BLAST/PSIBLAST alignment of GI: 254780715 and GI: 15966999 at iteration 1
>gi|15966999|ref|NP_387352.1| 50S ribosomal protein L19 [Sinorhizobium meliloti 1021] Length = 177
>gi|307302467|ref|ZP_07582224.1| ribosomal protein L19 [Sinorhizobium meliloti BL225C] Length = 177
>gi|307316203|ref|ZP_07595647.1| ribosomal protein L19 [Sinorhizobium meliloti AK83] Length = 177
>gi|20978616|sp|Q92L39|RL19_RHIME RecName: Full=50S ribosomal protein L19 Length = 177
>gi|15076272|emb|CAC47825.1| Probable 50S ribosomal protein L19 [Sinorhizobium meliloti 1021] Length = 177
>gi|306898043|gb|EFN28785.1| ribosomal protein L19 [Sinorhizobium meliloti AK83] Length = 177
>gi|306903137|gb|EFN33727.1| ribosomal protein L19 [Sinorhizobium meliloti BL225C] Length = 177
 Score =  188 bits (477), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 115/137 (83%)

Query: 1   MNIIDELDHEEMVRIESKRSLPKFSPGDTLCVKTIITEGDKSRIQAYEGVCIARSGRGIN 60
           MNII +L+ E+  +I +KR+LP+FSPGDT+ V   + EG+++R+QAYEGVCIARSG GIN
Sbjct: 1   MNIIQQLEAEQAAKIAAKRTLPEFSPGDTVRVNVRVVEGNRTRVQAYEGVCIARSGGGIN 60

Query: 61  KNFTVRKISYGEGMNRLFPLYSPMIQDITVIRRGKVRRSKLYYLQDLRGKAARIKENTGK 120
           ++FTVRKISYGEG+ R+FP+YSP+++ + V+RRGKVRR+KLYYL+D RGK+ARI ENTG 
Sbjct: 61  ESFTVRKISYGEGVERVFPVYSPLVESVDVVRRGKVRRAKLYYLRDRRGKSARIVENTGT 120

Query: 121 RAKALNEEVRRAALPEK 137
           RA+ LN+  R+A + EK
Sbjct: 121 RARKLNDAERQAVVEEK 137