RPSBLAST alignment of GI: 254780713 and protein with PDBid: 2f1l

>2f1l_A 16S rRNA processing protein; 9949912, structural genomics, PSI, protein structure initiative, joint center for structural genomics, JCSG; HET: UNL; 2.46A {Pseudomonas aeruginosa} SCOP: b.41.1.4 b.43.3.4 Length = 187
 Score =  100 bits (249), Expect = 3e-22
 Identities = 36/168 (21%), Positives = 76/168 (45%), Gaps = 10/168 (5%)

Query: 5   DKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNRELRILKMYRKNKRF 60
           D LV++  I + +G+ GEV + S+ +   +L  Y    +    + R+  +++     K  
Sbjct: 18  DDLVVIGKIVSVYGIRGEVKVYSFTDPLDNLLDYRRWTLRRDGEIRQAELVRGRLHGKVL 77

Query: 61  IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
            A   G+D+   A      ++   R +     LEE E++   LE ++  D+  +  G + 
Sbjct: 78  AAKLKGLDDREEARTFTGYEICIPRSEL--PSLEEGEYYWHQLEGLKVIDQGRQLLGVID 135

Query: 121 GVYNFGAGSILEIKNTM----EKTFLIPFTKFAVLEVNLQENKILIDP 164
            +   GA  ++ +K       ++  L+P+T   VL ++L   ++ +D 
Sbjct: 136 HLLETGANDVMVVKPCAGSLDDRERLLPYTGQCVLSIDLAAGEMRVDW 183