERLIPFLYEQVVKRVDLTTKRIEVD 170


>gi|209573749|sp|A1R7G4|RIMM_ARTAT RecName: Full=Ribosome maturation factor rimM
          Length = 184

 Score =  126 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 43/184 (23%), Positives = 73/184 (39%), Gaps = 7/184 (3%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLN----RYVLYSNDNRELRILKMYRKNKRFIAT 63
           + +A IG  HG+ GEV +    + P +       +V+       L I          +  
Sbjct: 3   LQVARIGKPHGIRGEVTVQVLTDAPSERFVAGTEFVVEPASAGPLTIRSARWNKDILLLG 62

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
           F  I + ++A  +R  KL+ + ++  DE+ +E  +   +L  +E      +  G+V  + 
Sbjct: 63  FEEIADRNAAEVIRGAKLFIETEELSDEDDDEGWY-EHELVGLEARVGS-QVVGKVAALS 120

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN-NTTMKNPQYDCP 182
                 +L +     K  LIPF    V EVN++   ILI P +     N        D  
Sbjct: 121 TLPVQDLLTVTTEEGKEILIPFVDEIVPEVNVEGGYILITPPSGLFEINDENAKEPKDGA 180

Query: 183 LDSA 186
            D A
Sbjct: 181 GDDA 184


>gi|114798866|ref|YP_758775.1| 16S rRNA processing protein RimM [Hyphomonas neptunium ATCC 15444]
 gi|123323742|sp|Q0C668|RIMM_HYPNA RecName: Full=Ribosome maturation factor rimM
 gi|114739040|gb|ABI77165.1| 16S rRNA processing protein RimM [Hyphomonas neptunium ATCC 15444]
          Length = 181

 Score =  126 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 41/164 (25%), Positives = 71/164 (43%), Gaps = 5/164 (3%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNREL--RILKMYRKNKR 59
            K  +L+ M  +   HG+ GEV + S+  +P  L  Y    ++  ++    +        
Sbjct: 5   TKTQRLIPMGVLKGAHGVRGEVRVKSFTADPDALFTYGPLMDEAGKVLLTPITARPGKDH 64

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
           FI              LR   L+A R    +   +EDEF+  DL  M  +    +   +V
Sbjct: 65  FIVRPKENLQKEDWDALRGCLLHASRDQLPEA--DEDEFYFEDLIGMPVYTVGEEPEARV 122

Query: 120 CGVYNFGAGSILEIK-NTMEKTFLIPFTKFAVLEVNLQENKILI 162
             V NFG+G +LEI+      T  +P T+  V  +++  ++I+I
Sbjct: 123 RAVQNFGSGDLLEIEIPGAPATIYVPLTRADVPVIDMAAHRIVI 166


>gi|229541112|ref|ZP_04430172.1| 16S rRNA processing protein RimM [Bacillus coagulans 36D1]
 gi|229325532|gb|EEN91207.1| 16S rRNA processing protein RimM [Bacillus coagulans 36D1]
          Length = 172

 Score =  126 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 37/173 (21%), Positives = 75/173 (43%), Gaps = 9/173 (5%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR-------YVLYSNDNRELRILKMYRK 56
           + +   +  I  THG+ GEV + S  +   +  +       ++   ++   + I      
Sbjct: 1   MTQWFNVGKIVNTHGIRGEVRVISQTDFKAERYKPGNTLYLFLPGRDEPLAVTIESHRVH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
            +  +  F G D+I  A + +   L    +   +  L E+EF+  ++   E     G+  
Sbjct: 61  KQFDLLKFEGFDSIEEAEKWKGGMLKVSEEQLDE--LGENEFYFHEIIGCEVVTTAGEKV 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           G V  +   GA  +  +K   +K  LIP+ +  V +V+ +E +I+I+P+   L
Sbjct: 119 GTVKEILTPGANDVWVVKTAQQKEALIPYIEDVVKKVDKKEKRIVIEPMEGLL 171


>gi|218248799|ref|YP_002374170.1| 16S rRNA-processing protein RimM [Cyanothece sp. PCC 8801]
 gi|226694911|sp|B7K5W1|RIMM_CYAP8 RecName: Full=Ribosome maturation factor rimM
 gi|218169277|gb|ACK68014.1| 16S rRNA processing protein RimM [Cyanothece sp. PCC 8801]
          Length = 186

 Score =  126 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 44/187 (23%), Positives = 72/187 (38%), Gaps = 20/187 (10%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR--------YVLYSNDNRELRILK 52
           M   +  + +  I    GL GE+ + S ++ P    +            S    EL   +
Sbjct: 1   MDNSESWLEIGRIVAAQGLKGELKVMSSSDFPERFEKPGTRWLQSPDRLSIQEVELVRGR 60

Query: 53  MYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQ 112
                  ++   + I +   A  LRD  L     D    +L E E+  +DL  +  + +Q
Sbjct: 61  YVPGKNLYVIKLAEIADRTQAETLRDYTLLVPSSDRP--QLNEGEYHVSDLINLTVYHQQ 118

Query: 113 -GKYWGQVCGVYNFGAGSILEI--------KNTMEKTFLIPFTKFAVLEVNLQENKILID 163
            G+  G V  + + G   +LE+        +NT  K  LIPF    V  V+L   +I I+
Sbjct: 119 TGEEIGVVTDMLSAG-NDLLEVQLNTLNSSENTSSKKVLIPFVYEIVPVVDLVNKRIEIN 177

Query: 164 PIAAGLN 170
           P    L 
Sbjct: 178 PPVGLLE 184


>gi|309781071|ref|ZP_07675809.1| 16S rRNA processing protein RimM [Ralstonia sp. 5_7_47FAA]
 gi|308920137|gb|EFP65796.1| 16S rRNA processing protein RimM [Ralstonia sp. 5_7_47FAA]
          Length = 213

 Score =  126 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 38/169 (22%), Positives = 70/169 (41%), Gaps = 12/169 (7%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSN----------DNRELRILKMY 54
           D LV +  +G  +G+ G + +  + +    LN    +            D R   +    
Sbjct: 42  DDLVEVGYVGGAYGIRGWIKVQLHGDADALLNARTWWLKPAAGALATSADWRVFPVGTSR 101

Query: 55  RKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGK 114
             +   +A      + + A  LR   ++  R DF +   ++DEF+  DL      + Q +
Sbjct: 102 EHSGTVVAGSPAAPDRNVAEALRGYAVWVSRADFPEP--DDDEFYWVDLIGATVVNEQQE 159

Query: 115 YWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
             G V G+ + GA  IL +    E   L+PF +  V  V++   +I++D
Sbjct: 160 TLGTVGGLIDNGAHQILRVVGEGEVERLVPFVEVYVKSVDVAGKRIVVD 208


>gi|229845195|ref|ZP_04465329.1| 16S rRNA-processing protein [Haemophilus influenzae 6P18H1]
 gi|229811906|gb|EEP47601.1| 16S rRNA-processing protein [Haemophilus influenzae 6P18H1]
          Length = 175

 Score =  126 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 34/172 (19%), Positives = 73/172 (42%), Gaps = 12/172 (6%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKN 57
           ++  ++ ++  +G+T+G+ G + I S       +  Y  +      + + + +      N
Sbjct: 1   MEQQRIEVVGKLGSTYGIRGWLRIYSSTEQAESIFDYQPWFLKIKGEWQSIELENWRYHN 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              I    G+D+  +A  L ++++      F +  LEE +++  DL      + +G   G
Sbjct: 61  HEIIVKLKGVDDRETAQILANVEIGVDLSVFPE--LEEGDYYWHDLIGCTVVNLEGYTMG 118

Query: 118 QVCGVYNFGAGSILEIKNT-----MEKTFLIPFT-KFAVLEVNLQENKILID 163
            V  +   G+  +L +K        ++  LIPF  +  V  V+L    I +D
Sbjct: 119 TVTEMMETGSNDVLVVKANTKDAFGKQERLIPFLYEQVVKRVDLTTKTIEVD 170


>gi|238765367|ref|ZP_04626291.1| Ribosome maturation factor rimM [Yersinia kristensenii ATCC 33638]
 gi|238696409|gb|EEP89202.1| Ribosome maturation factor rimM [Yersinia kristensenii ATCC 33638]
          Length = 186

 Score =  126 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 31/173 (17%), Positives = 76/173 (43%), Gaps = 12/173 (6%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRKNKRF 60
           ++ +++  +G+T+G+ G + + S   N   +  Y  +        + + +    R ++  
Sbjct: 15  EQPIVLGKMGSTYGIRGWLRVFSSTENAESIFDYQPWFIQQDGKWQHVELEDWKRHSQDL 74

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           I    G+D+  +A+ L + ++    Q   +  LEED+++  DL   +     G   G++ 
Sbjct: 75  IIKVKGVDDRDAANLLTNCEIIVDSQQLPE--LEEDDYYWKDLMGCQVVTTAGYELGKII 132

Query: 121 GVYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILIDPIAA 167
            +   G+  ++ +K  ++     K  L+PF     +  V+L   ++ +D    
Sbjct: 133 DMMETGSNDVMVVKANLKDAFGMKERLVPFLHGQVIKNVDLTAQRVEVDWDPG 185


>gi|116490847|ref|YP_810391.1| 16S rRNA processing protein RimM [Oenococcus oeni PSU-1]
 gi|290890293|ref|ZP_06553372.1| hypothetical protein AWRIB429_0762 [Oenococcus oeni AWRIB429]
 gi|122276971|sp|Q04FP6|RIMM_OENOB RecName: Full=Ribosome maturation factor rimM
 gi|116091572|gb|ABJ56726.1| 16S rRNA processing protein RimM [Oenococcus oeni PSU-1]
 gi|290480079|gb|EFD88724.1| hypothetical protein AWRIB429_0762 [Oenococcus oeni AWRIB429]
          Length = 166

 Score =  126 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 34/166 (20%), Positives = 73/166 (43%), Gaps = 4/166 (2%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPI-DLNRYVLYSNDNRELRILKMYRKNKRFIATFSG 66
           + +  +  THG+ GE+ ID   + P     +         +L +       + ++  FS 
Sbjct: 4   LRIGRVINTHGIAGELKIDFNTDFPEQRFAKNSELLIAGEKLVVQSSRPFKQFWLVKFSD 63

Query: 67  IDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNFG 126
            +NI+   + +   ++    + K+  L E EF  + +  ++  D +G   G++   ++ G
Sbjct: 64  HENINLVEKYKGEDIFI--NERKEPRLSEGEFLVSQIIGLKVIDEKGNSIGEIADSFHTG 121

Query: 127 AGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNT 172
           A  +  IK +  K  LIP+    V +V+LQ + + I+ +    +  
Sbjct: 122 ANDVWTIKKSNGKEILIPYIDQVVKKVDLQTSTVTIELLEGL-DED 166


>gi|157369098|ref|YP_001477087.1| 16S rRNA-processing protein RimM [Serratia proteamaculans 568]
 gi|166985970|sp|A8GA19|RIMM_SERP5 RecName: Full=Ribosome maturation factor rimM
 gi|157320862|gb|ABV39959.1| 16S rRNA processing protein RimM [Serratia proteamaculans 568]
          Length = 182

 Score =  126 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 34/183 (18%), Positives = 75/183 (40%), Gaps = 18/183 (9%)

Query: 1   MVKL------DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRI 50
           M K        + +++  +G+T+G+ G + + S   N   +  Y  +    S   + + +
Sbjct: 1   MSKQLKPVAPKQPIVLGKMGSTYGIRGWLRVFSSTENAESIFDYQPWLIQRSGQWQFVEL 60

Query: 51  LKMYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFD 110
               R ++  I    GID+  +A+ L + ++    +      LE D+++  DL   +   
Sbjct: 61  EDWKRHSQDLIIKVKGIDDRDAANLLTNCEIVVDSEQLPP--LEGDDYYWKDLMGCQVVT 118

Query: 111 RQGKYWGQVCGVYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILIDP 164
             G   G+V  +   G+  ++ ++  ++     K  L+PF     + +V+L    I  D 
Sbjct: 119 TSGYELGKVIDMMETGSNDVMVVRANLKDAFGMKERLVPFLHGQVIKKVDLTARVIEADW 178

Query: 165 IAA 167
              
Sbjct: 179 DPG 181


>gi|145628510|ref|ZP_01784310.1| 16S rRNA-processing protein [Haemophilus influenzae 22.1-21]
 gi|145639738|ref|ZP_01795340.1| 16S rRNA-processing protein [Haemophilus influenzae PittII]
 gi|144978980|gb|EDJ88666.1| 16S rRNA-processing protein [Haemophilus influenzae 22.1-21]
 gi|145271106|gb|EDK11021.1| 16S rRNA-processing protein [Haemophilus influenzae PittII]
 gi|309750380|gb|ADO80364.1| 16S rRNA processing protein RimM [Haemophilus influenzae R2866]
          Length = 175

 Score =  126 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 34/172 (19%), Positives = 73/172 (42%), Gaps = 12/172 (6%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKN 57
           ++  ++ ++  +G+T+G+ G + I S       +  Y  +      + + + +      N
Sbjct: 1   MEQQRIEVVGKLGSTYGIRGWLRIYSSTEQAESIFDYQPWFLKIKGEWQSIELENWRYHN 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              I    G+D+  +A  L ++++      F +  LEE +++  DL      + +G   G
Sbjct: 61  HEIIVKLKGVDDREAAQILANVEIGVDLSVFPE--LEEGDYYWHDLIGCTVVNLEGYTMG 118

Query: 118 QVCGVYNFGAGSILEIKNT-----MEKTFLIPFT-KFAVLEVNLQENKILID 163
            V  +   G+  +L +K        ++  LIPF  +  V  V+L    I +D
Sbjct: 119 TVTEMMETGSNDVLVVKANTKDAFGKQERLIPFLYEQVVKRVDLTTKTIEVD 170


>gi|325579370|ref|ZP_08149262.1| 16S rRNA processing protein RimM [Haemophilus parainfluenzae ATCC
           33392]
 gi|301154850|emb|CBW14313.1| 16S rRNA processing protein [Haemophilus parainfluenzae T3T1]
 gi|325159195|gb|EGC71331.1| 16S rRNA processing protein RimM [Haemophilus parainfluenzae ATCC
           33392]
          Length = 175

 Score =  126 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 34/172 (19%), Positives = 72/172 (41%), Gaps = 12/172 (6%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKN 57
           ++  ++ ++  +G+T+G+ G + I S       +  Y  +      + +   +      N
Sbjct: 1   MEQQRIEVVGKLGSTYGIRGWLRIYSSTEQAESIFDYQPWFLKIKGEWQPTELENWRHHN 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              I    G+D+  +A  L ++++      F +  LEE +++  DL      + +G   G
Sbjct: 61  HEIIVKLKGVDDREAAQTLANVEIGVDLSVFPE--LEEGDYYWHDLIGCSVVNLEGYTMG 118

Query: 118 QVCGVYNFGAGSILEIKNT-----MEKTFLIPFT-KFAVLEVNLQENKILID 163
            V  +   G+  +L +K        ++  LIPF  +  V  V+L    I +D
Sbjct: 119 TVTEMMETGSNDVLVVKANTKDAFGKQERLIPFLYEQVVKRVDLTTKTIEVD 170


>gi|15827851|ref|NP_302114.1| 16S rRNA-processing protein RimM [Mycobacterium leprae TN]
 gi|221230328|ref|YP_002503744.1| 16S rRNA-processing protein RimM [Mycobacterium leprae Br4923]
 gi|3914643|sp|O33016|RIMM_MYCLE RecName: Full=Ribosome maturation factor rimM
 gi|254797758|sp|B8ZRW7|RIMM_MYCLB RecName: Full=Ribosome maturation factor rimM
 gi|2251157|emb|CAB10628.1| hypothetical protein MLCB250.34 [Mycobacterium leprae]
 gi|13093403|emb|CAC30567.1| 16S rRNA processing protein [Mycobacterium leprae]
 gi|219933435|emb|CAR71711.1| 16S rRNA processing protein [Mycobacterium leprae Br4923]
          Length = 179

 Score =  126 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 32/171 (18%), Positives = 65/171 (38%), Gaps = 10/171 (5%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLN--------RYVLYSNDNRELRILKMYRKNKR 59
           + +  +   HG+ GEV ++   ++P            +        R   ++       R
Sbjct: 10  LTIGRVVKAHGIGGEVVVEIRTDDPASRFCPGNILRAKDFPRGGPERRYTVVYAREHGAR 69

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +   +G+ +  +A  LR         D    +  +  +++  LE ++     G+  G V
Sbjct: 70  LLVRLAGVSDRDAADALRGSLFVIDSLDLPPIDEPDT-YYDHQLEGLQVRTMMGRDVGVV 128

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
             V +  AG +L ++       L+PF    V  V+L +  + IDP    L+
Sbjct: 129 AEVLHTAAGELLAVRCDSG-EVLVPFVGAIVKLVSLDDGIVEIDPPKGLLD 178


>gi|300854477|ref|YP_003779461.1| putative 16S rRNA processing protein [Clostridium ljungdahlii DSM
           13528]
 gi|300434592|gb|ADK14359.1| predicted 16S rRNA processing protein [Clostridium ljungdahlii DSM
           13528]
          Length = 162

 Score =  126 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 37/166 (22%), Positives = 73/166 (43%), Gaps = 4/166 (2%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIAT 63
           +   + +  I  THG+ GE+ +    ++     +      D     I++   ++K+ I  
Sbjct: 1   MKDFITVGQIINTHGIKGELKVYPLTDDIERFKKLKSAYIDGTLKNIIECKLQSKKVILK 60

Query: 64  FSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVY 123
             GID+I  A   +   +   R D    +LEE  +F TD+      D  G ++G+V  V 
Sbjct: 61  IEGIDSIEEAMAYKQKYIEIPRND--AVKLEEGTYFITDIIGCSVVDEDGTFYGKVGDVI 118

Query: 124 NFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
           +     +  IK       LIP  +  V+ +++++ +I+I P+   +
Sbjct: 119 HTHNNDVYWIKGEN--ELLIPAIENVVVSIDVEKEEIVIKPVKTWM 162


>gi|238758268|ref|ZP_04619447.1| Ribosome maturation factor rimM [Yersinia aldovae ATCC 35236]
 gi|238703598|gb|EEP96136.1| Ribosome maturation factor rimM [Yersinia aldovae ATCC 35236]
          Length = 182

 Score =  126 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 29/173 (16%), Positives = 75/173 (43%), Gaps = 12/173 (6%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRF 60
           ++ +++  +G+T+G+ G + + S   N   +  Y  +        + + +    R ++  
Sbjct: 11  EQPIVLGKMGSTYGIRGWLRVFSSTENAESIFDYQPWFIQQGGKWQHVELEDWKRHSQDL 70

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           I     +D+  +A+ L + ++    +      LEED+++  DL   +     G   G++ 
Sbjct: 71  IIKVKDVDDRDAANLLTNCEIIVDSKQLP--TLEEDDYYWKDLMGCQVVTTTGYELGKII 128

Query: 121 GVYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILIDPIAA 167
            +   G+  ++ +K  ++     K  L+PF     + +V+L   ++ +D    
Sbjct: 129 DMMETGSNDVMVVKANLKDAFGMKERLVPFLHGQVIKKVDLTAQRVEVDWDPG 181


>gi|294788701|ref|ZP_06753942.1| 16S rRNA processing protein RimM [Simonsiella muelleri ATCC 29453]
 gi|294483183|gb|EFG30869.1| 16S rRNA processing protein RimM [Simonsiella muelleri ATCC 29453]
          Length = 169

 Score =  126 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 43/167 (25%), Positives = 74/167 (44%), Gaps = 7/167 (4%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDS---YANNPIDLNRYVLYSNDNREL-RILKMYRK 56
           M  +   V M  I    G+ G V +     Y ++ +D +++ L   ++  +  +L  +  
Sbjct: 1   MNNMQNWVAMGYIKGAFGVKGWVKVQPSTEYTDSLLDYSQWRLVQGNDVMMATLLNGHVA 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
           N      F  I +  SA+ LR   +Y  R+ F +   +E+EF+ TDL  M+  +R     
Sbjct: 61  NGELHVKFEQIQDRDSAALLRGYTIYIPREQFAEP--DENEFYWTDLMGMQVHNRDNACL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
           G+V  +   GA  +L +K       LIPF    + +VN     I +D
Sbjct: 119 GEVINIMETGAHDVLVVKGEFG-EKLIPFVSQFIDDVNELTQTITVD 164


>gi|314936599|ref|ZP_07843946.1| 16S rRNA processing protein RimM [Staphylococcus hominis subsp.
           hominis C80]
 gi|313655218|gb|EFS18963.1| 16S rRNA processing protein RimM [Staphylococcus hominis subsp.
           hominis C80]
          Length = 166

 Score =  126 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 41/168 (24%), Positives = 77/168 (45%), Gaps = 9/168 (5%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNR-----YVLYSNDNRELRILKMYRKNKRFIA 62
           V +  I  THG+ GEV + S ++      +      V + ++  E+ I          + 
Sbjct: 3   VEVGQIVNTHGIKGEVKVKSNSDFTDTRFQPGEVLIVNHHHNEIEMTITSYRIHKGFHML 62

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
            F GI++I+   + +   L+ +R   +D EL E+EF+ +D+     F+      G+V  +
Sbjct: 63  KFEGINHINDVEQYKGDYLFQERDH-EDIELNENEFYYSDIIGCTVFN-NDTPIGRVINI 120

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           +  GA  +  +K   +K +LIP+    V EV+++   I I  +   L 
Sbjct: 121 FETGANDVWVVK--GDKEYLIPYIADVVKEVDVEHKTIRITSMEGLLE 166


>gi|238752939|ref|ZP_04614401.1| Ribosome maturation factor rimM [Yersinia rohdei ATCC 43380]
 gi|238708847|gb|EEQ01103.1| Ribosome maturation factor rimM [Yersinia rohdei ATCC 43380]
          Length = 186

 Score =  126 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 31/173 (17%), Positives = 76/173 (43%), Gaps = 12/173 (6%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRF 60
           D+ +++  +G+T+G+ G + + S   N   +  Y  +        + + +    R ++  
Sbjct: 15  DQPIVLGKMGSTYGIRGWLRVFSSTENAESIFDYQPWFIQQGGKWQHVELEDWKRHSQDL 74

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           I    G+D+  +A+ L + ++    +   +  LEED+++  DL   +     G   G++ 
Sbjct: 75  IIKVKGVDDRDAANLLTNCEIVVDSKQLPE--LEEDDYYWKDLMGCQVVTTTGYELGKII 132

Query: 121 GVYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILIDPIAA 167
            +   G+  ++ +K  ++     K  L+PF     +  V+L   ++ +D    
Sbjct: 133 DMMETGSNDVMVVKANLKDAFGMKERLVPFLHGQVIKNVDLTAQRVEVDWDPG 185


>gi|298346449|ref|YP_003719136.1| 16S rRNA processing protein [Mobiluncus curtisii ATCC 43063]
 gi|298236510|gb|ADI67642.1| 16S rRNA processing protein [Mobiluncus curtisii ATCC 43063]
          Length = 192

 Score =  126 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 36/188 (19%), Positives = 67/188 (35%), Gaps = 25/188 (13%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRE----LRILKMYRKNKRFIA 62
            + +  IG   G+ GEV +    ++P            NR     L + +     K F+ 
Sbjct: 2   KLTVGIIGRASGVRGEVRVALRTDDPRSRFAPGTVLLTNRNSPAALTVDQARMSGKHFVV 61

Query: 63  TFSGIDNIHSASELRDLKLYAKRQ---------------------DFKDEELEEDEFFNT 101
           +F  I + + A  L   KLY +                       D+ +    +D F+  
Sbjct: 62  SFQEIPDRNDAETLSGTKLYIETDAPPLCADAGDTPDTTADPEAADYPETTENDDGFYRH 121

Query: 102 DLEEMETFDRQGKYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKIL 161
           +L  +   +  G+  G +  +    A  +LE+     +  L+PF    V +V+L    + 
Sbjct: 122 ELVGLRAMNLAGETLGTISDLLLAPAQDLLEVTTADGEKILVPFVYEIVPDVDLDNGLVT 181

Query: 162 IDPIAAGL 169
           +DP     
Sbjct: 182 MDPPGGLF 189


>gi|237748992|ref|ZP_04579472.1| ribosome maturation factor rimM [Oxalobacter formigenes OXCC13]
 gi|229380354|gb|EEO30445.1| ribosome maturation factor rimM [Oxalobacter formigenes OXCC13]
          Length = 180

 Score =  126 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 43/166 (25%), Positives = 76/166 (45%), Gaps = 9/166 (5%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPI---DLNRYVLYSNDNRELRILKMYRKNKRFI 61
             L+ +  I   +G+ G   I  Y+        +  + L   D   +++++  R+    +
Sbjct: 12  SDLIEVGHISGAYGIRGWAKIVPYSAEAEAMLRVKDWWLDLPDMHNVKVMQARRQGDEIV 71

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
           A FSGIDN  +A  LR   +   R  F +  L EDE++  DL  +  F+ +G   G V G
Sbjct: 72  AHFSGIDNREAAEALRGSVICISRSRFPE--LPEDEYYWVDLIGLSVFNLRGDALGTVRG 129

Query: 122 VYNFGAGSILEIKNTME----KTFLIPFTKFAVLEVNLQENKILID 163
           + + GA  +L++         +  LIPF    + +V+ +  KI +D
Sbjct: 130 LIDNGAHPVLQVAVEDSENKVRELLIPFVDQFIDDVDREGGKITVD 175


>gi|161723309|ref|NP_246234.2| 16S rRNA-processing protein [Pasteurella multocida subsp. multocida
           str. Pm70]
          Length = 175

 Score =  126 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 31/172 (18%), Positives = 70/172 (40%), Gaps = 12/172 (6%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKN 57
           ++  ++ ++  +G+T+G+ G + I S       +  Y  +        +   +      N
Sbjct: 1   MEQQRIEVVGKLGSTYGIRGWLRIYSSTEYAESIFDYQPWFLKIKGQWQPTELESWRYHN 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              I     +D+  +A  L ++++      F +  LEE +++  DL      + +    G
Sbjct: 61  NDLIVKLKHVDDRETAQTLANIEIGVDLAVFPE--LEEGDYYWHDLIGCNVVNLENYAMG 118

Query: 118 QVCGVYNFGAGSILEIKNT-----MEKTFLIPFT-KFAVLEVNLQENKILID 163
            V  +   G+  +L ++        ++  LIPF  +  V  V+L    I++D
Sbjct: 119 TVTEMMETGSNDVLVVRAKSKDAFGKQERLIPFLYEQVVKRVDLNTKTIVVD 170


>gi|47097598|ref|ZP_00235125.1| 16S rRNA processing protein RimM [Listeria monocytogenes str. 1/2a
           F6854]
 gi|258611625|ref|ZP_05234263.2| 16S rRNA processing protein RimM [Listeria monocytogenes FSL
           N3-165]
 gi|258612340|ref|ZP_05270099.2| 16S rRNA processing protein RimM [Listeria monocytogenes F6900]
 gi|47014029|gb|EAL05035.1| 16S rRNA processing protein RimM [Listeria monocytogenes str. 1/2a
           F6854]
 gi|258601991|gb|EEW15316.1| 16S rRNA processing protein RimM [Listeria monocytogenes FSL
           N3-165]
 gi|258611013|gb|EEW23621.1| 16S rRNA processing protein RimM [Listeria monocytogenes F6900]
          Length = 169

 Score =  126 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 38/171 (22%), Positives = 72/171 (42%), Gaps = 9/171 (5%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNR-------YVLYSNDNRELRILKMYRKNKR 59
           +  +  I  THGL GE+ + +  + P +  +       +   S    +L I    +    
Sbjct: 1   MYNVGKIVNTHGLIGEIRVIATTDFPEERFQVGNTVYLFEKNSKKPEKLIIRSHRKHKNF 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +  F G   IH    +++  L  K       +LEE+EF+  ++         G+  G++
Sbjct: 61  DLLMFEGFTGIHQVERMKEGVLKIKETQL--TDLEENEFYFHEIIGCTVVTTDGEELGEI 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
             +   GA  +  +K   +K  LIP+    V E+N+ + KI I+ +   L+
Sbjct: 119 TEILTPGANDVWVVKGADKKEKLIPYIADVVKEINIDDQKITIEVMEGLLD 169


>gi|304316923|ref|YP_003852068.1| 16S rRNA processing protein RimM [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302778425|gb|ADL68984.1| 16S rRNA processing protein RimM [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 166

 Score =  126 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 37/169 (21%), Positives = 74/169 (43%), Gaps = 7/169 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR----YVLYSNDNRELRILKMYRKNKR 59
           +D  + +  I + +G+NGEV +    ++          Y+        L +  +      
Sbjct: 1   MDDYLSVGKITSAYGVNGEVKVFPLTDHLDRFYDLDYVYIFEETGKTSLNVETVRFIKNL 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            I  F  I++ + A +L+   +  KR +    +L++DE+F  DL  M+ +    K  G +
Sbjct: 61  VIVKFKEINDRNEAEKLKGKLIKIKRDN--AVKLDDDEYFIKDLLNMKVYTDDQKELGIL 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAG 168
             V   GA  +  +K   E+  LIP  K  + +V+++E K+ +  +   
Sbjct: 119 KDVLKTGANDVYVVKT-DERDILIPAIKDVIKKVDIKERKMTVHLLEGL 166


>gi|17545653|ref|NP_519055.1| 16S rRNA-processing protein [Ralstonia solanacearum GMI1000]
 gi|21362859|sp|Q8Y0V9|RIMM_RALSO RecName: Full=Ribosome maturation factor rimM
 gi|17427946|emb|CAD14636.1| probable 16s rrna processing protein rimm [Ralstonia solanacearum
           GMI1000]
          Length = 184

 Score =  126 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 37/169 (21%), Positives = 71/169 (42%), Gaps = 12/169 (7%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----------SNDNRELRILKMY 54
           D LV +  +G  +G+ G + +  + +    L+    +          S+D R L +    
Sbjct: 13  DDLVEVGYVGGAYGVRGWIKVQPHGDAEALLHASTWWLKPAAGAPAVSSDWRVLPVGTSR 72

Query: 55  RKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGK 114
             +   +A    + + + A  LR   ++ +R +F     +E  F+  DL      + Q +
Sbjct: 73  EHSGSVVAGSPAVPDRNVAEALRGCTVWVRRAEFPAPADDE--FYWVDLIGSTVVNEQQE 130

Query: 115 YWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
             G V G+ + GA  IL I +      L+PF +  V  V++    I++D
Sbjct: 131 TLGTVAGLIDNGAHQILRIVDEGGTERLVPFVEVYVKSVDVAGKHIVVD 179


>gi|46908025|ref|YP_014414.1| 16S rRNA-processing protein RimM [Listeria monocytogenes serotype
           4b str. F2365]
 gi|47094472|ref|ZP_00232150.1| 16S rRNA processing protein RimM [Listeria monocytogenes str. 4b
           H7858]
 gi|293596406|ref|ZP_05231381.2| ribosome maturation factor rimM [Listeria monocytogenes FSL J1-194]
 gi|293597068|ref|ZP_05267001.2| ribosome maturation factor rimM [Listeria monocytogenes HPB2262]
 gi|59798758|sp|Q71YM3|RIMM_LISMF RecName: Full=Ribosome maturation factor rimM
 gi|46881295|gb|AAT04591.1| 16S rRNA processing protein RimM [Listeria monocytogenes serotype
           4b str. F2365]
 gi|47017155|gb|EAL08010.1| 16S rRNA processing protein RimM [Listeria monocytogenes str. 4b
           H7858]
 gi|293585205|gb|EFF97237.1| ribosome maturation factor rimM [Listeria monocytogenes HPB2262]
 gi|293595620|gb|EFG03381.1| ribosome maturation factor rimM [Listeria monocytogenes FSL J1-194]
          Length = 169

 Score =  126 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 38/171 (22%), Positives = 73/171 (42%), Gaps = 9/171 (5%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNR-------YVLYSNDNRELRILKMYRKNKR 59
           +  +  I  THGL GE+ + +  + P +  +       +   S    +L I    +    
Sbjct: 1   MYNVGKIVNTHGLIGEIRVIATTDFPEERFQVGNTVYLFEKNSKKPEKLIIRSHRKHKNF 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +  F G   IH    +++  L  K       +LEE+EF+  ++         G+  G++
Sbjct: 61  DLLMFEGFTGIHQVERMKEGVLKIKEAQL--TDLEENEFYFHEIIGCIVVTTDGEELGEI 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
             +   GA  +  +K + +K  LIP+    V E+N+ + KI I+ +   L+
Sbjct: 119 TEILTPGANDVWVVKGSDKKEKLIPYIADVVKEININDKKITIEVMEGLLD 169


>gi|258612038|ref|ZP_05243865.2| ribosome maturation factor rimM [Listeria monocytogenes FSL R2-503]
 gi|300766440|ref|ZP_07076395.1| 16S rRNA processing protein RimM [Listeria monocytogenes FSL
           N1-017]
 gi|258607916|gb|EEW20524.1| ribosome maturation factor rimM [Listeria monocytogenes FSL R2-503]
 gi|300512864|gb|EFK39956.1| 16S rRNA processing protein RimM [Listeria monocytogenes FSL
           N1-017]
          Length = 169

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 39/171 (22%), Positives = 73/171 (42%), Gaps = 9/171 (5%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNR-------YVLYSNDNRELRILKMYRKNKR 59
           +  +  I  THGL GE+ + +  + P +  +       +   S    +L I    +    
Sbjct: 1   MYNVGKIVNTHGLIGEIRVIATTDFPEERFQVGNTVYLFEKNSKKPEKLIIRSHRKHKNF 60

Query: 60  FIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQV 119
            +  F G   IH    +++  L  K       +LEE+EF+  ++         GK  G++
Sbjct: 61  DLLMFEGFTGIHQVERMKEGVLKIKEAQL--TDLEENEFYFHEIIGCIVVTTDGKELGEI 118

Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
             +   GA  +  +K + +K  LIP+    V E+N+ + KI I+ +   L+
Sbjct: 119 TEILTPGANDVWVVKGSDKKEKLIPYIADVVKEININDKKITIEVMEGLLD 169


>gi|238790730|ref|ZP_04634491.1| Ribosome maturation factor rimM [Yersinia frederiksenii ATCC 33641]
 gi|238721171|gb|EEQ12850.1| Ribosome maturation factor rimM [Yersinia frederiksenii ATCC 33641]
          Length = 186

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 29/173 (16%), Positives = 74/173 (42%), Gaps = 12/173 (6%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRF 60
           D+ +++  +G+T+G+ G + + S   N   +  Y  +        + + +    R ++  
Sbjct: 15  DQPIVLGKMGSTYGIRGWLRVFSSTENAESIFDYQPWFIQQAGKWQHVELEDWKRHSQDL 74

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           I    G+D+  +A+ L + ++    +      L +D+++  DL   +     G   G++ 
Sbjct: 75  IIKVKGVDDRDAANLLTNCEIVVDSKQLP--TLGDDDYYWKDLMGCQVVTTTGYELGKII 132

Query: 121 GVYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILIDPIAA 167
            +   G+  ++ +K  ++     K  L+PF     +  V+L   ++ +D    
Sbjct: 133 DMMETGSNDVMVVKANLKDAFGMKERLVPFLHGQVIKNVDLTAQRVEVDWDPG 185


>gi|197284284|ref|YP_002150156.1| 16S rRNA-processing protein RimM [Proteus mirabilis HI4320]
 gi|227357812|ref|ZP_03842160.1| 16S rRNA processing protein [Proteus mirabilis ATCC 29906]
 gi|194681771|emb|CAR40984.1| 16S rRNA processing protein [Proteus mirabilis HI4320]
 gi|227161922|gb|EEI46940.1| 16S rRNA processing protein [Proteus mirabilis ATCC 29906]
          Length = 181

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 32/172 (18%), Positives = 71/172 (41%), Gaps = 13/172 (7%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRFI 61
           + ++M  +G+ +G+ G + + S   +  ++  Y  +          + I      N+  I
Sbjct: 12  EPIVMGKLGSPYGIRGWLRVFSSTEHAENIFEYQPWFIQRHGQWESIEIETWKHHNQDII 71

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               GID+  +A+ L + ++        D    + E++  DL   +    +G   G V  
Sbjct: 72  VKLKGIDDRDAANILTNFEIVVSATQLPDL---DGEYYWKDLMGCQVETDKGYDLGVVND 128

Query: 122 VYNFGAGSILEIKNTME-----KTFLIPFTK-FAVLEVNLQENKILIDPIAA 167
           +   G+  ++ IK  ++     +  L+PF     + +V+L   KI++D    
Sbjct: 129 MMETGSNDVMVIKANLKDAFGVRERLVPFLDGQVIKKVDLSAKKIIVDWDPG 180


>gi|225463376|ref|XP_002271571.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|297740629|emb|CBI30811.3| unnamed protein product [Vitis vinifera]
          Length = 665

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 42/198 (21%), Positives = 73/198 (36%), Gaps = 32/198 (16%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLN-----RYVLYSNDNRELRIL------KM 53
            + V +  I + HGL GE+ +    + P         R++      +E          + 
Sbjct: 75  SEFVEVGYISSVHGLQGEIRVKPNTDFPELRFAEPGIRWLRQQFSGKETIREVELVEGRG 134

Query: 54  YRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETF-DRQ 112
           +   K +I  F GID +  A +L    L  +  D  +  LEE EF++ DL  M       
Sbjct: 135 HPGQKTWILKFGGIDTVEEAKQLVGSSLLVREDDRPE--LEEGEFYSRDLLGMRVTLKET 192

Query: 113 GKYWGQVCGVYNFGAGSILEI------------------KNTMEKTFLIPFTKFAVLEVN 154
           G+  G V  V++ GA  +L++                           +PF +  V  V+
Sbjct: 193 GEPVGTVVNVFSTGANDLLQVMLDPSVKTPDHTGNPKSETGVSGPLVWVPFVEAIVPNVD 252

Query: 155 LQENKILIDPIAAGLNNT 172
           + + ++ I P    L   
Sbjct: 253 MNKREMQITPPKGLLELN 270


>gi|257061858|ref|YP_003139746.1| 16S rRNA-processing protein RimM [Cyanothece sp. PCC 8802]
 gi|256592024|gb|ACV02911.1| 16S rRNA processing protein RimM [Cyanothece sp. PCC 8802]
          Length = 186

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 45/187 (24%), Positives = 73/187 (39%), Gaps = 20/187 (10%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR--------YVLYSNDNRELRILK 52
           M   +  + +  I    GL GE+ + S ++ P    +            S    EL   +
Sbjct: 1   MDNSESWLEIGRIVAAQGLKGELKVMSSSDFPERFEKPGTRWLQSPDRLSIQEVELVRGR 60

Query: 53  MYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQ 112
                  ++   + I +   A  LRD  L     D    +L EDE+  +DL  +  + +Q
Sbjct: 61  YVPGKNLYVIKLAEIADRTQAETLRDYTLLVPSSDRP--QLNEDEYHVSDLINLTVYHQQ 118

Query: 113 -GKYWGQVCGVYNFGAGSILEI--------KNTMEKTFLIPFTKFAVLEVNLQENKILID 163
            G+  G V  + + G   +LE+        +NT  K  LIPF    V  V+L   +I I+
Sbjct: 119 TGEEIGVVTDMLSAG-NDLLEVQLNTLNSSENTSSKKVLIPFVYEIVPVVDLVNKRIEIN 177

Query: 164 PIAAGLN 170
           P    L 
Sbjct: 178 PPVGLLE 184


>gi|298253303|ref|ZP_06977095.1| 16S rRNA-processing protein rimM [Gardnerella vaginalis 5-1]
 gi|297532698|gb|EFH71584.1| 16S rRNA-processing protein rimM [Gardnerella vaginalis 5-1]
          Length = 197

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 43/180 (23%), Positives = 76/180 (42%), Gaps = 17/180 (9%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR---YVLYSNDNRELRILKMYRKNKRFI 61
           + L+ +  IG   GL GEV +  + + P +       +  ++  RE  I        R+I
Sbjct: 16  NDLLRVCRIGKAQGLKGEVTVQIFTDEPYERFEPGNVLCTADGEREFVIENARTFKNRWI 75

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQG-------K 114
             F    N + A  L   +LY   +D ++   E   +   DL  ++    +        K
Sbjct: 76  LLFEESQNRNDAEALNGTELYVHAEDAQELAAENAWYIK-DLVGLQARLCEENQLGLTPK 134

Query: 115 YWGQVCGVYNFGAGSILEIK-----NTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
             G+V  V + GA S+L+I+     +   KT L+PF +  V EV++    + I+P    +
Sbjct: 135 IIGKVVDVLD-GAQSLLKIRLDHPVDEEHKTALVPFVEAIVPEVDVANGYLTINPPGGLI 193


>gi|328957320|ref|YP_004374706.1| 16S rRNA-processing protein RimM [Carnobacterium sp. 17-4]
 gi|328673644|gb|AEB29690.1| 16S rRNA-processing protein RimM [Carnobacterium sp. 17-4]
          Length = 171

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 38/173 (21%), Positives = 71/173 (41%), Gaps = 8/173 (4%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVL---YSNDNRELRILKM---YRKN 57
           +  L  +  I  T G+ GEV + S  + P +  +         D + +  L +    +  
Sbjct: 1   MKTLYNVGKIVNTQGIKGEVRVISKTDFPEERYKKGSTLSLFQDGKLVTDLTVASHRKHK 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              I +F    NI+   + RD  L          EL ++EF+   +  +   D +    G
Sbjct: 61  NFDILSFENHPNINDVEKYRDGILKVSEDRL--TELPKNEFYLHQIVGLTVQDEEKNTIG 118

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           ++  V + GA  +  I+   +K  LIP+ +  VLEV+L+   + I  +    +
Sbjct: 119 KISEVMSPGANDVWVIERPKKKDLLIPYIEEVVLEVDLENQMVTIHMMEGLDD 171


>gi|113971172|ref|YP_734965.1| 16S rRNA-processing protein RimM [Shewanella sp. MR-4]
 gi|114048410|ref|YP_738960.1| 16S rRNA-processing protein RimM [Shewanella sp. MR-7]
 gi|123029444|sp|Q0HGA9|RIMM_SHESM RecName: Full=Ribosome maturation factor rimM
 gi|123131181|sp|Q0HSK2|RIMM_SHESR RecName: Full=Ribosome maturation factor rimM
 gi|113885856|gb|ABI39908.1| 16S rRNA processing protein RimM [Shewanella sp. MR-4]
 gi|113889852|gb|ABI43903.1| 16S rRNA processing protein RimM [Shewanella sp. MR-7]
          Length = 176

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 38/173 (21%), Positives = 79/173 (45%), Gaps = 12/173 (6%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRK 56
           M    + V++  +G+ HG+ G + I +Y ++   +  Y  +    + + RE+++++   +
Sbjct: 1   MSSNQQPVVLGKLGSCHGIKGWLKITAYTDSVEGIFDYSPWLIKENGEWREVKVIQWRYQ 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
            K  +A   G+     A  L + ++    +      L EDEF+  DL   E  +  G   
Sbjct: 61  GKAVVAELEGVTTRERAQMLTNCEIGILPEQM--NALPEDEFYWRDLIGCEVINTNGYNM 118

Query: 117 GQVCGVYNFGAGSILEIKNT-----MEKTFLIPFTK-FAVLEVNLQENKILID 163
           G V  +   G+  +L +K        +   ++PF     +L+V++Q  +IL+D
Sbjct: 119 GVVDQIVETGSNDVLLVKANAKDSFGKVERMLPFVPGQFILKVDIQGKQILVD 171


>gi|212218946|ref|YP_002305733.1| 16S rRNA-processing protein RimM [Coxiella burnetii CbuK_Q154]
 gi|238058948|sp|B6J8I9|RIMM_COXB1 RecName: Full=Ribosome maturation factor rimM
 gi|212013208|gb|ACJ20588.1| 16S rRNA processing protein [Coxiella burnetii CbuK_Q154]
          Length = 168

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 30/166 (18%), Positives = 77/166 (46%), Gaps = 7/166 (4%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRKN 57
           +K +  V++  +   +GL G + + S+ +   +L  +  +    +N+ + L++       
Sbjct: 1   MKSNDKVIIGRLARPYGLRGWIKVVSFTHPIDNLLNHPTWQIQHNNEWQPLKLQAGKLHE 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              +     ID+  +A    +  +  +R       L+E +++ TDL  +   +  G   G
Sbjct: 61  PFLVVKLENIDDPETAKHYTNDLIAIERGAL--GALKEGDYYWTDLIGLAVVNTHGIELG 118

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
            V  +   G+  +L +++  E+  LIP+T + +  ++L++  I+++
Sbjct: 119 TVDSLIETGSNDVLVVRS-KERERLIPYTSYTIQSIDLEKKIIVVE 163


>gi|209573737|sp|A1AN01|RIMM_PELPD RecName: Full=Ribosome maturation factor rimM
          Length = 173

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 35/175 (20%), Positives = 75/175 (42%), Gaps = 8/175 (4%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-----VLYSNDNRELRILKMYR 55
           M+  + L+ +  +  THG+ G + + SY+ +   L                      +  
Sbjct: 1   MIDSESLIPVGKLVATHGIRGMLKLHSYSGSVESLCTCDSVILRSRDGALNRFEPKPVLP 60

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
           +  +F+  F G+D+I  A  L   ++  +R    + E +E  ++  DL  +E    +G  
Sbjct: 61  RPGKFLIGFKGVDHIDQAQTLVGSEICLRRDQLPEPEEDE--YYWCDLIGLEVATVEGMA 118

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
            G +  ++  G+  I  ++    + +LIP     +  V+L+  ++LI P+   L+
Sbjct: 119 LGVLEEIFKAGSSDIYVVRGA-GREYLIPAIADVIHSVDLEMGRMLITPLEGLLD 172


>gi|218283555|ref|ZP_03489545.1| hypothetical protein EUBIFOR_02135 [Eubacterium biforme DSM 3989]
 gi|218215823|gb|EEC89361.1| hypothetical protein EUBIFOR_02135 [Eubacterium biforme DSM 3989]
          Length = 162

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 41/164 (25%), Positives = 80/164 (48%), Gaps = 5/164 (3%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRY--VLYSNDNRELRILKMYRKNKRFIATF 64
           ++ +A I  THGL GE  +    ++P        VL+  D R L +++   +       F
Sbjct: 1   MIKVAQIINTHGLKGECKLYLVTDDPQHRFEKGRVLHLEDGRTLTVVRYREQKGFGYCYF 60

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
            GID+I  A +L+   L+  + D  +  LEE +++  +L     ++ + +  G+V  +  
Sbjct: 61  EGIDSIEKAEQLKTKNLFIAQDDLPE--LEEGQYYYHELMNCTVYNEKKENLGEVVDILE 118

Query: 125 FGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAG 168
            GA  +L +K+    +FL+PF    +++VN   ++I+I  +   
Sbjct: 119 TGANLVLRVKSKN-TSFLLPFVPAFIVDVNKDTHEIIIREMDGL 161


>gi|68248808|ref|YP_247920.1| 16S rRNA-processing protein RimM [Haemophilus influenzae 86-028NP]
 gi|145633788|ref|ZP_01789512.1| 16S rRNA-processing protein [Haemophilus influenzae 3655]
 gi|145635639|ref|ZP_01791336.1| 16S rRNA-processing protein [Haemophilus influenzae PittAA]
 gi|145637367|ref|ZP_01793027.1| 16S rRNA-processing protein [Haemophilus influenzae PittHH]
 gi|68057007|gb|AAX87260.1| 16S rRNA processing protein RimM [Haemophilus influenzae 86-028NP]
 gi|144985359|gb|EDJ92189.1| 16S rRNA-processing protein [Haemophilus influenzae 3655]
 gi|145267112|gb|EDK07119.1| 16S rRNA-processing protein [Haemophilus influenzae PittAA]
 gi|145269459|gb|EDK09402.1| 16S rRNA-processing protein [Haemophilus influenzae PittHH]
          Length = 175

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 34/165 (20%), Positives = 69/165 (41%), Gaps = 12/165 (7%)

Query: 9   LMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRFIATF 64
           ++  +G+T+G+ G + I S       +  Y  +      + + + +      N   I   
Sbjct: 8   VVGKLGSTYGIRGWLRIYSSTEQAESIFDYQPWFLKIKGEWQSIELENWRYHNHEIIVKL 67

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
            G+D+  +A  L ++++      F +  LEE +++  DL      + +G   G V  +  
Sbjct: 68  KGVDDRETAQILANVEIGVDLSVFPE--LEEGDYYWHDLIGCTVVNLEGYTMGTVTEMME 125

Query: 125 FGAGSILEIKNT-----MEKTFLIPFT-KFAVLEVNLQENKILID 163
            G+  +L +K        ++  LIPF  +  V  V+L    I +D
Sbjct: 126 TGSNDVLVVKANTKDAFGKQERLIPFLYEQVVKRVDLTTKTIEVD 170


>gi|30995359|ref|NP_438372.2| 16S rRNA-processing protein RimM [Haemophilus influenzae Rd KW20]
 gi|145631330|ref|ZP_01787102.1| tRNA (guanine-N(1)-)-methyltransferase [Haemophilus influenzae
           R3021]
 gi|148825533|ref|YP_001290286.1| 16S rRNA-processing protein RimM [Haemophilus influenzae PittEE]
 gi|148827341|ref|YP_001292094.1| 16S rRNA-processing protein RimM [Haemophilus influenzae PittGG]
 gi|229847378|ref|ZP_04467479.1| 16S rRNA-processing protein [Haemophilus influenzae 7P49H1]
 gi|319775927|ref|YP_004138415.1| 16S rRNA processing protein [Haemophilus influenzae F3047]
 gi|319898168|ref|YP_004136365.1| 16S rRNA processing protein [Haemophilus influenzae F3031]
 gi|329123788|ref|ZP_08252346.1| 16S rRNA processing protein RimM [Haemophilus aegyptius ATCC 11116]
 gi|166226444|sp|A5UAV2|RIMM_HAEIE RecName: Full=Ribosome maturation factor rimM
 gi|166226445|sp|A5UG05|RIMM_HAEIG RecName: Full=Ribosome maturation factor rimM
 gi|144983115|gb|EDJ90615.1| tRNA (guanine-N(1)-)-methyltransferase [Haemophilus influenzae
           R3021]
 gi|148715693|gb|ABQ97903.1| 16S rRNA-processing protein [Haemophilus influenzae PittEE]
 gi|148718583|gb|ABQ99710.1| 16S rRNA-processing protein [Haemophilus influenzae PittGG]
 gi|229809704|gb|EEP45429.1| 16S rRNA-processing protein [Haemophilus influenzae 7P49H1]
 gi|301168855|emb|CBW28446.1| 16S rRNA processing protein [Haemophilus influenzae 10810]
 gi|309972675|gb|ADO95876.1| 16S rRNA processing protein RimM [Haemophilus influenzae R2846]
 gi|317433674|emb|CBY82061.1| 16S rRNA processing protein [Haemophilus influenzae F3031]
 gi|317450518|emb|CBY86735.1| 16S rRNA processing protein [Haemophilus influenzae F3047]
 gi|327469275|gb|EGF14746.1| 16S rRNA processing protein RimM [Haemophilus aegyptius ATCC 11116]
          Length = 175

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 34/165 (20%), Positives = 69/165 (41%), Gaps = 12/165 (7%)

Query: 9   LMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKNKRFIATF 64
           ++  +G+T+G+ G + I S       +  Y  +      + + + +      N   I   
Sbjct: 8   VVGKLGSTYGIRGWLRIYSSTEQAESIFDYQPWFLKIKGEWQSIELENWRYHNHEIIVKL 67

Query: 65  SGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYN 124
            G+D+  +A  L ++++      F +  LEE +++  DL      + +G   G V  +  
Sbjct: 68  KGVDDREAAQILANVEIGVDLSVFPE--LEEGDYYWHDLIGCTVVNLEGYTMGTVTEMME 125

Query: 125 FGAGSILEIKNT-----MEKTFLIPFT-KFAVLEVNLQENKILID 163
            G+  +L +K        ++  LIPF  +  V  V+L    I +D
Sbjct: 126 TGSNDVLVVKANTKDAFGKQERLIPFLYEQVVKRVDLTTKTIEVD 170


>gi|161511002|ref|YP_087633.2| 16S rRNA-processing protein [Mannheimia succiniciproducens MBEL55E]
          Length = 175

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 35/172 (20%), Positives = 71/172 (41%), Gaps = 12/172 (6%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS----NDNRELRILKMYRKN 57
           +   ++  +  +G+T+G+ G + I S   N   +  Y  +     +  + + +      N
Sbjct: 1   MDRQRIETVGKLGSTYGIRGWLRIYSSTENAESIFDYQPWFLKIKDQWQAIELETWKHHN 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              I     I++  +A  L ++++      F    LEE +F+  DL   +  + QG   G
Sbjct: 61  HELIVKLKNINDRETAQTLANVEIGVDLSVFPA--LEEGDFYWHDLIGCQVVNLQGYAMG 118

Query: 118 QVCGVYNFGAGSILEIKNT-----MEKTFLIPFT-KFAVLEVNLQENKILID 163
            V  +   G+  +L ++        ++  LIPF  +  V  V+L    I +D
Sbjct: 119 TVSEMMETGSNDVLVVRANAKDAFGKQERLIPFLYEQVVKRVDLTTKTIEVD 170


>gi|161349300|ref|ZP_02096685.1| 16S rRNA processing protein RimM [Coxiella burnetii 'MSU Goat
           Q177']
 gi|164601552|gb|EDQ95151.1| 16S rRNA processing protein RimM [Coxiella burnetii 'MSU Goat
           Q177']
          Length = 168

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 30/166 (18%), Positives = 77/166 (46%), Gaps = 7/166 (4%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRKN 57
           +K +  V++  +   +GL G + + S+ +   +L  +  +    +N+ + L++       
Sbjct: 1   MKSNDKVIIGRLARPYGLRGWIKVVSFTHPIDNLLNHPTWQIQHNNEWQPLKLQAGKLHE 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              +     ID+  +A    +  +  +R       L+E +++ TDL  +   +  G   G
Sbjct: 61  PFLVVKLENIDDPETAXHYTNDLIAIERGAL--GALKEGDYYWTDLIGLAVVNTHGIELG 118

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
            V  +   G+  +L +++  E+  LIP+T + +  ++L++  I+++
Sbjct: 119 TVDSLIETGSNDVLVVRS-KERERLIPYTSYTIQSIDLEKKIIVVE 163


>gi|75907314|ref|YP_321610.1| 16S rRNA-processing protein RimM [Anabaena variabilis ATCC 29413]
 gi|109892999|sp|Q3ME71|RIMM_ANAVT RecName: Full=Probable 16S rRNA-processing protein rimM
 gi|75701039|gb|ABA20715.1| 16S rRNA processing protein RimM [Anabaena variabilis ATCC 29413]
          Length = 233

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 46/182 (25%), Positives = 76/182 (41%), Gaps = 19/182 (10%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLN----RYVLYSN--DNRELRILKMYR--K 56
           D+ + +  I +  GL+GEV +   ++ P        R++L     + + + +L       
Sbjct: 50  DEWLQIGKIVSAQGLSGEVRVYPDSDFPERFEVPGTRWLLRPGQTEPQPIELLHGRYLEN 109

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
              ++   +G++N   + ELR   L+    D  +  L EDE+   DL  ME F +     
Sbjct: 110 KNLYVLQLAGVENRTQSEELRGCMLFVPASDRPE--LGEDEYHVVDLIGMEVFLQTSGDL 167

Query: 117 -GQVCGVYNFGAGSILEIK-------NTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAG 168
            G V  V   G   +LE+        +   KT LIPF K     V+L+  +I I P    
Sbjct: 168 VGTVVDVIPAG-NDLLEVSLHEPVPSDKKPKTVLIPFVKAIAPVVDLETRRIEITPPPGL 226

Query: 169 LN 170
           L 
Sbjct: 227 LE 228


>gi|289207613|ref|YP_003459679.1| 16S rRNA processing protein RimM [Thioalkalivibrio sp. K90mix]
 gi|288943244|gb|ADC70943.1| 16S rRNA processing protein RimM [Thioalkalivibrio sp. K90mix]
          Length = 169

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 31/168 (18%), Positives = 69/168 (41%), Gaps = 9/168 (5%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSN----DNRELRILKMYRK 56
           M +  + + +  +   +G+ G V I S       +  +         D R + +      
Sbjct: 1   MNEAGERIRVGRVSGVYGVKGWVRIFSETEPRAAIADFPHLWLRAGADWRLVEVEAGRAH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
               +  F+   +  +A  L   +L  +R        E+ E++  DL  M+   + G   
Sbjct: 61  GHGVVMKFAETADREAAYGLMGAELAIERDWLPPA--EDGEYYWADLLGMKVEHQDGTAL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTK-FAVLEVNLQENKILID 163
           G++ G    GA  +L ++   ++  LIP+ +   +L+V+L+  ++ +D
Sbjct: 119 GRISGFMETGANDVLVVR--GDRERLIPWVRGQYILDVDLEGRRLRVD 164


>gi|254468713|ref|ZP_05082119.1| 16S rRNA processing protein RimM [beta proteobacterium KB13]
 gi|207087523|gb|EDZ64806.1| 16S rRNA processing protein RimM [beta proteobacterium KB13]
          Length = 165

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 35/165 (21%), Positives = 71/165 (43%), Gaps = 10/165 (6%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS-----NDNRELRILKMYRKNK 58
           ++ LV++  I + +G+ G V I  +     +  +Y          D   + I ++  + +
Sbjct: 1   MENLVIIGKIISAYGIKGWVKIRPFTETAKNFIQYKTQFLSRNQKDWNRVEIKEIKIQGQ 60

Query: 59  RFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQ 118
             IA   G+ +   +   +   L   R      +L EDEF+  DL  ++  D   +  G+
Sbjct: 61  DVIADI-GLTDRDQSISHKGYFLAIARDQLP--QLPEDEFYWDDLIGLKVIDVDREDLGK 117

Query: 119 VCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
           V G+   GA  +L +  + ++  LIP+    + +V+     I +D
Sbjct: 118 VVGLIETGANDVLVV--SGDRERLIPYIPQVIKKVDTHNQLIEVD 160


>gi|289522292|ref|ZP_06439146.1| 16S rRNA processing protein RimM [Anaerobaculum hydrogeniformans
           ATCC BAA-1850]
 gi|289504128|gb|EFD25292.1| 16S rRNA processing protein RimM [Anaerobaculum hydrogeniformans
           ATCC BAA-1850]
          Length = 176

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 30/176 (17%), Positives = 63/176 (35%), Gaps = 11/176 (6%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNR------YVLYSNDNRELRILKMYR 55
           +  ++LV +  I   HG+ GE+ +    + P           Y    +    L I  +  
Sbjct: 1   MFSEELVTVGRIVGAHGIKGELRLLPLTDFPERFKDMDYLDVYRPNGSFWCRLTINSIRE 60

Query: 56  K--NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMET-FDRQ 112
                +FI     I +  +A  LR   +  + Q+    EL +  ++  DL  +       
Sbjct: 61  HVGKGQFIVGVDEIVDRDAAESLRGGLVMVRPQE--RVELPDGFYWIDDLLGLAVVDYDT 118

Query: 113 GKYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAG 168
           G   G +  +   G+  +  ++    K  ++P     V E+N+    + +  +   
Sbjct: 119 GNNLGTLVEIMPTGSNDVYVVETEKGKRHMLPAISEVVKEINIDNGFVKVHLLEGL 174


>gi|327183808|gb|AEA32255.1| 16S rRNA-processing protein RimM [Lactobacillus amylovorus GRL
           1118]
          Length = 186

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 40/172 (23%), Positives = 77/172 (44%), Gaps = 7/172 (4%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLN----RYVLYSNDNRELRILKMYRKNKRFI 61
           +   +A I TTHGLNGEV ++   + P D      +  L ++ +R L I K     + ++
Sbjct: 17  QYFDVAKILTTHGLNGEVKVNVITDFPEDRFAEGMQLALKADTDRILTIKKSRPFKQFWL 76

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMET-FDRQGKYWGQVC 120
             F  +++I  A +LR   L     +    EL E  ++  D+ + +   +  GK  G++ 
Sbjct: 77  LQFDEVNDIDEAEKLRGQILVVSEDN--RGELPEGVYYYKDIFDCDVIDEESGKRLGKIT 134

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNT 172
            + + GA  I  +     K + IP     V +V++   K+ ++ +    +  
Sbjct: 135 DIQSPGANDIWLVHEDDGKEYWIPNIADVVKKVDVPNKKVYVELMEGLRDED 186


>gi|254513965|ref|ZP_05126026.1| 16S rRNA processing protein RimM [gamma proteobacterium NOR5-3]
 gi|219676208|gb|EED32573.1| 16S rRNA processing protein RimM [gamma proteobacterium NOR5-3]
          Length = 172

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 26/168 (15%), Positives = 71/168 (42%), Gaps = 14/168 (8%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNR----ELRILKMYRKNKRFIA 62
           ++L   I   +G+ G V + ++ + P +   +  +  + +     ++      + K  IA
Sbjct: 1   MLLAGKITGAYGIKGWVKLHAFTDPPQNFFAFSRHQIERQGRTESIQFADGRAQGKGLIA 60

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY---WGQV 119
              G+D+   A  LR  +++  +++  +  L  D+++   L+ ++ + +        G V
Sbjct: 61  RVVGVDSRTDAELLRGTQIWVPKEELPE--LGPDDYYWHQLQGLQVWSQHEGQSLLLGVV 118

Query: 120 CGVYNFGAGSILEIKNTME----KTFLIPFT-KFAVLEVNLQENKILI 162
             +   GA  +L ++        +  LIP+     V  ++++   + +
Sbjct: 119 DHLLETGANDVLVLRPCDGSIDKRERLIPYLPDDVVQGIDIEAGSMTV 166


>gi|332670017|ref|YP_004453025.1| 16S rRNA processing protein RimM [Cellulomonas fimi ATCC 484]
 gi|332339055|gb|AEE45638.1| 16S rRNA processing protein RimM [Cellulomonas fimi ATCC 484]
          Length = 184

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 36/173 (20%), Positives = 76/173 (43%), Gaps = 6/173 (3%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNR----YVLYSNDNRELRILKMYRKNKRFIA 62
           L+ +A IG  HGL GEV +D   + P +              +  L +++   +  R+  
Sbjct: 2   LLNVARIGRAHGLRGEVALDLRTDAPQERLAVGAVLQTEPAGSGPLTVMRTRVQQGRWYV 61

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
           TF+   +  +A  L    L  +    +D + ++D ++  +L  +      G+  G+V G+
Sbjct: 62  TFAEASDRTAAEALTGTTLVVEVD--EDADADDDAWYPHELAGLRAEHVDGRVLGEVVGL 119

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMK 175
            +  A  +L ++       L+PF +  V  V+++  ++++DP    L +    
Sbjct: 120 EHAPAHDVLVVREPDGTRTLVPFVRAIVPTVDVRGGRVVLDPPGGLLASDAEN 172


>gi|315497157|ref|YP_004085961.1| 16S rRNA processing protein rimm [Asticcacaulis excentricus CB 48]
 gi|315415169|gb|ADU11810.1| 16S rRNA processing protein RimM [Asticcacaulis excentricus CB 48]
          Length = 180

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 51/177 (28%), Positives = 89/177 (50%), Gaps = 3/177 (1%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRE--LRILKMYRKNKRFI 61
           + +LV +A +  + G+ GE  + S+ ++P+ +  Y    N   E  L I          +
Sbjct: 1   MTELVFVAQVAASFGVRGEFKLISHMDDPLSVLEYNPLYNPRGEPALVITAARVHKGALV 60

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
               GI +   A  L+ LKLY +R+D  + E +ED+F+ TDL  +E     G   G++ G
Sbjct: 61  VKAEGISDKDKADALKGLKLYVRREDLPEVE-DEDDFYITDLIGLEVRSTDGSVIGRLKG 119

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQ 178
           V +FGAG +L+I+     ++ + FT+  V EVN+    ++I P    + N  ++  Q
Sbjct: 120 VEDFGAGDLLDIQPKGGASYYLMFTRENVPEVNIGAGYVVISPPQEVVVNEPLETDQ 176


>gi|164688560|ref|ZP_02212588.1| hypothetical protein CLOBAR_02205 [Clostridium bartlettii DSM
           16795]
 gi|164602973|gb|EDQ96438.1| hypothetical protein CLOBAR_02205 [Clostridium bartlettii DSM
           16795]
          Length = 170

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 51/173 (29%), Positives = 82/173 (47%), Gaps = 9/173 (5%)

Query: 4   LDKLVLM---ATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND---NRELRILKMYRKN 57
           +D  + +     I  T GL GEV +  Y ++    +    +  D   N +  + ++  K 
Sbjct: 1   MDNKLTVFRIGQIVNTQGLKGEVRVYPYTDDINRFDDLEYFYLDKGLNNKYEVERVRYKG 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              I    GID+I  A +L+   +Y  R     +ELEEDEFF  DL  ++ F   G+  G
Sbjct: 61  NMVIMKIKGIDSIELAQKLKTKNMYIGRDQ--GKELEEDEFFVADLIGLDVFTVDGEKVG 118

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
            V  V       +  + N  EK +LIP  +  V  ++L+ENK++I+PI   L+
Sbjct: 119 VVKDVLQHAINDVYVV-NNGEKEYLIPSIEKFVPTIDLEENKMIINPIKGMLD 170


>gi|114320046|ref|YP_741729.1| 16S rRNA processing protein RimM [Alkalilimnicola ehrlichii MLHE-1]
 gi|122312116|sp|Q0AA98|RIMM_ALHEH RecName: Full=Ribosome maturation factor rimM
 gi|114226440|gb|ABI56239.1| 16S rRNA processing protein RimM [Alkalilimnicola ehrlichii MLHE-1]
          Length = 170

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 37/169 (21%), Positives = 72/169 (42%), Gaps = 10/169 (5%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY-----SNDNRELRILKMYR 55
           M   D +V M  +   HG+ G V + S+      +  Y  +       D   +       
Sbjct: 1   MEGADDIVPMGEVVGLHGVRGWVKVYSHTEPREAILDYPHWYLRRDDGDWVPVERTAGRC 60

Query: 56  KNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKY 115
           + K  +A F  +++   A     L++   R+D  +  L E +++  DLE +  +   G+ 
Sbjct: 61  QGKGLVAAFRDVEDRDRARAYIGLQIGVPRRDLPE--LPEGQYYWADLEGLAAYTTGGEP 118

Query: 116 WGQVCGVYNFGAGSILEIKNTMEKTFLIPFT-KFAVLEVNLQENKILID 163
            G+V  ++  GA  +L ++   ++  L+PF     V  V+L   +I +D
Sbjct: 119 LGRVSHLFATGANDVLVLQ--GDRERLVPFVYGQTVRRVDLTAGRIELD 165


>gi|158320499|ref|YP_001513006.1| 16S rRNA processing protein RimM [Alkaliphilus oremlandii OhILAs]
 gi|166979605|sp|A8MHC3|RIMM_ALKOO RecName: Full=Ribosome maturation factor rimM
 gi|158140698|gb|ABW19010.1| 16S rRNA processing protein RimM [Alkaliphilus oremlandii OhILAs]
          Length = 167

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 35/169 (20%), Positives = 72/169 (42%), Gaps = 4/169 (2%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDN--RELRILKMYRKNKRFI 61
           + K++ +  I  THG+ G++ +    +             +    +  I  +  K    I
Sbjct: 1   MAKMLRVGKITNTHGIKGDLKVLPLTDYFERFEELEWVYIEGFKDKFYIENIKYKPTLVI 60

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCG 121
            +F G  +I+   + +D  L           L ED ++  D+  ++ F  + +Y G+V  
Sbjct: 61  LSFEGYGDINLVEKFKDRYLLIDESQ--RRILPEDTYYIADIIGLDVFTVKDEYIGKVVD 118

Query: 122 VYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
           +   G+  +  I+    K  +IP  K  + E++L++ +I IDPI   + 
Sbjct: 119 IIQTGSSEVYVIRMNNLKEIMIPSVKEFMPEISLEKKRITIDPIEGMIE 167


>gi|329120757|ref|ZP_08249419.1| 16S rRNA processing protein RimM [Neisseria bacilliformis ATCC
           BAA-1200]
 gi|327460554|gb|EGF06890.1| 16S rRNA processing protein RimM [Neisseria bacilliformis ATCC
           BAA-1200]
          Length = 169

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 43/167 (25%), Positives = 65/167 (38%), Gaps = 7/167 (4%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRK 56
           M +  + V M  I    G+ G V +         L  Y  +    +     + +      
Sbjct: 1   MAQETQWVAMGYIKGAFGIKGWVKVAVDTEYADSLLDYPEWRLSRNGKAVSVVLEAGKTA 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
                  F GI +  +A  LR   +   R DF++   EE E++  DL  M      G+  
Sbjct: 61  ADGLHVKFQGIGDRDAAQLLRGYTVEINRADFEET--EEGEYYWADLVGMTVITPAGETL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
           G V G+   GA  IL +++   +T LIPF    V EVN +   I  D
Sbjct: 119 GTVSGLMETGAHDILVVRHEGGET-LIPFVAQFVGEVNRETRTITAD 164


>gi|309792458|ref|ZP_07686922.1| hypothetical protein OSCT_2873 [Oscillochloris trichoides DG6]
 gi|308225446|gb|EFO79210.1| hypothetical protein OSCT_2873 [Oscillochloris trichoides DG6]
          Length = 174

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 36/169 (21%), Positives = 71/169 (42%), Gaps = 6/169 (3%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY---VLYSNDNRELRILKMYRKN-KRF 60
           D L+L+  I    G+ G+V + S+ + P  L R    +          + K++       
Sbjct: 8   DDLLLIGVIAGPFGVKGQVKLKSFTDRPDYLRRNLREIFVGKKLVPYTLTKLHEHKPGLL 67

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           I T   ++   +  ELR  +++ ++ D     L  DE++  DL  ++      +  G V 
Sbjct: 68  ILTLRDLETREAVDELRGCEVFIRQSD--AAPLGTDEYYLHDLIGLQVLTEANQEIGTVR 125

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGL 169
            +   G   +L +    +   LIP  +  V+ ++L   +++I PI   L
Sbjct: 126 EIIETGVHEVLIVSRPGQPDALIPVVREFVVNLDLAARQVVIRPIEGLL 174


>gi|170750014|ref|YP_001756274.1| 16S rRNA processing protein RimM [Methylobacterium radiotolerans
           JCM 2831]
 gi|209573582|sp|B1LVU1|RIMM_METRJ RecName: Full=Ribosome maturation factor rimM
 gi|170656536|gb|ACB25591.1| 16S rRNA processing protein RimM [Methylobacterium radiotolerans
           JCM 2831]
          Length = 231

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 47/188 (25%), Positives = 77/188 (40%), Gaps = 13/188 (6%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY-VLYSNDNRELRILKMYR----KNKRF 60
            LVL+   G  HGL GEV + SY  +P  +  Y  L ++D R L +  +           
Sbjct: 51  NLVLLGEFGRAHGLTGEVRLKSYTGDPQAIAGYGALQTSDGRTLALADVRPAPGSSPDML 110

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           IA   G+    +A  L  + L+  R      E +++ +   DL      D  G   G + 
Sbjct: 111 IARVKGVSGRSAAEALNRVALFVPRDRLAAPEDDDEVYA-ADLIGAAAVDEAGTLVGTIV 169

Query: 121 GVYNFGAGSILEIKNTMEK-TFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQY 179
            V N+G G +LE++      T L+PFTK  V  +++ + ++ +                 
Sbjct: 170 AVPNYGGGDLLELRPPNGGATALLPFTKAFVPVLDVAQRRVTVAAPEDLF------AAPG 223

Query: 180 DCPLDSAG 187
           + P D  G
Sbjct: 224 EKPADDPG 231


>gi|306836396|ref|ZP_07469374.1| 16S rRNA processing protein RimM [Corynebacterium accolens ATCC
           49726]
 gi|304567756|gb|EFM43343.1| 16S rRNA processing protein RimM [Corynebacterium accolens ATCC
           49726]
          Length = 165

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 35/168 (20%), Positives = 68/168 (40%), Gaps = 11/168 (6%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND-----NRELRILKMYRKNKRFIA 62
           +++  +  +HG+ GEV ++   + P                   EL I  +     R + 
Sbjct: 3   LMIGRVIKSHGIKGEVVVEPTTDEPEVRFAVGEKLQGRQGRKEHELTISAVRSHKGRLLV 62

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
           T   I +   A  LR  + +A        E +++ F++ +LE +      G+  G V  V
Sbjct: 63  TCKEIADRTQADSLRGTQFFA-----APLEDDDEGFYDHELEGLRVIR-DGEDIGAVVSV 116

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
            +  +  +LE++     + L+PF    V EV+++     I P    L+
Sbjct: 117 VHGPSQDLLEVELASGSSALVPFVHAIVPEVDVEAGTCTIQPPEGLLD 164


>gi|239917434|ref|YP_002956992.1| 16S rRNA processing protein RimM [Micrococcus luteus NCTC 2665]
 gi|281414076|ref|ZP_06245818.1| 16S rRNA processing protein RimM [Micrococcus luteus NCTC 2665]
 gi|239838641|gb|ACS30438.1| 16S rRNA processing protein RimM [Micrococcus luteus NCTC 2665]
          Length = 200

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 41/187 (21%), Positives = 76/187 (40%), Gaps = 13/187 (6%)

Query: 4   LDKLVLMATIGTTHGLNGEVYIDSYANNPIDLN----RYVLYSNDNR---ELRILKMYRK 56
            D LV +A IG  HG+ GEV +  + ++P        R V+         EL + +    
Sbjct: 6   QDDLVRVARIGKPHGIRGEVTVQVFTDDPDARFAPGERLVVRDGAPGLPAELTVTRARWN 65

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
            +  +  F+   + + A  LR  +L+A          E DE++  DL ++E     G+  
Sbjct: 66  KQILVVGFAESLDRNVAETLRGAQLFAV----PAAPEESDEWYEEDLVDLEVRI-DGERV 120

Query: 117 GQVCGVYNFGAGSILEIKNTM-EKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMK 175
           G V  +       +L +     E+  L+PF +  V E++ +   +++ P    L   T +
Sbjct: 121 GVVTALTTGAVQDLLHVAVDGVEEEALVPFVEEIVPEIDPKAGVLVLTPPPGLLELATGE 180

Query: 176 NPQYDCP 182
           +      
Sbjct: 181 DEDAADG 187


>gi|304389812|ref|ZP_07371771.1| 16S rRNA processing protein RimM [Mobiluncus curtisii subsp.
           curtisii ATCC 35241]
 gi|304326988|gb|EFL94227.1| 16S rRNA processing protein RimM [Mobiluncus curtisii subsp.
           curtisii ATCC 35241]
          Length = 192

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 36/188 (19%), Positives = 67/188 (35%), Gaps = 25/188 (13%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRE----LRILKMYRKNKRFIA 62
            + +  IG   G+ GEV +    ++P            NR     L + +     K F+ 
Sbjct: 2   KLTVGIIGRASGVRGEVRVALRTDDPRSRFAPGTVLLTNRNSPAALTVDQARMSGKHFVV 61

Query: 63  TFSGIDNIHSASELRDLKLYAKRQ---------------------DFKDEELEEDEFFNT 101
           +F  I + + A  L   KLY +                       D+ +    +D F+  
Sbjct: 62  SFQEIPDRNDAETLSGTKLYIETDAPPLCTDPGDTSDTTADPETADYPETTEGDDGFYRH 121

Query: 102 DLEEMETFDRQGKYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKIL 161
           +L  +   +  G+  G +  +    A  +LE+     +  L+PF    V +V+L    + 
Sbjct: 122 ELVGLRAMNLAGETLGTISDLLLAPAQDLLEVTTAQGEKILVPFVYEIVPDVDLDNGLVT 181

Query: 162 IDPIAAGL 169
           +DP     
Sbjct: 182 MDPPGGLF 189


>gi|161831215|ref|YP_001596374.1| 16S rRNA-processing protein RimM [Coxiella burnetii RSA 331]
 gi|189040132|sp|A9NBR0|RIMM_COXBR RecName: Full=Ribosome maturation factor rimM
 gi|161763082|gb|ABX78724.1| 16S rRNA processing protein RimM [Coxiella burnetii RSA 331]
          Length = 168

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 30/166 (18%), Positives = 78/166 (46%), Gaps = 7/166 (4%)

Query: 2   VKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMYRKN 57
           +K +  V++  +   +GL G + + S+ +   +L  +  +    +N+ + L++       
Sbjct: 1   MKPNDKVIIGRLARPYGLRGWIKVVSFTHPIDNLLNHPTWQIQHNNEWQPLKLQAGKLHE 60

Query: 58  KRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWG 117
              +     ID+  +A    +  +  +R+      L+E +++ TDL  +   +  G   G
Sbjct: 61  PFLVVKLENIDDPETAKHYTNDLIAIERRAL--GALKEGDYYWTDLIGLAVVNTHGIELG 118

Query: 118 QVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID 163
            V  +   G+  +L +++  E+  LIP+T + +  ++L++  I+++
Sbjct: 119 TVDSLIETGSNDVLVVRS-KERERLIPYTSYTIQSIDLEKKIIVVE 163


>gi|227904206|ref|ZP_04022011.1| 16S rRNA processing protein [Lactobacillus acidophilus ATCC 4796]
 gi|227868225|gb|EEJ75646.1| 16S rRNA processing protein [Lactobacillus acidophilus ATCC 4796]
          Length = 187

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 39/172 (22%), Positives = 76/172 (44%), Gaps = 7/172 (4%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLN----RYVLYSNDNRELRILKMYRKNKRFI 61
           +   +A I TTHGL+GEV ++   + P D      +  L  + +R L I K     + ++
Sbjct: 18  QYFDVARILTTHGLHGEVKVNVITDFPEDRFAEGMQLELKDDIDRVLTIKKSRPFKQFWL 77

Query: 62  ATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMET-FDRQGKYWGQVC 120
             F  I +I  A +LR   L    +D    EL +  ++  D+ +     +  GK  G++ 
Sbjct: 78  LQFDEITDIDEAEKLRGKILVISEKD--RGELPDGVYYYKDIFDCGVIDNETGKRLGKIT 135

Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNT 172
            + + GA  I  +     K + IP     V ++++ + K+ ++ +    +  
Sbjct: 136 DIQSPGANDIWLVHEDNGKEYWIPNIADVVKKIDIADKKVYVELMEGLRDED 187


>gi|119899189|ref|YP_934402.1| 16S rRNA processing protein [Azoarcus sp. BH72]
 gi|166226423|sp|A1K9L0|RIMM_AZOSB RecName: Full=Ribosome maturation factor rimM
 gi|119671602|emb|CAL95515.1| conserved hypothetical 16S rRNA processing protein [Azoarcus sp.
           BH72]
          Length = 168

 Score =  125 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 32/171 (18%), Positives = 72/171 (42%), Gaps = 18/171 (10%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYS---------NDNRELRIL 51
           M+      ++  I    G+ G + I  + ++P    +   +          +   + ++ 
Sbjct: 1   MM------VLGRIVAPFGVQGWLKIHPFGDDPAAWRKMTHWWLAEDPDGPESAWVQYKLA 54

Query: 52  KMYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDR 111
                 K  +A   G+ + ++A  +    + A R      E +E  ++  DL  ++  + 
Sbjct: 55  SCRPHGKGLVALLEGVPDRNAAEAIEGRYVGAPRDAMPAPEKDE--YYWGDLVGLDVVNE 112

Query: 112 QGKYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILI 162
             +  G+V G+ + GA  +L++++  E   LIPF    VL+V+L   +I +
Sbjct: 113 TDETLGRVSGLISTGAHDVLQVED-GETERLIPFVAAYVLDVDLAARRIRV 162


>gi|227503361|ref|ZP_03933410.1| 16S rRNA-processing protein [Corynebacterium accolens ATCC 49725]
 gi|227075864|gb|EEI13827.1| 16S rRNA-processing protein [Corynebacterium accolens ATCC 49725]
          Length = 165

 Score =  125 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 35/168 (20%), Positives = 70/168 (41%), Gaps = 11/168 (6%)

Query: 8   VLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSND-----NRELRILKMYRKNKRFIA 62
           +++  +  +HG+ GEV ++   + P                   EL I  +     R + 
Sbjct: 3   LMIGRVIKSHGIKGEVVVEPTTDEPEVRFAVGEKLQGRQGRKEHELTISAVRSHKGRLLV 62

Query: 63  TFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGV 122
           T   I +   A  LR  + +A        E +++ F++ +LE +      G+  G V  V
Sbjct: 63  TCKEIADRTQADSLRGTQFFA-----APLEDDDEGFYDHELEGLRVIR-DGEDIGAVVSV 116

Query: 123 YNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLN 170
            +  +  +LE++ +   + L+PF    V EV+++     I+P    L+
Sbjct: 117 VHGPSQDLLEVELSTGSSALVPFVHAIVPEVDVEAGTCTIEPPEGLLD 164


>gi|78484993|ref|YP_390918.1| 16S rRNA processing protein RimM [Thiomicrospira crunogena XCL-2]
 gi|109893065|sp|Q31HX9|RIMM_THICR RecName: Full=Ribosome maturation factor rimM
 gi|78363279|gb|ABB41244.1| 16S rRNA processing protein RimM [Thiomicrospira crunogena XCL-2]
          Length = 181

 Score =  125 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 37/175 (21%), Positives = 77/175 (44%), Gaps = 15/175 (8%)

Query: 1   MV--KLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLY----SNDNRELRILKMY 54
           M+  K D+ +++  I   +G+ G V I S+ +   ++  Y  +     N+ R  ++ +  
Sbjct: 1   MMSSKQDEKIILGQINGIYGVQGWVKIFSHTDPRQNILSYSPWLVKVKNEWRTFQVEEGR 60

Query: 55  RK--NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQ 112
            +   K  +A   GID+   A E    ++    +        E+ F+   L   +    +
Sbjct: 61  AQQGGKSVVAKLEGIDDRDLAREYIGCEIAILPEQLPAT---EEGFYWMQLIGCQVTSVE 117

Query: 113 GKYWGQVCGVYNFGAGSILEIKNTMEK---TFLIPFTKF-AVLEVNLQENKILID 163
           G+  GQV  +   GA  +L ++   +    + LIPF     +L+V+++  +I +D
Sbjct: 118 GEDLGQVTEIVETGAHDVLRVEKQSDAGLVSTLIPFVMETFILDVDVESKQIQVD 172


>gi|29653789|ref|NP_819481.1| 16S rRNA-processing protein RimM [Coxiella burnetii RSA 493]
 gi|154706710|ref|YP_001424968.1| 16S rRNA-processing protein RimM [Coxiella burnetii Dugway
           5J108-111]
 gi|212213070|r