HHsearch alignment for GI: 254780719 and conserved domain: COG0609

>COG0609 FepD ABC-type Fe3+-siderophore transport system, permease component [Inorganic ion transport and metabolism].
Probab=99.90  E-value=1.4e-20  Score=130.49  Aligned_cols=247  Identities=17%  Similarity=0.257  Sum_probs=185.4

Q ss_pred             HHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHC---C-----HHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             99999999987889999----998799964358999999999999950---0-----36679999999999998631035
Q gi|254780719|r   11 FSGIGIVLSTGPLGCFI----IWQRIAYFGDTIAHSALLGVALSLIFQ---L-----PLTICIFMIATLTSLVLLQIQKN   78 (260)
Q Consensus        11 l~~~~~~~~~~~lG~~v----v~rr~s~~~~alsH~a~~Gial~~~l~---~-----~~~~ga~~~~~l~al~i~~l~~~   78 (260)
T Consensus        59 l~a~l~Ga~LavsG~~lQ~v~rNpLAdP~ilGIssGA~~~~~l~i~~~~~~~~~~~~~l~~~af~ga~~~~~lv~~ia~~  138 (334)
T COG0609          59 LLAILVGAALAVAGALLQGVTRNPLADPGILGISSGASLGAVLAILLFPLGLGISIYLLPLAAFLGALLAALLVYLIARL  138 (334)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHCHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999999548789932305655699999999999840100378999999999999999999999985


Q ss_pred             CCC--HHH--HHHHHHHHHHHHHHHHHHH-HCCC--CHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             765--045--6999999999999999996-2132--00133344333244228767058999989999999842456654
Q gi|254780719|r   79 EAL--SSD--AILGVITHSTISLALVILS-FMKW--VNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLA  151 (260)
Q Consensus        79 ~~~--~~d--a~igi~~s~~~alg~llls-~~~~--~~~~l~~~LfG~il~v~~~dv~~~~~~~~~~~~~l~~~~r~l~~  151 (260)
T Consensus       139 ~~~~~~~~~liL~Giais~~~~al~~~l~~~~~~~~~~~~~~~Wl~Gsl~~~~w~~~~~~~~~~~i~l~~~~~~~~~l~i  218 (334)
T COG0609         139 RGGGLSPLRLILAGIALSALFGALTSLLLILADDSLALQAILFWLLGSLGGATWSDVLILLPVILIGLLLLLFLSRKLNI  218 (334)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCH
T ss_conf             16888838999999999999999999999966738777784987505645587788899999999999999999774767


Q ss_pred             HCCCHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             12888999980898106776999999999999999988999999999999999974199899999999999999999999
Q gi|254780719|r  152 TTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLY  231 (260)
Q Consensus       152 ~~fD~~~A~~~Gi~v~~~~~l~~~l~al~v~~~v~~vG~llv~allv~Paa~A~~l~~~~~~~~~~s~~~g~~~~~~G~~  231 (260)
T Consensus       219 l~lgd~~A~~LGi~v~~~r~~~~i~a~llt~~~Vs~~G~I~FVG-Li~PHiaR~lvg~~~r~lip~s~l~Ga~lll~aD~  297 (334)
T COG0609         219 LSLGDELAKSLGINVNRLRLLLLLLASLLTAAAVSLVGPIGFVG-LIAPHIARLLVGNDHRYLLPLSALLGALLLLLADI  297 (334)
T ss_pred             HHCCHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHCHHHHHH-HHHHHHHHHHHCCCCCEEHHHHHHHHHHHHHHHHH
T ss_conf             54498999877987899999999999999999999812168888-63899999982876422178789999999999999


Q ss_pred             HHH----HHCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             999----9558808999999999999998723
Q gi|254780719|r  232 GSL----IFDTPSGPSIIITSLFLFILSFFYK  259 (260)
Q Consensus       232 lS~----~~~lp~g~~Iv~~~~~~f~~~~~~~  259 (260)
T Consensus       298 ~~R~i~~p~e~pvGiitaliGaP~Fi-yLl~r  328 (334)
T COG0609         298 LARTILAPAEIPVGIVTALIGAPYFI-YLLRK  328 (334)
T ss_pred             HHHHCCCCCCCCHHHHHHHHHHHHHH-HHHHH
T ss_conf             99863473234589999999999999-99998