RPSBLAST alignment of GI: 254780713 and protein with PDBid: 2dyi

>2dyi_A Probable 16S rRNA-processing protein RIMM; ribosomal protein S19, PRC-barrel, structural genomics, NPPSFA; 2.00A {Thermus thermophilus HB8} PDB: 2dog_A Length = 162
 Score = 92.8 bits (230), Expect = 4e-20
 Identities = 35/165 (21%), Positives = 66/165 (40%), Gaps = 14/165 (8%)

Query: 6   KLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRFIATFS 65
           +LV +   G  + L G +        P+ L+   +Y   +    I  +YR  +  +   +
Sbjct: 2   RLVEIGRFGAPYALKGGLRFRG---EPVVLHLERVYVEGHGWRAIEDLYRVGEELVVHLA 58

Query: 66  GIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVCGVYNF 125
           G+ +   A  L  L++Y   +      LEE  ++   L  +  +    +  G+V  + + 
Sbjct: 59  GVTDRTLAEALVGLRVY--AEVADLPPLEEGRYYYFALIGLPVYVEG-RQVGEVVDILDA 115

Query: 126 GAGSILEIKNTME-----KTFLIPFTKFAVLEVNLQENKILIDPI 165
           GA  +L I+   E        L+P        V ++E  I +DPI
Sbjct: 116 GAQDVLIIRGVGERLRDRAERLVPLQA---PYVRVEEGSIHVDPI 157