RPSBLAST alignment of GI: 254780713 and SCOP domain: d2f1la1

Alignment
>d2f1la1 b.41.1.4 (A:101-175) 16S rRNA processing protein RimM, C-terminal domain {Pseudomonas aeruginosa [TaxId: 287]} Length = 75
 Score = 62.8 bits (153), Expect = 2e-11
 Identities = 14/70 (20%), Positives = 34/70 (48%), Gaps = 4/70 (5%)

Query: 98  FFNTDLEEMETFDRQGKYWGQVCGVYNFGAGSILEIKNTM----EKTFLIPFTKFAVLEV 153
           ++   LE ++  D+  +  G +  +   GA  ++ +K       ++  L+P+T   VL +
Sbjct: 1   YYWHQLEGLKVIDQGRQLLGVIDHLLETGANDVMVVKPCAGSLDDRERLLPYTGQCVLSI 60

Query: 154 NLQENKILID 163
           +L   ++ +D
Sbjct: 61  DLAAGEMRVD 70

SCOP domain information

class: All beta proteins
fold: PRC-barrel domain
superfamily: PRC-barrel domain
family: RimM C-terminal domain-like
domain: 16S rRNA processing protein RimM, C-terminal domain
species: Pseudomonas aeruginosa [TaxId: 287]