HHsearch alignment for GI: 254780719 and conserved domain: COG1108

>COG1108 ZnuB ABC-type Mn2+/Zn2+ transport systems, permease components [Inorganic ion transport and metabolism].
Probab=100.00  E-value=0  Score=424.01  Aligned_cols=260  Identities=34%  Similarity=0.636  Sum_probs=255.5

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             90069899999999999998788999999879996435899999999999995003667999999999999863103576
Q gi|254780719|r    1 MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEA   80 (260)
Q Consensus         1 m~~~f~~~all~~~~~~~~~~~lG~~vv~rr~s~~~~alsH~a~~Gial~~~l~~~~~~ga~~~~~l~al~i~~l~~~~~   80 (260)
T Consensus         9 ~~~~f~~~alla~~li~~~~~~lG~flvlRr~sl~gdalsHa~L~Gval~~ll~~~~~~~a~~~~l~~a~~i~~l~~~~~   88 (274)
T COG1108           9 FQYDFMQNALLASLLIGIACGLLGTFLVLRRMSLMGDALSHAVLPGVALGFLLGINPLLGAFIFGLLAALLIGYLRRRSK   88 (274)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             88999999999999999999877599999889998549999999999999998126899999999999999999986124


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHH
Q ss_conf             50456999999999999999996213200133344333244228767058999989999999842456654128889999
Q gi|254780719|r   81 LSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAK  160 (260)
Q Consensus        81 ~~~da~igi~~s~~~alg~llls~~~~~~~~l~~~LfG~il~v~~~dv~~~~~~~~~~~~~l~~~~r~l~~~~fD~~~A~  160 (260)
T Consensus        89 ~~~D~aigiv~s~~~alGlvl~s~~~~~~~~l~~~LfG~il~V~~~dl~~~~ii~~i~l~~l~~f~r~ll~~~fD~~~A~  168 (274)
T COG1108          89 LKEDTAIGIVFSSGLALGLVLLSLVPSSRVDLMHYLFGDILAVSRSDLLLIAIIGALVLLLLLLFYRELLLLTFDPEFAR  168 (274)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHH
T ss_conf             22789999999999999999875246765449999954256078989999999999999999999999999626899998


Q ss_pred             HCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             80898106776999999999999999988999999999999999974199899999999999999999999999955880
Q gi|254780719|r  161 AEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS  240 (260)
Q Consensus       161 ~~Gi~v~~~~~l~~~l~al~v~~~v~~vG~llv~allv~Paa~A~~l~~~~~~~~~~s~~~g~~~~~~G~~lS~~~~lp~  240 (260)
T Consensus       169 ~~Gl~v~~~~~l~~~lisl~iv~~~k~VG~iLv~alLi~Paa~A~~lt~~~~~~~~ia~~~g~~s~~~Gl~lSy~~~~p~  248 (274)
T COG1108         169 VLGLNVRLLHYLLLVLLALTIVAAIKAVGALLVSALLIIPAATARLLTKSFRQMLIIAVLIGLLSSVLGLYLSYYLDLPS  248 (274)
T ss_pred             HCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             74985889999999999999999999999999999998699999999728999999999999999999999999707894


Q ss_pred             HHHHHHHHHHHHHHHHHHCC
Q ss_conf             89999999999999987239
Q gi|254780719|r  241 GPSIIITSLFLFILSFFYKK  260 (260)
Q Consensus       241 g~~Iv~~~~~~f~~~~~~~k  260 (260)
T Consensus       249 g~~Ivl~~~~~fl~~~l~~~  268 (274)
T COG1108         249 GPAIVLIAALLFLLSFLFGP  268 (274)
T ss_pred             HHHHHHHHHHHHHHHHHHHH
T ss_conf             59999999999999999874