PSIBLAST alignment of GI: 254780715 and protein with PDB id: 1p85

>gi|33357915|pdb|1P85|N Chain N, Real Space Refined Coordinates Of The 50s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp State Of E. Coli 70s Ribosome Length = 114
>gi|33357943|pdb|1P86|N Chain N, Real Space Refined Coordinates Of The 50s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Initiation-Like State Of E. Coli 70s Ribosome Length = 114
 Score =  124 bits (311), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 62/118 (52%), Positives = 83/118 (70%), Gaps = 5/118 (4%)

Query: 2   NIIDELDHEEMVRIESKRSLPKFSPGDTLCVKTIITEGDKSRIQAYEGVCIARSGRGINK 61
           NII +L+ E+M     K+ +P F PGDT+ VK  + EG K R+QA+EGV IA   RG++ 
Sbjct: 2   NIIKQLEQEQM-----KQDVPSFRPGDTVEVKVWVVEGSKKRLQAFEGVVIAIRNRGLHS 56

Query: 62  NFTVRKISYGEGMNRLFPLYSPMIQDITVIRRGKVRRSKLYYLQDLRGKAARIKENTG 119
            FTVRKIS GEG+ R+F  +SP++  I+V RRG VR++KLYYL++  GKAARIKE   
Sbjct: 57  AFTVRKISNGEGVERVFQTHSPVVDSISVKRRGAVRKAKLYYLRERTGKAARIKERLN 114