>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase. Glutamyl-tRNA reductase catalyzes the conversion of glutamyl-tRNA to glutamate-1-semialdehyde, initiating the synthesis of tetrapyrrole. Whereas tRNAs are generally associated with peptide bond formation in protein translation, here the tRNA activates glutamate in the initiation of tetrapyrrole biosynthesis in archaea, plants and many bacteria. In the first step, activated glutamate is reduced to glutamate-1-semi-aldehyde via the NADPH dependent glutamyl-tRNA reductase. Glutamyl-tRNA reductase forms a V-shaped dimer. Each monomer has 3 domains: an N-terminal catalytic domain, a classic nucleotide binding domain, and a C-terminal dimerization domain. Although the representative structure 1GPJ lacks a bound NADPH, a theoretical binding pocket has been described. (PMID 11172694). Amino acid dehydrogenase (DH)-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate,

Probab=98.24 E-value=1.8e-05 Score=59.97 Aligned_cols=95 Identities=16% Similarity=0.317 Sum_probs=66.7 Q ss_pred CCCEEEEEECCHHHHHHHHHHHHCCC-EEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHH Q ss_conf 98805698157111688999997898-59997399899999997122112784032898999860577889999769906 Q gi|254780716|r 2 KQADIGIIGLGSMGSNLSLNILDKGF-RLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGD 80 (475) Q Consensus 2 ~k~~IGiIGLG~MG~~mA~nL~~~G~-~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~ 80 (475) T Consensus 177 ~~~~vLviGaGem~~l~~~~L~~~g~~~i~v~nRt~~ra~~la~~~g~---~~---~~~~~l~~~l~~~DvvisaT~s~~ 250 (311) T cd05213 177 KGKKVLVIGAGEMGELAAKHLAAKGVAEITIANRTYERAEELAKELGG---NA---VPLDELLELLNEADVVISATGAPH 250 (311) T ss_pred CCCEEEEECCCHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHCCC---EE---ECHHHHHHHHHHCCEEEEECCCCC T ss_conf 116799986879999999999965998259976867899999997498---99---729999999976899999279996 Q ss_pred HHHHHHHHHH-HCCCCCCEEEECC Q ss_conf 9999999997-2078998999679 Q gi|254780716|r 81 PVDQLIDKLK-PLLSPEDILLDGG 103 (475) Q Consensus 81 ~v~~vi~~l~-~~l~~g~iiID~s 103 (475) T Consensus 251 ~~~~~-~~~~~~~~~~~~~iiDLa 273 (311) T cd05213 251 YAKIV-ERAMKKRSGKPRLIVDLA 273 (311) T ss_pred CHHHH-HHHHHHCCCCCEEEEEEC T ss_conf 20359-999753479976999917

HHsearch alignment for GI: 254780716 and conserved domain: cd05213