RPS-BLAST 2.2.22 [Sep-27-2009]

Database: scop70_1_75 
           13,730 sequences; 2,407,596 total letters

Searching..................................................done

Query= gi|254780713|ref|YP_003065126.1| 16S rRNA-processing protein
[Candidatus Liberibacter asiaticus str. psy62]
         (190 letters)



>d2f1la2 b.43.3.4 (A:7-95) 16S rRNA processing protein RimM,
          N-terminal domain {Pseudomonas aeruginosa [TaxId: 287]}
          Length = 89

 Score = 63.8 bits (155), Expect = 1e-11
 Identities = 17/86 (19%), Positives = 37/86 (43%), Gaps = 4/86 (4%)

Query: 7  LVLMATIGTTHGLNGEVYIDSYANNPIDLNRY----VLYSNDNRELRILKMYRKNKRFIA 62
          LV++  I + +G+ GEV + S+ +   +L  Y    +    + R+  +++     K   A
Sbjct: 2  LVVIGKIVSVYGIRGEVKVYSFTDPLDNLLDYRRWTLRRDGEIRQAELVRGRLHGKVLAA 61

Query: 63 TFSGIDNIHSASELRDLKLYAKRQDF 88
             G+D+   A      ++   R + 
Sbjct: 62 KLKGLDDREEARTFTGYEICIPRSEL 87


>d2f1la1 b.41.1.4 (A:101-175) 16S rRNA processing protein RimM,
           C-terminal domain {Pseudomonas aeruginosa [TaxId: 287]}
          Length = 75

 Score = 62.8 bits (153), Expect = 2e-11
 Identities = 14/70 (20%), Positives = 34/70 (48%), Gaps = 4/70 (5%)

Query: 98  FFNTDLEEMETFDRQGKYWGQVCGVYNFGAGSILEIKNTM----EKTFLIPFTKFAVLEV 153
           ++   LE ++  D+  +  G +  +   GA  ++ +K       ++  L+P+T   VL +
Sbjct: 1   YYWHQLEGLKVIDQGRQLLGVIDHLLETGANDVMVVKPCAGSLDDRERLLPYTGQCVLSI 60

Query: 154 NLQENKILID 163
           +L   ++ +D
Sbjct: 61  DLAAGEMRVD 70


>d1f3rb2 b.1.1.1 (B:139-257) Immunoglobulin light chain kappa
           variable domain, VL-kappa {Rat (Rattus norvegicus)
           [TaxId: 10116]}
          Length = 119

 Score = 27.1 bits (59), Expect = 0.91
 Identities = 9/20 (45%), Positives = 12/20 (60%)

Query: 115 YWGQVCGVYNFGAGSILEIK 134
           +  Q    Y FGAG+ LE+K
Sbjct: 87  FCYQYNNGYTFGAGTKLELK 106


>d1ml9a_ b.85.7.1 (A:) Dim-5 {Fungus (Neurospora crassa) [TaxId:
           5141]}
          Length = 284

 Score = 26.4 bits (57), Expect = 1.7
 Identities = 18/101 (17%), Positives = 29/101 (28%), Gaps = 8/101 (7%)

Query: 28  YANNPIDLNRYVLYSNDNRELRILKMYRKNK-RFIATFSGIDNI-------HSASELRDL 79
           +A +       +      + L +   Y     RFI      +         H+   + DL
Sbjct: 182 FALDKFSDPDSLDPLLAGQPLEVDGEYMSGPTRFINHSCDPNMAIFARVGDHADKHIHDL 241

Query: 80  KLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
            L+A +   K  EL  D        E +  D         C
Sbjct: 242 ALFAIKDIPKGTELTFDYVNGLTGLESDAHDPSKISEMTKC 282


>d1jqoa_ c.1.12.3 (A:) Phosphoenolpyruvate carboxylase {Escherichia
           coli [TaxId: 562]}
          Length = 936

 Score = 26.2 bits (57), Expect = 2.0
 Identities = 14/66 (21%), Positives = 26/66 (39%), Gaps = 5/66 (7%)

Query: 43  NDNRELRILK-MYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNT 101
            D R  ++LK MY +   F  T   ++ + +  +     LY +      EEL+   F   
Sbjct: 770 KDVRNFQVLKEMYNEWPFFRVTLDLLEMVFAKGDPGIAGLYDELLV--AEELK--PFGKQ 825

Query: 102 DLEEME 107
             ++  
Sbjct: 826 LRDKYV 831


>d1a0ql1 b.1.1.1 (L:2-108) Immunoglobulin light chain kappa variable
           domain, VL-kappa {Mouse (Mus musculus), cluster 4
           [TaxId: 10090]}
          Length = 106

 Score = 25.8 bits (56), Expect = 2.7
 Identities = 9/20 (45%), Positives = 11/20 (55%)

Query: 115 YWGQVCGVYNFGAGSILEIK 134
           Y  Q   +  FG G+ LEIK
Sbjct: 86  YCLQYYNLRTFGGGTKLEIK 105


>d1q9ra1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable
           domain, VL-kappa {Mouse (Mus musculus), cluster 1.2
           [TaxId: 10090]}
          Length = 113

 Score = 25.0 bits (54), Expect = 3.9
 Identities = 9/20 (45%), Positives = 11/20 (55%)

Query: 115 YWGQVCGVYNFGAGSILEIK 134
           Y  Q   +  FG G+ LEIK
Sbjct: 93  YCKQSYNLRTFGGGTKLEIK 112


>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC
           {Synechococcus sp. strain PCC 7942 (Anacystis nidulans
           R2) [TaxId: 1140]}
          Length = 242

 Score = 24.9 bits (53), Expect = 4.6
 Identities = 6/47 (12%), Positives = 15/47 (31%)

Query: 7   LVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKM 53
               +          + +I +  +  I L    +    +R + + KM
Sbjct: 157 FTNTSDQFMGAHSITDSHISTITDTIILLQYVEIRGEMSRAINVFKM 203


>d1laja_ b.121.4.5 (A:) Cucumovirus coat protein {TAV (Tomato
           aspermy virus) [TaxId: 12315]}
          Length = 174

 Score = 24.4 bits (53), Expect = 6.6
 Identities = 12/33 (36%), Positives = 18/33 (54%), Gaps = 1/33 (3%)

Query: 73  ASELRDLKLYAKRQDFKDEELEEDEF-FNTDLE 104
            +E+ D+  YA     KD+ LE DE   + D+E
Sbjct: 130 GAEIGDMGKYALIVYSKDDVLEADEMVIHIDIE 162


>d1jqna_ c.1.12.3 (A:) Phosphoenolpyruvate carboxylase {Escherichia
           coli [TaxId: 562]}
          Length = 880

 Score = 24.3 bits (52), Expect = 6.9
 Identities = 11/59 (18%), Positives = 22/59 (37%), Gaps = 4/59 (6%)

Query: 37  RYVLYSNDNRELRILKMYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEE 95
           + V+      EL    M R    F      ++ + + ++L   + Y +R    D+ L  
Sbjct: 736 QKVVEDGKQSELE--AMCRDWPFFSTRLGMLEMVFAKADLWLAEYYDQR--LVDKALWP 790


>d1jk7a_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human (Homo
           sapiens), beta isoform [TaxId: 9606]}
          Length = 294

 Score = 24.2 bits (52), Expect = 7.7
 Identities = 7/24 (29%), Positives = 15/24 (62%), Gaps = 1/24 (4%)

Query: 120 CGVYNFGAGSILEIKNTMEKTFLI 143
           CG ++  AG+++ +  T+  +F I
Sbjct: 268 CGEFD-NAGAMMSVDETLMCSFQI 290


>d1je0a_ c.56.2.1 (A:) 5'-deoxy-5'-methylthioadenosine
          phosphorylase {Archaeon Sulfolobus solfataricus [TaxId:
          2287]}
          Length = 234

 Score = 24.0 bits (51), Expect = 8.9
 Identities = 6/31 (19%), Positives = 9/31 (29%)

Query: 43 NDNRELRILKMYRKNKRFIATFSGIDNIHSA 73
          N+NR   +       +       GI     A
Sbjct: 38 NENRGFLVYTGKYNGETVSIATHGIGGPSIA 68


>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor,
           TRCF {Escherichia coli [TaxId: 562]}
          Length = 233

 Score = 24.0 bits (51), Expect = 9.3
 Identities = 9/48 (18%), Positives = 17/48 (35%), Gaps = 2/48 (4%)

Query: 73  ASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120
           A+EL  L +YA+R   +    + D        +   F+        + 
Sbjct: 20  AAEL--LDIYAQRAAKEGFAFKHDREQYQLFCDSFPFETTPDQAQAIN 65


  Database: scop70_1_75
    Posted date:  Mar 27, 2010  6:21 PM
  Number of letters in database: 2,407,596
  Number of sequences in database:  13,730
  
Lambda     K      H
   0.318    0.137    0.392 

Gapped
Lambda     K      H
   0.267   0.0556    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 13730
Number of Hits to DB: 717,563
Number of extensions: 33560
Number of successful extensions: 130
Number of sequences better than 10.0: 1
Number of HSP's gapped: 128
Number of HSP's successfully gapped: 17
Length of query: 190
Length of database: 2,407,596
Length adjustment: 80
Effective length of query: 110
Effective length of database: 1,309,196
Effective search space: 144011560
Effective search space used: 144011560
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.4 bits)