HHsearch alignment for GI: 254780719 and conserved domain: COG1079

>COG1079 Uncharacterized ABC-type transport system, permease component [General function prediction only].
Probab=90.75  E-value=0.95  Score=22.19  Aligned_cols=170  Identities=14%  Similarity=0.145  Sum_probs=79.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHCCHHHHHH---HHHHHHHHHHHHHHCCCCCCHHHHHHH
Q ss_conf             99998788999999879996435----89999999999999500366799---999999999986310357650456999
Q gi|254780719|r   16 IVLSTGPLGCFIIWQRIAYFGDT----IAHSALLGVALSLIFQLPLTICI---FMIATLTSLVLLQIQKNEALSSDAILG   88 (260)
Q Consensus        16 ~~~~~~~lG~~vv~rr~s~~~~a----lsH~a~~Gial~~~l~~~~~~ga---~~~~~l~al~i~~l~~~~~~~~da~ig   88 (260)
T Consensus        19 tPLllaaLG~l~sERsG-VlNIglEG~M~~gAf~~~~~~~~-t~spw~gl~~a~l~g~l~~ll~a~~ti~l~~nq-iisG   95 (304)
T COG1079          19 TPLLLAALGGLFSERSG-VLNIGLEGIMLLGAFSGALFAYG-TGSPWLGLLAAALVGALFGLLHAFLTIKLRANQ-IISG   95 (304)
T ss_pred             HHHHHHHHHHHHHHHHC-EEEECHHHHHHHHHHHHHHHHHC-CCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC-CHHH
T ss_conf             99999999888988722-14541314899999999999981-466899999999999999999999997614561-2248


Q ss_pred             HHHHH-HHHHHHHHHH-HCCCCHHHHHHH---------HHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHH-----HHHHH
Q ss_conf             99999-9999999996-213200133344---------33324422876705899998999999984245-----66541
Q gi|254780719|r   89 VITHS-TISLALVILS-FMKWVNTDLTSF---------LFGDILAVNTTDILLIWGIGFLNIMILFKIWK-----PLLAT  152 (260)
Q Consensus        89 i~~s~-~~alg~llls-~~~~~~~~l~~~---------LfG~il~v~~~dv~~~~~~~~~~~~~l~~~~r-----~l~~~  152 (260)
T Consensus        96 ~alnl~a~Glt~fl~~~~~~~~~~~~~~~~~p~l~~ip~~g~~~~~~--~-~~~y~ai~lv~~~~~~L~rTr~GL~lrav  172 (304)
T COG1079          96 LALNLLASGLTAFLGQSIFGQPGTTFQPIDIPGLSDIPVIGPALFGQ--S-PLVYLAILLVALVWYVLYRTRFGLRLRAV  172 (304)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCHHCCC--C-HHHHHHHHHHHHHHHHHHCCCCCEEEEEE
T ss_conf             99999998999999999863688877766776323476444110255--7-99999999999999997305246699982


Q ss_pred             CCCHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             2888999980898106776999999999999999988999999
Q gi|254780719|r  153 TVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITS  195 (260)
Q Consensus       153 ~fD~~~A~~~Gi~v~~~~~l~~~l~al~v~~~v~~vG~llv~a  195 (260)
T Consensus       173 GE~P~aad~~Gi~V~r~R~~av~~sG~la----GlaGa~Lsl~  211 (304)
T COG1079         173 GENPAAADAMGINVYRYRYLAVLVSGALA----GLAGAYLSLA  211 (304)
T ss_pred             CCCHHHHHHCCCCHHHHHHHHHHHHHHHH----HHHHHHEEEE
T ss_conf             69826788679875678899999999998----7535213555