RPSBLAST alignment for GI: 254780718 and conserved domain: KOG0061

>gnl|CDD|35284 KOG0061, KOG0061, KOG0061, Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism]. Length = 613
 Score = 79.6 bits (196), Expect = 8e-16
 Identities = 65/229 (28%), Positives = 107/229 (46%), Gaps = 31/229 (13%)

Query: 11  ISLSNTSFHKNGYKILQDINFTIKPNEIVTLIGPNGSGKSTIAKLITGIIKP---TIGSV 67
           ++LS+    K    IL+ ++ T KP E++ ++GP+GSGK+T+   + G +       G +
Sbjct: 31  LTLSSKEKSKKTKTILKGVSGTAKPGELLAIMGPSGSGKTTLLNALAGRLNGGLKLSGEI 90

Query: 68  --------KRHPQLIVGYVPQKVTIENTLPLS--LMRFMTLSMPSSR---------DDVL 108
                    R  + I GYV Q   +  TL +   L     L +PSS          ++V+
Sbjct: 91  LLNGRPRDSRSFRKISGYVQQDDVLLPTLTVRETLRFSALLRLPSSLSKEEKRERVEEVI 150

Query: 109 QILD----RVNLIGKYNRNIKDLSGGEFQRALLAKALLRKPNLLVLDEPLQGIDFPGELS 164
             L        LIG  N  I+ LSGGE +R  +A  LL  P++L LDEP  G+D    L 
Sbjct: 151 SELGLEKCADTLIG--NPGIRGLSGGERKRVSIALELLTDPSILFLDEPTSGLDSFSALQ 208

Query: 165 LYELITSVRQSTGCGILLISHNL-HMVMASTDTVICLNN-RICYQGPPQ 211
           + +L+  + +S G  ++   H     +    D ++ L+   + Y G P+
Sbjct: 209 VVQLLKRLARS-GRTVICTIHQPSSELFELFDKLLLLSEGEVVYSGSPR 256