RPSBLAST alignment for GI: 254780713 and conserved domain: PRK00122

>gnl|CDD|178881 PRK00122, rimM, 16S rRNA-processing protein RimM; Provisional. Length = 172
 Score =  127 bits (322), Expect = 2e-30
 Identities = 47/170 (27%), Positives = 83/170 (48%), Gaps = 6/170 (3%)

Query: 1   MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDL----NRYVLYSNDNRELRILKMYRK 56
           M K + L+++  I + HG+ GEV + S+ + P  +       +    + +E+ I      
Sbjct: 1   MSKPEDLLVVGKIVSAHGIKGEVKVKSFTDFPERIFDYGPWLLGKGGEWQEVEIESGRFH 60

Query: 57  NKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYW 116
               I  F G+D+ ++A  L+  +L+  R      ELEEDE++  DL  +E  D  G+  
Sbjct: 61  KGFLIVKFEGVDDRNAAEALKGCELFVPRSQL--PELEEDEYYWHDLIGLEVVDEDGEEL 118

Query: 117 GQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIA 166
           G+V  +   GA  +L +    ++  LIPF +  V EV+L+  +I +D   
Sbjct: 119 GKVTDILETGANDVLVVLKDKKEERLIPFVEEVVKEVDLEAKRITVDWPE 168