RPSBLAST alignment for GI: 254780718 and conserved domain: PRK14241

>gnl|CDD|184587 PRK14241, PRK14241, phosphate transporter ATP-binding protein; Provisional. Length = 258
 Score = 62.8 bits (153), Expect = 7e-11
 Identities = 53/211 (25%), Positives = 101/211 (47%), Gaps = 42/211 (19%)

Query: 11  ISLSNTSFHKNGYKILQDINFTIKPNEIVTLIGPNGSGKSTIAKLITGIIKPTIGSVKRH 70
           I + + + +   +  ++D+N  I+P  +   IGP+G GKST+ + +  + +   G+    
Sbjct: 5   IDVKDLNIYYGSFHAVEDVNLNIEPRSVTAFIGPSGCGKSTVLRTLNRMHEVIPGARVEG 64

Query: 71  PQLIVG---YVP--QKVTIENTLPLSLMR---FMTLSMPSSRDDVLQILDRVNLIGKYNR 122
             L+ G   Y P    V +  T+ +   R   F T+S+   RD+V+     + L G  N+
Sbjct: 65  EVLLDGEDLYGPGVDPVAVRRTIGMVFQRPNPFPTMSI---RDNVVA---GLKLNGVRNK 118

Query: 123 N------------------IKD--------LSGGEFQRALLAKALLRKPNLLVLDEPLQG 156
                              +KD        LSGG+ QR  +A+A+  +P++L++DEP   
Sbjct: 119 KDLDELVEKSLRGANLWNEVKDRLDKPGGGLSGGQQQRLCIARAIAVEPDVLLMDEPCSA 178

Query: 157 IDFPGELSLYELITSVRQSTGCGILLISHNL 187
           +D    L++ +LI  ++Q     I++++HN+
Sbjct: 179 LDPISTLAIEDLINELKQDY--TIVIVTHNM 207